Sunteți pe pagina 1din 200

Universitatea din Bucureti

Facultatea de Biologie
coala Doctoral de Biologie

Tez de doctorat

Coordonator tiinific:
Prof. dr. Veronica LAZR
Doctorand:
Irina GHEORGHE

2014

Investete n oameni!
Proiect cofinanat din Fondul Social European prin Programul Operaional Sectorial pentru Dezvoltarea Resurselor
Umane 2007 2013
Axa prioritar: 1 Educaia i formarea profesional n sprijinul creterii economice i dezvoltrii societii bazate pe
cunoatere
Domeniul major de intervenie: 1.5 Programe doctorale i postdoctorale n sprijinul cercetrii
Titlul proiectului: Programe doctorale i post-doctorale de excelen pentru formarea de resurse umane nalt calificate pentru
cercetare n domeniile tiinele Vieii, Mediului i Pmntului
Cod proiect: POSDRU/159/1.5/S/133391
Beneficiar: Universitatea din Bucureti

Markeri fenotipici i moleculari de rezisten la antibioticele


betalactamice la tulpini de bacili Gram negativi non
fermentativi oportuniti
Conductor doctorat: Prof. Dr. Veronica Lazr
Doctorand: Irina Gheorghe

2014

Cercetrile tiinifice care au dus la realizarea acestei teze de doctorat


au fost realizate cu suportul financiar al Programului Operational
Dezvoltarea Resurselor Umane 2007 2013, cofinantat prin Fondul
Social

European,

POSDRU/159/1.5/S/133391

cadrul

proiectului

cu

ID:

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

CUPRINS

INTRODUCERE...4
I. PARTEA TEORETIC7
CAPITOLUL 1. CARACTERIZAREA GENERAL A BACILILOR GRAM
NEGATIVI NON-FERMENTATIVI (BGNNF) OPORTUNITI...........................................7
1.1. Pseudomonas aeruginosa.............................................................................................8
1.1.1. Habitat.........................................................................................................8
1.1.2. Morfologie, caractere de cultur i cretere................................................9
1.1.3. Factori de virulen i rezistena la antibiotice...........................................9
1.1.3.1. Etapele infeciei cu P. aeruginosa i factorii de virulen implicai.........11
1.1.3.2. Interaciunea gazd-agent patogen ......................................................12
1.1.3.3. Mecanisme de rezisten.........................................................................15
1.1.4. Implicarea speciei P. aeruginosa n patologia uman..............................18
1.2. Burkholderia pseudomallei....19
1.3. Complexul Burkholderia cepacia...20
1.4. Ralstonia pickettii..20
1.5. Brevundimonas vesicularis.21
1.6. Brevundimonas diminuta21
1.7. Stenotrophomonas maltophilia...21
1.7.1. Morfologie, caractere de cultur i cretere ..22
1.7.2. Habitat...23
1.7.3. Factori de virulen.......24
1.7.4. Manifestri clinice ale infeciilor cu S. maltophilia........25
1.8. Genul Acinetobacter27
1.8.1. Morfologie, caractere de cultur i cretere..27
1.8.2. Manifestri clinice ale infeciei cu A. baumannii28
CAPITOLUL 2. MECANISME DE REZISTEN ALE BACILILOR GRAM
NEGATIVI NON-FERMENTATIVI LA ANTIBIOTICELE -LACTAMICE..30
2.1. Mecanisme de rezisten natural...30
2.2. Mecanismele rezistenei dobndite.31
2.2.1. Rezistenta mediat cromosomal......31
2.2.2. Rezistena plasmidial ...............................................32
2.2.3. Rezistena mediat prin elem ente genetice transpozabile....35
2.2.3.1. Transpozonii...35
2.2.3.2. Integronii.....37
2.3. Rezistena BGNNF la principalele clase de antibiotice...............................................39
2.3.1 Rezistena la antibioticele -lactamice........................................................................39
-1-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

2.3.1.1. Mecanismele de aciune ale antibioticelor -lactamice...40


2.3.1.1.1.Ptrunderea -lactaminelor n celule la bacterii Gram negative...40
2.3.1.1.2. Producerea de -lactamaze..............................................................................42
2.3.1.1.2.1. Clasificarea -lactamazelor..42
2.3.1.1.2.1.1. Clasificarea -lactamazelor n funcie de spectrul de activitate.43
2.3.1.1.2.1.2. Clasificarea -lactamazelor pe baza secvenei moleculare i tipul
de molecule hidrolizate........................................................................................................43
2.3.1.1.2.3. Rezistena prin impermebilitate.51
2.3.1.1.2.4. Mecanismele de eflux......51
2.3.2. Rezistena la aminoglicozide ...52
2.3.3. Rezistena la quinolone...53
II. Contribuii originale privind studiul markerilor fenotipici i molecular i de rezisten la
antibioticele -lactamice la tulpini de BGNNF oportuniti

