Sunteți pe pagina 1din 132

Tratamentul diabetului zaharat

DZ este o boal cronic

Obiectivul principal: meninerea parametrilor clinici i biochimici specifici ct mai aproape de normal

Tratamentul trebuie privit n perspectiva speranei de via

Prevenia primar a DZ tip 1


Promovarea alimentrii copilului la sn Evitarea bolilor infecioase cu potenial diabetogen Evitarea substanelor toxice pancreatotrope Msuri farmacologice

Prevenia primar a DZ tip 2


Controlul greutii Promovarea activitii fizice Diete bogate n fibre i srace n grsimi Msuri farmacologice

Prevenia secundar prevenirea apariiei complicaiilor


Diagnostic precoce Controlul glicemiei (HbA1c) Tratamentul factorilor de risc vascular (obezitate, dislipidemie, hipertensiune) Evitarea fumatului Detectarea complicaiilor cronice n stadiul subclinic

Prevenia teriar
Tratamentul activ al complicaiilor cronice
Evitarea complicrii complicaiilor

Criteriile unui bun control metabolic


Glicemia preprandial: 80-110 mg/dl Glicemia postprandial: 100-145 mg/dl HbA1c: < 6,5 % Colesterol total: < 200 mg/dl Trigliceride a jeun: < 150 mg/dl

TA < 130 / 80 mm Hg (120 / 70 mm Hg)


IMC < 25 kg/m2 (B); < 24 kg/m2 (F)

Metode de tratament
Tratamentul dietetic

Exerciiul fizic

Tratamentul medicamentos (insulin i/sau ADO)

Educaia specific

Tratamentul dietetic
Locul dietoterapiei n tratamentul DZ Obiectivele tratamentului nutriional: - meninerea glicemiei la un nivel ct mai aproape de valorile normale - normalizarea profilului lipidic - asigurarea unui aport caloric adecvat - prevenirea i tratarea complicaiilor acute i cronice - creterea calitii vieii printr-o alimentaie adecvat

Recomandrile nutriionale generale pentru pacientul diabetic


Calorii Glucide: 55-60 % din aportul caloric Fibre alimentare: 30-40 g/zi Lipide: sub 30 % din calorii Colesterol: < 300 mg/zi Proteine: 12-15 % din aportul caloric Sodiu: < 6 g NaCl / zi; la hipertensivi < 3 g NaCl / zi Alcoolul Edulcorantele Vitamine i minerale

Etapele alctuirii unei diete


Precizarea caracteristicilor generale ale dietei Calculul aportului caloric Distribuia caloriilor pe cele 3 principii energetice - 55-60 % glucide - 25-30 % lipide (1/3 animale, 2/3 vegetale) - 12-15 % proteine (1/2 animale, 1/2 vegetale) Distribuirea glucidelor pe numrul de mese precizat - 20% - 10% - 30% - 10% - 20% - 10% Alegerea alimentelor Pregtirea corect a alimentelor (reguli de gastrotehnie)

Efortul fizic terapeutic - beneficii


Scade glicemia i HbA1c

Amelioreaz profilul lipidic


- TG - LDL-colesterolul

- HDL-colesterolul
Amelioreaz HTA uoar i moderat Adjuvant al dietei pentru scderea ponderal

Amelioreaz factorii de risc cardio-vascular


Crete tonusul psihic i calitatea vieii

Efortul fizic terapeutic - riscuri


Hipoglicemie Hiperglicemie dup eforturi fizice foarte intense Hiperglicemie i cetoz la pacienii insulino-deficieni Precipitarea i exacerbarea bolilor cardio-vasculare (angin pectoral, infarct de miocard, aritmii, moarte subit) Agravarea complicaiilor cronice ale DZ - retinopatie proliferativ: hemoragii vitreene, deslipiri de retin - nefropatie: proteinuria - neuropatie periferic: leziuni ale articulaiilor i ale es. moi - neuropatie vegetativ: scade rspunsul cardio-vascular la efort, hipotensiune ortostatic

Tratamentul insulinic
Istoric

Nicolae Paulescu 1869 - 1931

F.F.G. Banting

C.H. Best

J.B. Collip

J.R. MacLeod

Leonard Thompson

Principalele etape n dezvoltarea insulinoterapiei


Descoperirea insulinei (1921) Insuline "clasice" (convenionale) (1922) Insuline cu aciune prelungit (1936) Insuline NPH (1950) Insuline nalt purificate (monocomponent) (1978) Insuline umane (1982) Analogi de insulin (1996)

Clasificarea insulinelor
Dup provenien - animale - de tip uman

Dup durata de aciune - cu durat scurt de aciune - cu aciune intermediar - cu durat lung de aciune - insuline premixate

Insulinemia plasmatic la persoane cu diabet zaharat tip 1 i subieci sntoi


N=8 Subieci sntoi 480 400 320 N=24 DZ1

Insulin uman regular


Analog rapid de insulin

pmol/L

240

160
80 0
07:00

12:00

18:00

24:00

06:00 h

Momentul zilei

Disocierea insulinelor
Insulin uman regular
Vrf de aciune 2-4 hr

Analog rapid de insulin

Vrf de aciune 1 hr

Insulina LISPRO Humalog

S
21

A-chain
1

S S

S
1

B28 LYS B-chain

B29 PRO

30

Analogii rapizi de insulin

Glulisine

Analogii de insulin cu aciune lung

Insulina glargine (lantus)

Insulina detemir (levemir)

Preparate de insulin
Cu aciune scurt - Actrapid HM - Humulin R - Insuman Rapid Cu aciune intermediar - Insulatard HM - Humulin N (NPH) - Insuman Bazal Cu aciune lung - Monotard HM - Humulin L

Analogi de insulin
Analogi de insulin cu aciune (ultra)rapid - NovoRapid - Humalog - Apidra Analogi de insulin cu aciune lung - Lantus - Levemir

Insuline premixate - Mixtard 10 50 HM (Mixtard 30 HM)

- Humulin M1 5 (Humulin M3)


- Insuman Comb 25; Insuman Comb 50

Analogi premixai - NovoMix 30

- Humalog Mix 25, Humalog Mix 50

Profil de aciune

140

Nivelul insulinei (U/ml)

120 100 80 60

Aciune rapid (lispro, aspart, glulisine) Durat scurt (Regular) Intermediare (NPH) Aciune lung (glargine, levemir)
0 2 4 6 8 10 12 14 16

40
20 0

Ore

Scheme de insulinoterapie
Convenional

Intensificat

Insulinoterapia intensificat

Insuline prandiale Insuline bazale

Administrarea insulinei
Cile de administrare

Dispozitivele de administrare
Autocontrolul i ajustarea dozelor Pompa de insulin Indicaiile insulinoterapiei

Indicaiile insulinoterapiei n diabetul zaharat tip 2


Meninerea dezechilibrului glicemic n ciuda dozelor maxime de ageni orali combinai Hiperglicemie cu cetonemie i cetonurie Decompensarea generat de evenimente intercurente Managementul perioperator Sarcina i lactaia Hepatopatii i/sau nefropatii Alergia sau alte reacii adverse serioase la ADO Hiperglicemii importante n momentul prezentrii

Efectele secundare ale insulinoterapiei


Hipoglicemia Hipovolemia indus de insulin Creterea n greutate Reacii induse de anticorpii antiinsulin Lipodistrofia Abcesele la locul injeciei Edemul insulinic Neuropatia indus de insulin nceoarea vederii Agravarea retinopatiei diabetice Efecte adverse ale insulinei inhalatorii

Hiperglicemiile matinale
Subinsulinizarea

Fenomenul Somogyi

Fenomenul de zori (Dawn phenomenon)

Tratamentul cu preparate non-insulinice


Medicamente care cresc secreia pancreatic de insulin - sulfonilureice - reglatori prandiali ai glicemiei Medicamente care scad rezistena la insulin - biguanide - tiazolidindione Medicamente care scad absorbia intestinal de glucoz - inhibitori de alfa-glucozidaz Incretinele

Medicamente care cresc secreia pancreatic de insulin (secretagoge)


Canalul KATP cu cele dou componente: receptorul sulfonilureic (SUR 1) i canalul rectificator de K (Kir 6.2)

Ansamblul canalului

Componenta SUR

Componenta Kir 6.2

nchiderea canalului KATP prin legarea unei molecule de ATP la unul din cele 4 situsuri de pe SUR 1

Preparatele sulfonilureice
Agentul sulfonilureic Preparate comerciale Tolbutamid; 500 mg Diabinese; 250 mg Glibenclamid; 5 mg Maninil; 1,75; 3,5 mg Glucotrol; 5 i 10 mg Diaprel MR; 60 mg Glurenorm; 30 mg Amaryl; 1, 2, 3 i 4 mg Doza maxim 3000 mg 500 mg 15 mg 10,5 mg 10 mg 120 mg 90 mg 6 mg

Generaia I - tolbutamid - clorpropamid


Generaia a II-a - glibenclamid

- glipizid - gliclazid - gliquidona Generaia a III-a - glimepiride

Reglatorii prandiali ai glicemiei


Acelai mecanism de aciune ca al sulfonilureicelor
Durat scurt de aciune Risc hipoglicemic redus O mas o doz, nici o mas nici o doz Preparate: - Repaglinida (NovoNorm; 0,5 1 2 mg)

- Nateglinida (Starlix)

Medicamente care scad rezistena la insulin

Biguanidele
Mecanism de aciune Efecte adverse Contraindicaii Preparate: - fenformin - metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp = 500 mg, 850 mg, 1000 mg; doza maxim = 3000 mg) - buformin: Silubin Retard (1 cp = 100 mg; doza maxim = 300 mg)