SCOPUL SI OBIECTIVELE STUDIULUI54

CAPITOLUL 3
Obiectivul 1. EVIDENIEREA FENOTIPIC A ANTIBIOREZISTENEI LA TULPINI
DE BGNNF IZOLATE DE LA PACIENI SPITALIZAI..................................................56
Materiale i metode......................................................................................................................57
Rezultate i discuii......................................................................................................................65
Concluzii......................................................................................................................................89
Obiectivul 2. EVIDENIEREA GENOTIPIC A ANTIBIOREZISTENEI L A TULPINI
DE BGNNF.91
Materiale i metode.....................................................................................................................92
Rezultate i discuii......................................................................................................................98
Concluzii....................................................................................................................................120
Obiectivul 3. CARACTERIZAREA GENETIC A TULPINILOR DE P. AERUGINOSA
BLAVIM-2 I A. BAUMANNII BLAOXA-23 REZISTENTE LA CARBAPENEME
CIRCULANTE N ROMNIA.....121
Materiale i metode...................................................................................................................123
Rezultate i discuii...................................................................................................................140
Concluzii...................................................................................................................................154
Capitolul 4. CONCLUZII GENERALE.................................................................................156
Lucrri publicate pe parcursul elaborrii tezei.........157
Bibliografie.....160
ANEXE...175

-2-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

List de abrevieri
BGNNF= bacili Gram negativi non fermentativi
MBL = metalo--lactamaze
CHLD = -lactamaze din clasa D
CG I = cefalosporine de generaia I
CG II = cefalosporine de generaia a II- a
CG III = cefalosporine de generaia a III- a
CG IV= cefalosporine de generaia a IV- a
ESBL = BLSE = extended spectrum -lactamases = -lactamaze de spectru extins
MDR = Multi Drug Resistance = multirezisten
PDR = Pan Drug Resistance = panrezisten
XDR = Extended Drug Resistance = rezisten extins
SI = secven de inserie
PFGE = electroforez pe gel n cmp pulsator
FTIR-ATR = Fourier Transform Infrared Spectroscopy with Attenuated Total Reflectance
MLST = Multilocus Sequence Typing
INBCV = Institutul Naional de Boli Cardiovasculare
SCF = Spitalul Clinic Fundeni
VIM = Verona imipenemase
SPM = Sa Paolo metallo--lactamase
GIM = German imipenemase
AIM = Adelaide imipenmase
SIM = Seoul imipenemase
GES = Guyana Extended Spectrum -lactamase
PER = Pseudomonas aeruginosa extended resistance
TEM = for Temoneira patients name
SHV = Sulfhydryl Variable enzyme
CTX-M = Cefotaxime first isolated in Munich
VEB = Vietnamese Extended Spectrum -lactamase
ECDC = European Center Disease Control
AmpC = cefalosporinaz inductibil
PBRT = PCR - Based Replicon Typing