Tiazolidindionele (glitazonele)
Mecanism de aciune: PPAR (peroxisome proliferator activated receptors)
Efecte adverse Preparate: - troglitazona - pioglitazona (Actos) (1 cp = 15; 30; 45 mg) - rosiglitazona (Avandia) (1 cp = 4 mg; doza maxim = 8 mg)

Medicamente care scad absorbia intestinal de glucoz Inhibitorii de alfa-glucozidaz


Mecanism de aciune

Efecte adverse
Preparate - acarboza (Glucobay, 1 cp = 50; 100 mg; doza maxim = 300 mg) - miglitolul

Incretinele

Secreia de insulin dup administrarea de glucoz oral / intravenos


oral intravenos
15 30 45 60 TIME (min) 75 90 200
D INSULIN (mU/L)

D GLUCOZ (mg/dl)

90 70 50 30 10 -10 -30 0

150 100 50 0 0 15

90

30

45 60 TIME (min)

75

McIntyre N. Lancet 1964; 2: 20-21

Efectul incretinic

Ingestia de glucoz determin un rspuns insulinic mai pronunat dect glucoza administrat intravenos, indicnd prezena unor substane secretate de tractul care stimuleaz eliberarea de insulin

gastrointestinal

printr-un mecanism glucodependent.

Creutzfeldt. Diabetologia 1985; 28: 565

Definiia incretinelor

Gut-derived factors that increase glucose-stimulated insulin secretion

In cret in

Intestine

Secretion

Insulin

Creutzfeldt. Diabetologia 1985; 28: 565

Efectul incretinic la persoanele sntoase i la pacienii cu diabet zaharat tip 2


Persoane sntoase
Oral IV Insulin (mU/l) Pacieni cu DZ tip 2

Insulin (mU/l)

Oral IV

Timp (min)

Timp (min)

Incretinele GLP-1: Glucagon-Like Peptide 1


H A E G T F T S D V S S Y L E G Q A A K A K F L R I V E W G G

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide A Y E G T F I S D Y S I A M D K I H Q K K G K A L L W N V F D Q D N W Q K T Q I N H
Drucker D. Diabetes Care 2003; 26: 2929

GIP Gastric inhibitory polypeptide Glucose-mediated insulinotropic polypeptide


GM: 4984
Eliberare: duoden, jejun, ileonul proximal

Aciuni: - inhibarea secreiei gastrice acide - stimularea secreiei de insulin - aciuni insulin-like asupra metabolismului lipidic

GLP-1 Glucagon-like peptide-1

GM: aprox. 4000


Eliberare: intestinul subire distal, colon

Aciuni: - stimularea secreiei de insulin - inhibarea golirii gastrice - aciuni insulin-like extrapancreatice - inhibarea apetitului

GLP-1
Glucoza Celula L Enterocit

Hipotalamus: Apetitul
GLP-1

Pancreas: Insulina Glucagonul

Stomac: Motilitatea

GLP-1
Alimente
stimuleaz secreia insulinic indus de glucoz inhib secreia de glucagon inhib golirea gastric

Celulele L GLP-1

inhib apetitul amelioreaz insulinosensibilitatea n studii experimentale crete masa -celular

Drucker DJ. Mol Endocrinol 2003; 17:161-171

Metabolism glucidic normal


Glucide alimentare
digestie absorbie

GIP

+
Celula

GLP-1

secreia de insulin euglicemie

Diabet zaharat tip 2


Glucide alimentare

GIP

GLP-1

Celula

Secreie de insulin hiperglicemie

GIP vs. GLP-1 GIP


42 aa Celulele K duoden

GLP-1

30-31 aa Celulele L ileon + colon Secreia de insulin Secreia de insulin Efect minim asupra golirii gastrice Golirea gastric Efect nesemnificativ asupra secreiei de glucagon Efect nesemnificativ asupra saietii i greutii corporale Masa -celular Secreia de glucagon Apetitul i greutatea corporal Masa -celular
Drucker D. Diabetes Care 2003; 26: 2929

GLP-1
M as Meal

Eliberare de Intestinal GLP-1 GLP -1 intestinal release

Active GLP-1 activ GLP-1

DPP-4

GLP-1 inactiv inactive

. Rothenberg P et al. Diabetes 2000; 49 (suppl.1): A39

Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

Inhibitori de DPP-4
Drucker. Diabetes Care 2003; 26: 2929 Dungan. Clin Diabetes 2005; 23: 56

Exenatida (Byetta)
Gila monster (Heloderma suspectum)
Aprobat de FDA (2005) i de EMEA (2006) pt. trat. DZ 2 Capt C-terminal bogat n reziduuri de prolin

Aciune de 10 ori mai intens dect a GLP-1 nativ


T1/2 mai lung

GLP-1 i Exenatida

GLP-1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402

Exenatida (Byetta, Bydureon)


Indicat n tratamentul DZ tip 2 necontrolat prin: - monoterapie cu metformin, sulfonilureice sau TZD - terapie oral combinat: metformin + sulfonilureice metformin + TZD Byetta Doza iniial: 5 g x 2/zi Adm. sc cu (pn la) 60 min. naintea meselor principale Dup o lun, doza se poate crete la 10 g x 2/zi Bydureon administrare o dat pe sptmn

Liraglutida
Derivat acil al GLP-1 Adugarea unei grupri de acizi grai activeaz legarea de albuminele plasmatice ntrzie eliminarea renal T1/2 ~ 12 ore Administrare injectabil o singur dat pe zi
Knudsen L et al. J Med Chem 2000; 43: 1664-1669

Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

Inhibitori de DPP-IV
Drucker. Diabetes Care 2003; 26: 2929 Dungan. Clin Diabetes 2005; 23: 56

GLP-1
M as Meal

Eliberare de Intestinal GLP-1 GLP -1 intestinal release

Active GLP-1 activ GLP-1

DPP-4
Inhibitor de DPP-4

GLP-1 inactiv inactive

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39

Inhibitori de DPP-4

Sitagliptina (Januvia) - inhibitor competitiv, reversibil i nalt selectiv al DPP-4 - aprobat de FDA (2006) i de ANM (2007) pt. trat. DZ 2

Vildagliptina (Glavus) - se leag de DPP-4 complex inactiv

Sitagliptina (Januvia)

Indicat n tratamentul DZ tip 2 necontrolat prin: - monoterapie cu metformin, sulfonilureice sau TZD - terapie oral combinat: metformin + sulfonilureice

Doza recomandat: 100 mg/zi (doz unic), indiferent de orarul meselor

Efecte non-glicemice ale incretinelor


Analogii de GLP-1 - scdere n greutate progresiv i dependent de doz - uoar reducere a LDL-colesterolului - ameliorare a funciei ventriculare la pacienii post-IM
Inhibitorii de DPP-4 - efecte neutre asupra greutii - uoar reducere a TG i o cretere a HDL-colesterolului

Efecte adverse ale incretinelor


Analogii de GLP-1 - greuri i vrsturi (50% dintre pacieni) - dependente de doz - se amelioreaz pe parcursul tratamentului - diaree - hipoglicemii uoare i moderate (cnd se asociaz cu SU) Inhibitorii de DPP-4 - cefalee - susceptibilitate pentru infecii de ci aeriene superioare

Algoritmul de tratament n DZ 2

Dieta i exerciiul fizic


Antidiabetice orale Asocieri de antidiabetice orale

Insulin antidiabetice orale

ADA/EASD Ghid (2006)


Lifestyle + metformin If HbA1c 7% Add sulphonylurea Add basal insulin If HbA1c 7% Add glitazone Add basal insulin Intensify insulin If HbA1c 7% Further intensify insulin or add basal insulin + metformin insulin sensitiser
Bailey C et al. Br J Diabetes Vas Dis 2006; 6: 147148.

Add glitazone

Add basal insulin

Add sulphonylurea

Preparate combinate de ADO


Preparate combinate glibenclamid + metformin Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg 5 mg/500 mg

Preparate combinate TZD + metformin Competact 15 mg/850 mg Preparate combinate inhibitori DPP-4 + metformin Janumet 50 mg/850 mg 50 mg/1000 mg

Dislipidemiile

Definirea termenilor
Dislipidemii Hiperlipidemii Valorile normale - colesterol seric total < 190 mg/dl (< 5 mmol/l) - trigliceride serice < 180 mg/dl (< 2 mmol/l) - colesterol - HDL > 40 mg/dl (> 1 mmol/l) - colesterol - LDL < 115 mg/dl (< 3 mmol/l) Obiectivele terapeutice

Importana dislipidemiilor

Impactul epidemiologic - boli populaionale - n Romnia: 55% din populaia ntre 20 i 60 ani
Impactul biologic: risc cardio-vascular risc de pancreatit acut

Impactul economic

Lipoproteinele
Asocieri moleculare dintre diferite componente lipidice sanguine (TG, colesterol, fosfolipide, AG) i proteinele circulante Constituite din: - partea transportat: AG esterificai sub form de TG i esteri de colesterol - transportorul: apoproteine Rolul apoproteinelor: - structural - funcional: legarea de receptori activarea sau inhibarea unor enzime (LPL, LCAT)

Clase majore lipoproteice


Chilomicronii 90% TG

VLDL 60% TG, 12% colesterol


IDL forme tranzitorii; 30% colesterol, 40% TG

LDL 60% colesterol - fenotip A - fenotip B - fenotip intermediar


HDL

Clasificarea dislipidemiilor (Frederickson)


Tipul I chilomicronemie bazal
Tipul IIa hiper - LDL Tipul IIb hiper - LDL i hiper - VLDL Tipul III cu IDL n condiii bazale Tipul IV hiper VLDL Tipul V chilomicronemie bazal + hiper - VLDL