-3-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

INTRODUCERE

Grupul bacililor Gram negativi a cror pondere n patologia infecioas a crescut mult n
ultimul timp, include bacilii fermentativi respectiv enterobacteriile i bacilii non fermentativi
(BGNNF). Frecvena lor de izolare se datoreaz pe de o parte, creterii numrului de pacieni
imunodeprimai, iar pe de alt parte dobndirii unor factori genetici de rezisten la antibiotice
sau a unor factori de virulen care le determin c ondiia de patogeni oportuniti, aceste aspect e
constituind i obiectul de studiu al lucrrii de fa.
Primele dou capitole ale tezei reprezint partea de documentare tiinific a lucrrii i
prezint o caracterizare general a principalelor specii de BGNNF i evidenierea mecanismelor
de rezisten la antibiotice -lactamice i non -lactamice la speciile analizate.
Bacilii Gram negativi non fermentativi din speciile Pseudomonas aeruginosa i
Acinetobacter baumannii sunt responsabili de mare parte din infeciile nosocomiale, fiind
patogeni oportuniti responsabili de infecii severe la pacienii imunocompromii. Tratamentele
tradiionale ale bolilor infecioase bazate pe compui cu aciune microbiostatic sau microbicid
au condus, datorit utilizrii excesive, la selectarea i evolu ia fenomenelor de multirezisten,
rezisten extins i chiar panrezisten la antibiot ice.
P. aeruginosa, A. baumannii i Stenotrophomonas maltophilia prezint anumite trsturi
comune, ca de exemplu: prezena n mediul extern, rezistena intrinsec la o serie de antibiotice
i capacitatea de a determina o serie de infecii asociate dispozitivelor medicale. Multirezistena
este frecvent prezent la tulpini izolate din clinic, astfel c un numr tot mai ridicat de tulpini
au fost semnalate ca prezentnd rezisten la majoritatea antibioticelor folosite n mod curent:
peniciline, cefalosporine, carbapeneme, aminoglicozide, tetracicline, fluoroquinolone i
trimethoprim sulfamethoxazol.
Tulpinile aparinnd speciilor menionate mai sus au capacitate ridicat de rspndire pe
orizontal n mediul spitalicesc i de a dobndi o serie de determinani genetici mobili. n cazul
fiecreia dintre ele factorii predispozani ai gazdei sunt asociai cu evoluia unui proces infecios.
Dac n urm cu 10 ani A. baumannii era complet necunoscut ca agent etiologic al
infeciilor nosocomiale, n prezent este o specie comun n mediul spitalicesc, persistena fiind
-4-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

condiionat de rezistena la desicaie, ca i rezistena la dezinfectani. Supravieuirea i


multiplicarea pe suprafaa tegumentului i a mucoaselor este rezultatul selectrii unor clone multi
i panrezistente la aciunea agenilor antimicrobieni i a mecanismelor locale de aprare.
A. baumannii are capacitatea de a coloniza dispozitive medicale i de a dezvolta biofilme
(Karthika i colab., 2008). De cele mai multe ori, sursa bacteriemiei determinate de A. baumannii
este reprezentat de cateterele intravasculare pe suprafaa crora poate dezvolta biofilme.
Dezvoltarea de biofilme explic rezistena crescut la aciunea unui spectru larg de
antibiotice chiar i la cele care sunt sensibile atunci cnd sunt testate prin metode standard ca
celule n suspensie. Celulele nglobate n biofilm prezint o rezisten de tip special, consecutiv
dezvoltrii acestei comuniti, numit rezisten comportamental sau toleran, pentru a evita
confuzia cu rezistena mediat de factori genetici de rezisten. Deci chiar dac sunt sensibile
atunci cnd sunt n suspensie, testate prin metoda standard de determinare a concentraiei minime
inhibitorii, cnd sunt aderate i nglobate n matricea unui biofilm, celulele sunt rezistente la
dozele uzuale de antibiotic, calculate pe baza C.M.I. n plus, n biofilm, datorit proximitii
celulelor este favorizat i transferul pe orizontal al plasmidelor R ntr -un biofilm multispecific
sau multiclonal, ceea ce amplific fenomenul de rezisten la antibiotice n general.
Dac n urm cu 40 de ani incidena infeciilor determi nate de BGNNF era destul de
sczut, acestea avnd o pondere crescut consecutiv interveniilor chirurgicale la nivelul
tractului urinar, astzi acestea afecteaz aproximativ 30% din pacienii internai n seciile de
terapie intensiv.
Pn n prezent apte familii de metalo--lactamaze (MBL) au fost descrise la izolate
clinice de P. aeruginosa (VIM, IMP, SPM, GIM, SIM, AIM, i mai recent, NDM), unele avnd
distribuie global (VIM, IMP i NDM) (Michalopoulos i colab., 2010). -lactamazele din
familia VIM au fost descrise prima dat n Europa n 1990, iar ulterior au fost semnalate ca
avnd distribuie global si asociate casetelor genice ale clasei 1 de integroni. OXA-23 este cea
mai rspndit -lactamaz din clasa D (CHLD) la A. baumannii , localizat n structura Tn2006,
Tn2007, Tn2008 sau la nivel cromosomal/plasmidial.
La nivel european, potrivit ECDC (European Center Disease Control), n 2011 Romnia
a ocupat cea mai nalt rat a rezistenei la carbapeneme la izolate clinice de P. aeruginosa,
datele disponibile n prezent fiind destul de puine i limitate doar la regiunea de nord a rii. La

-5-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

A. baumannii, caracterizarea contextului genetic al genelor de rezisten la antibioticele lactamice a fost raportat numai de spitale din regiunea de vest a rii.
Similar 2011, n 2012 rezistena tulpinilor de P. aeruginosa la carbapeneme n ara
noastr a ocupat locul I ntre rile europene urmat de Grecia, Bulgaria i Ungaria, ri vecine
Romniei

(www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database).