Tipul VI hiper - HDL

Clasificarea dislipidemiilor (Asociaia European de ateroscleroz)


Forma de dislipidemie
Hipercolesterolemie - de grani - moderat - sever Hipertrigliceridemie - moderat - sever

Colesterol
190-249 250-300 > 300 < 190 < 190 190-300 > 300

Trigliceride
< 180 < 180 < 180 180-400 > 400 180-400 > 400

Hiperlipidemie mixt - moderat - sever

Etiopatogenia dislipidemiilor
Factori genetici - defect cromozomial monogenic (ex. HLP tip IIa) - defect cromozomial poligenic Factori ctigai - excesele alimentare - abuzul de alcool - fumatul - sedentarismul - stress-ul - obezitatea - diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic - unele medicamente: corticoizii, contraceptivele orale

Mecanisme patogenetice
Creterea sintezei sau produciei lipoproteice - diet hipercaloric, hiperlipidic, hipercolesterolic, bogat n glucide simple fluxul de AGL spre ficat VLDL IDL i LDL
Diminuarea catabolismului lipoproteic - activitii LPL hiperchilomicronemie i/sau VLDL - absena receptorilor LDL sau activitii lor LDL - anomalii ale Apo E IDL nu mai sunt recunoscute de receptorii LDL hiperlipidemia mixt sever Combinarea mai multor factori i mecanisme de producere

Tablou clinic
Xantoame de tip eruptiv, tendinos, tuberos, palmar Xantelasma Arc cornean Lipemia retinalis

Dureri abdominale, manifestri de pancreatit


Manifestri ale ATS cerebrale, coronariene i periferice Simptome osteo-articulare (rar)

Investigaii paraclinice
Aprecierea aspectului plasmei sau serului dup 24 de ore de la recoltare i pstrare la frigider (+ 40C) Dozarea colesterolului total i a TG Dozarea HDL-colesterolului Calculul LDL-colesterolului (formula lui Friedwald): LDL-col = colesterol total HDL-col TG/5 (mg/dl) LDL-col = colesterol total HDL-col TG/2,2 (mmol/l) Condiie: TG < 400 mg/dl Alte metode (electroforeza, ultracentrifugarea, dozarea apoproteinelor)

Depistarea dislipidemiilor

Ideal: screening sistematic la ntreaga populaie cu vrsta > 20 ani

Practic: la grupele cu risc crescut

Grupele cu risc crescut la care se recomand depistarea dislipidemiilor

1. 2. 3. 4.

Bolnavi cu boli cardio-vasculare aterosclerotice Persoane cu factori de risc cardiovascular Persoane cu arc cornean sau xantomatoz Rudele de gradul I ale persoanelor de la punctele 1 i 2

Depistarea complet - determinarea CT, TG, HDL-col - recoltare dimineaa, dup 8-12 ore de post - recomandat la persoane cu boli cardio - vasculare ATS DZ xantomatoz Depistarea parial - determinarea doar a colesterolului total - recoltare n orice moment al zilei - recomandat la persoanele care au i ali factori de risc rudele de gradul I ale celor cu BCV ATS alte persoane care se prezint la consultaie

Dislipidemiile aterogene

Hipercolesterolemie de grani (190-249 mg/dl)

Hipertrigliceridemie > 180 mg/dl


Scderea colesterolului HDL < 40 mg/dl la brbai < 50 mg/dl la femei Modificarea LDL care devin mici i dense

Dislipidemiile secundare
Hipercolesterolemii hipotiroidie, colestaz, sindrom nefrotic, sarcin, medicaie cu tiazide i progesteron Hipertrigliceridemie DZ necontrolat, sindrom nefrotic, insuficien renal cronic, paraproteinemie Hiperlipidemie mixt DZ necontrolat, sindrom nefrotic, medicaie cu tiazide, corticosteroizi, progestageni

Complicaii i asocieri morbide


Patologia cardio-vascular aterosclerotic Pancreatita acut Diabetul zaharat Obezitatea Hipertensiunea arterial Sindromul X metabolic

Management-ul dislipidemiilor

Stabilirea obiectivelor Optimizarea stilului de via - dieta hipolipidic - exerciiul fizic

Tratamentul medicamentos

Principiile dietei hipolipidice


Adaptarea aportului caloric n funcie de necesiti i greutatea corporal Reducerea aportului caloric provenit din lipide < 30% Scderea lipidelor saturate la 1/3 din totalul lipidelor Lipidele mononesaturate i cele polinesaturate (forma cis) vor reprezenta baza aportului lipidic (cte 1/3) Scderea aportului de colesterol < 300 mg/zi Creterea aportului de glucide complexe (50-55%) Fibrele alimentare 20-30 g/zi Glucidele simple 10% din necesarul caloric Alcoolul va fi suspendat sau mult limitat Evitarea fumatului

Dieta trebuie negociat cu pacientul Control la 3 luni Scade colesterolul cu 10-20%

Exerciiul fizic
Scade trigliceridele Crete HDL-colesterolul

Tratamentul medicamentos Rezinele (Colestiramina)


Mecanism de aciune - blocheaz circuitul enterohepatic al acizilor biliari - activeaz transformarea colesterolului n acizi biliari - stimuleaz captarea LDL pe calea receptorilor LDL Efecte secundare - disconfort abdominal, constipaie, diaree, creterea TG, absorbiei altor medicamente Contraindicaii - obstrucie biliar complet, ulcer peptic, sarcin Monitorizare - leucocite

Acidul nicotinic i derivaii (Acipimox)


Mecanism de aciune - inhib eliberarea AG din depozite - sinteza i secreia de VLDL Efecte secundare - prurit, greuri, congestia feei, vrsturi Contraindicaii - insuficien hepatic, infarct miocardic recent, cardiopatie congestiv, gut, sarcin, ulcer gastric Monitorizare - glicemie, teste funcionale hepatice, acid uric

Uleiul de pete
Conine AG polinesaturai omega 3 Inhib sinteza i secreia de VLDL

Fibraii
Mecanism de aciune - PPAR exprimarea genei LPL exprimarea genei Apo A I i Apo A II diminuarea genei Apo C activeaz LPL stimuleaz catabolismul LDL i VLDL inhib lipoliza TG din adipocite concentraia LDL mici i dense HDL de volum crescut hiperlipemia postprandial fibrinogenul efect antitrombogen

Efecte secundare - disconfort abdominal, greuri, erupii, mialgii (miopatie), efectul anticoagulantelor Contraindicaii - insuficien hepatic, renal, sindrom nefrotic, sarcin, alptare Monitorizare - teste funcionale hepatice, creatin-kinaza

Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil

Statinele
Mecanism de aciune - inhib HMG-CoA reductaza, deci sinteza colesterolului - sinteza receptorilor LDL, deci catabolizarea acestuia - procentul de LDL mici i dense - oxidabilitatea LDL - fibrinogenul, Lp(a), PAI-1 efecte favorabile pe sistemul de coagulare-fibrinoliz
Efecte secundare flatulen, enzimelor hepatice i musculare, erupii

Contraindicaii boli hepatice active, sarcin, alptare

Monitorizare - teste funcionale hepatice, creatin-kinaza

Preparate - rosuvastatin, atorvastatin, simvastatin, pravastatin, lovastatin, fluvastatin

Indicaii de utilizare a claselor de hipolipemiante


Tipul de hiperlipidemie Prima alegere Hipercolesterolemie Hipertrigliceridemie Hiperlipidemie mixt Statine Fibrai Alternativ Rezine, acid nicotinic, fibrai Acid nicotinic, ulei de pete

Fibrai, statine Acid nicotinic

Asocieri medicamentoase recomandate


Colestiramin + statine Fibrai + statine

Obezitatea

Definiie - obezitatea este o boal caracterizat prin creterea greutii corporale pe seama esutului adipos

Etimologie - obedo-obedere (lat) = a mnca n exces, a mnca mult i lacom

Prevalen - n lume > 250 milioane obezi - n 2025 > 300 milioane obezi

Prevalena supraponderii i a obezitii n rile europene

Obezitatea problem major de sntate public

Prevalen crescut la nivel populaional

Costuri directe i indirecte ridicate implicate de ngrijirea obezitii

Complicaii multiple

Formule de calcul a greutii ideale


Formula lui Broca: GI = I 100
Formula lui Lorentz: GI = (I 100) (I 150)/4 (B) GI = (I - 100) (I 150)/2 (F) Formula Societii Asigurrilor Metropolitane din New York: GI = 50 + 0,75(I 150) + (V 20)/4 (B) F: GI (B) X 0,9

Indici de apreciere a obezitii


Indicele de mas corporal: IMC = G/I2 (n = 18,5 24,9 kg/m2) Indicele abdomino-fesier: IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95) Indicele abdominal: IA = CA / I (n < 0,5) Grosimea paniculului adipos n regiunea tricipital: n < 20 mm (B); n < 30 mm (F) CA: n < 94 cm (B); n < 80 cm (F)

Clasificarea greutii n funcie de valorile IMC (Kg/m2)

Subponderal Normal Supraponderal Obezitate gradul I


Obezitate gradul II Obezitate gradul III

< 18,5 18,5 - 24,9 25 29,9 30 34,9


35 39,9 40

Clasificarea obezitii n funcie de distribuia esutului adipos


Tipul obezitii Abdominal Gluteo-femural Talia (cm) B 94 < 94 Talia (cm) F 80 < 80

Riscul cardiovascular n funcie de talie i sex


Risc sczut
Brbai Femei < 94 < 80

Risc probabil
94 101 80 87

Risc cert
102 88

Clasificarea obezitii
Criteriul etiopatogenic - obezitate primar - obezitate secundar
Criteriul histologic - obezitate hiperplazic - obezitate hipertrofic - obezitate mixt Criteriul evolutiv - obezitate dinamic (faza de acumulare) - obezitate static (de regul cnd a atins maximul ponderal)

Schema general de producere a obezitii


Factori genetici Factori ctigai Dezechilibru energetic: Aportul energetic > cheltuiala energetic Acumulare de trigliceride n adipocite - Cretere n greutate: obezitate

- Acumulare selectiv intraabdominal


de esut adipos: obezitate abdominal

Organismul normoponderal adult EA = EC (MB + TM + TR + ADS)


Organismul obez EA = EC + ED EA = energie de aport EC = energie de consum MB = energie consumat pentru nevoile bazale TM = travaliu muscular TR = energie de termoreglare ADS = aciunea dinamic specific a alimentelor

Principalii factori de risc obezogen (1)


Factori genetici istoric familial de obezitate

Subnutriia mamei gestante, greutate mic la natere a ftului


Stil de via nesntos alimentaie hipercaloric, alcool, sedentarism, stress Factori psihologici, sociali i culturali - depresia, anxietatea tulburri de comportament alimentar - urbanizarea - obiceiuri alimentare nesntoase - lipsa aciunilor de educaie i prevenire la nivel populaional - mentaliti greite

Principalii factori de risc obezogen (2)


Tulburri de comportament alimentar gustri interprandiale de alimente bogate caloric, bulimie, binge eating, night eating, carbohydrate-craving Factori fiziologici sarcin, lactaie, menopauz Factori endocrini i hipotalamici Medicamente Ali factori ntreruperea fumatului n absena unei diete corespunztoare

Mortalitatea
Riscul cel mai mic: IMC = 20 25 27 Kg/m2 excesiv la IMC > 30 Kg/m2 IMC sczut neoplasme IMC crescut boli cardio-vasculare Durata medie de supravieuire cu 10 ani mai mic Efectul fluctuaiilor greutii

Complicaiile cardio-vasculare ale obezitii


Boala coronarian

Insuficiena cardiac
Aritmiile i moartea subit Hipertensiunea arterial Varicele membrelor inferioare

Complicaiile respiratorii ale obezitii


Hipoventilaie hipoxie i hipercapnie tulburri nervoase centrale (somnolen, convulsii) Hipoxemia poliglobulie secundar volumul sanguin HTP CPC IVD ICCG 1956, Burnwell Sdr. Pickwick obezitate marcat, hipoventilaie, somnolen, uneori convulsii, cianoz, respiraie periodic, policitemie secundar, HVD, CPC decompensat Pneumopatii acute i bronite Dispnee, chiar n lipsa insuficienei cardiace Sindromul apneei n timpul somnului

Complicaiile digestive ale obezitii


Litiaza biliar Angiocolecistite Herniile hiatal, inghinal, ombilical Steatoza hepatic Hemoroizi

Tulburri endocrine
Distrofie ovarian (ovare polichistice) Tulburri ale ciclului menstrual Hiperestrogenism i hiperandrogenism la femei Hipogonadism la brbai

Cancerele
La B: prostat, colorectal La F: endometru, sn, ci biliare, col uterin, ovar

Complicaiile metabolice ale obezitii


Diabetul zaharat Hiperlipidemia Hiperuricemia

Complicaiile la nivelul aparatului locomotor


Reumatism cronic degenerativ Osteoartrite de old i de genunchi Boli periarticulare tendinite

Complicaiile neurologice i psihice


Cefalee, vertij, astenie fizic Tulburri psihice

Complicaiile chirurgicale ale obezitii


Risc chirurgical i anestezic mai mare Risc de insuficien respiratorie, infecii ale plgilor, dehiscena plgilor, tromboflebite postoperatorii

Complicaiile obstetricale ale obezitii


Eclampsie, varice, tromboflebite, infecii urinare, diabet gestaional, mortalitate fetal crescut Distocii Retracie uterin ntrziat hemoragii, oc; endometrite, accidente mamare, pielonefrite

Complicaiile cutanate
Infecii microbiene i fungice (intertrigo inghinal, axilar) Eczeme

Tratamentul obezitii n funcie de IMC


IMC (kg/m2) > 27 > 30 Co-morbiditi Tratament Da sau nu Educaie privind schimbarea stilului de via Nu Educaie i program de modificare a obiceiurilor Da Educaie, program de modificare a obiceiurilor i medicamente Diet hipocaloric, medicamente

> 30

> 35

Da sau nu

> 40

Da

Toate cele enumerate anterior i metode chirurgicale

Principiile tratamentului dietetic n obezitate


Glucide: 55-58% Proteine: 15-17% Lipide: 27-28% NaCl: < 6 g 5 mese pe zi Mic dejun: 20% Gustare: 15% Prnz: 30%

Fibre alimentare: 20-30 g


Colesterol: < 300 mg Lichide: > 2 litri

Gustare: 15%
Cina: 20%

Tipuri de diete utilizate n obezitate

Dieta cu deficit de 500 kcal/zi


Dieta cu deficit de 1000 kcal/zi Dieta hipocaloric standard de 1200-1300 kcal/zi Reducerea la jumtate din aportul caloric anterior Dietele foarte hipocalorice sau restrictive sub 800 kcal/zi

Rolul efortului fizic n tratamentul obezitii


Crete sensibilitatea esuturilor la insulin

Determin scdere n greutate i menine greutatea dorit


Scade riscul cardiovascular Scade necesarul de ageni farmacologici Crete capacitatea de efort Crete calitatea vieii

Tratamentul medicamentos al obezitii

Orlistat (Xenical)
Inhib selectiv lipaza gastrointestinal absorbia grsimilor cu 30% (TG i colesterol)

Aciuni i efecte - reducerea greutii pe seama masei grase - reducerea taliei i a IMC - reducerea RCV prin reducerea celorlali FR ( col total, LDL, TG, ameliorarea toleranei la glucoz, a TA) Reacii adverse - digestive (n condiiile unui aport lipidic crescut) - nivelului plasmatic al vitaminelor liposolubile

Contraindicaii sindrom de malabsorbie


Posologie 3 x 120 mg / zi la mesele principale

Tratamentul chirurgical al obezitii

Indicaii
IMC 40 kg/m2 IMC 35 kg/m2 cu comorbiditi Vrsta ntre 18 i 60 ani

Eecul tratamentului conservator aplicat cel puin un an


Pacient care va coopera pe termen lung dup operaie

Tratamentul chirurgical al obezitii Contraindicaii


IMC < 35 kg/m2 Vrsta sub 18 ani sau peste 60 de ani

Obezitate de cauz endocrin


Dependena de droguri sau alcool Risc operator inacceptabil Boli asociate grave: hepatopatie, cardiopatie, patologie digestiv

Tehnici chirurgicale Tehnici restrictive


- gastroplastia orizontal - gastroplastia vertical - bandingul gastric

Tehnici de malabsorbie
- by-pass-ul jejunoileal - by-pass-ul bilio-intestinal - by-pass-ul bilio-pancreatic

Hiperuricemiile

Definirea termenilor
Hiperuricemia

Artrita acut uric


Artrita gutoas cronic i tofii gutoi (guta cronic tofacee) Nefropatia uric Litiaza renal uric

Epidemiologie
Prevalena hiperuricemiilor - 2 18% - n Romnia 4,2% la aduli Prevalena gutei - 0,13 0,37% - 2 5% din totalul artropatiilor Sexotropism masculin Vrf de inciden - decada a 5-a de vrst

Clasificarea hiperuricemiilor
Primare - Idiopatic (> 99%) - Defecte metabolice specifice motenite (<1%) Secundare - Deficitul de glucozo-6-fosfataz (boala von Gierke) - Hemolize cronice: anemii hemolitice, leucemii, limfoame - Mecanisme renale - insuficien renal familial progresiv - insuficien renal cronic dobndit - medicamente (diuretice, citostatice) - produi metabolici endogeni (lactat, corpi cetonici)

Tratamentul dietetic n hiperuricemii


Diet srac n purine Tratamentul obezitii Reducerea consumului de alcool Diet lacto-fructo-zaharat

Tratamentul atacului acut de gut

Colchicina

AINS
Glucocorticoizii (po sau intraarticular)

NU hipouricemiante
Profilaxia recurenelor

Prevenirea formrii depozitelor tisulare de urai i diminuarea sau dispariia celor constituite
Inhibitorii biosintezei acidului uric - allopurinol, oxipurinol, tiopurinol

Medicaia uricoeliminatoare - probenecidul - benziodarona - sulfinpirazona

Indicaiile uricofrenatoarelor - litiaza renal cert sau colici nefretice eliminare de calculi n antecedente - uraturie > 700 mg/24 ore - coexistena unor afeciuni care contraindic aportul excesiv de lichide (IR sever, sdr. nefrotic, HTA) Indicaiile uricoeliminatoarelor - uraturie < 700 mg/24 ore - absena litiazei renale sau a colicilor renale n antecedente - cnd hiperuricemia e datorat tratamentului diuretic al HTA - cnd e posibil cura de diurez i alcalinizarea urinei

Sindromul X metabolic

Definiia sindromului X metabolic (IDF, 2005)


Obezitate abdominal (CA 94 cm la B / 80 cm la F)

+
Oricare 2 din urmtoarele 4 elemente: TG 150 mg/dl HDL < 40 mg/dl la B i < 50 mg/dl la F TAs 130 mm Hg sau TAd 85 mm Hg Glicemie a jeun 100 mg/dl