La

A.

baumannii, date referitoare la profilurile de rezisten la antibiotice au fost raportate din 30 de


ri ale Europei prin programul SENTRY (Turner i colab., 2003) n perioada 2001-2004,
perioad pe parcursul creia procentul tulpinilor rezistente la imipenem, meropenem, ampicilinsulbactam i polimixin B a fost de: 26,3; 29,6; 51,6; si respective 2,7%. n Grecia procentul
tulpinilor de A. baumannii rezistente la imipenem izolate de la pacieni din seciile de terapie
intensiv n perioada 1996-2007 a fost de 85% (http://www.mednet.gr/whonet).
Avnd n vedere rezultatele limitate la doar dou regiuni ale rii raportate n studiile
precedente i datele insuficiente privind caracterizarea genetic a tulpinilor de P. aeruginosa i
A. baumannii circulante n Romnia i rezistente la carbapeneme aceast tez a avut ca scop
studiul fenotipic i molecular al fenomenului de rezisten la antibiotice -lactamice la tulpini de
bacili Gram negativi non fermentativi oportuniti izolai din infecii nosocomiale n vederea
reducerii riscului epidemiologic i elaborrii unor msuri eficiente de prevenire a diseminrii
clonelor rezistente.

-6-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

I. PARTEA TEORETIC
CAPITOLUL 1
CARACTERIZAREA GENERAL A BACILILOR GRAM NEGATIVI NONFERMENTATIVI OPORTUNITI
Bacilii Gram negativi nonfermentativi (BGNNF) cuprind specii n general saprobionte
n natur, fiind larg rspndite n sol i ape, comensale la animale i om i pe suprafaa plantelor,
n special n habitatele umede, avnd un rol important n patologia uman, ca ageni ai infeciilor
oportuniste i nosocomiale, mai ales la gazde imunocompromise. Virulena lor este mediat de
adezine i toxine, de capacitatea de a forma biofilme (Tomaras i colab., 2003), ca i de
multirezistena natural sau dobndit la numeroase antibiotice, ceea ce explic frecvena tot mai
mare a infeciilor nosocomiale cu P. aeruginosa i A. baumannii (Chifiriuc i colab., 2011).
BGNNF sunt strict aerobi, nu fermenteaz glucoza i alte glucide, dar le degradeaz pe
cale oxidativ i au multiple capaciti nutriionale: metabolizeaz substraturi foarte diverse, ceea
ce le permite creterea pe medii foarte selective (cetrimid, Drigalski) sau minimale (ap de
robinet, glucoz, ioni de (NH4)2, -SO4, oligoelemente); supravieuiesc n ap distilat, soluii de
substane antiseptice i dezinfectante (Chifiriuc i colab., 2011) . Pot fi transmii prin intermediul
aparaturii medicale contaminate (Tomaras i c olab., 2003). Familia Pseudomonadaceae cuprinde
genul Pseudomonas cu 256 de specii, mprite n 4 grupe metabolice i genul Xanthomonas,
care alturi de Pseudomonas formeaz grupul Pseudomonadelor (Tabelul 1). Ali ageni patogeni
din acelai grup cu Pseudomonas sp. sunt: Acinetobacter sp., Stenotrophomonas maltophilia,
Alcaligenes sp., Flavimonas oryzihabitans, i Sphingobacterium sp. (Steinberg i colab., 2000).
Aceste microorganisme au trsturi comune: majoritatea provoac infecii nosocomiale i sunt de
obicei rezistente la antibiotice (Nerad i colab., 1998; Rubinstein 1999). n prezent infeciile
grave datorate acestui grup de microorganisme au o frecven ridicat (Wisplinghoff i colab.,
2000; Duggan i colab., 1996).

-7-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Tabelul 1. Clasificarea pseudomonadelor de importan medical (dup Gil ligan i colab., 2003)

Grupuri i subgrupuri de omologie pe baza


analizei ARNr
I. Specii fluorescente

Genuri i specii
Pseudomonas aeruginosa
P. fluorescens
P. putida P .stutzeri

II. Specii nefluorescente

P. mendocina
Burkholderia pseudomallei
B. mallei
B. cepacia
Ralstonia pickettii
Comamonas sp.
Acidovorax sp.
Brevundimonas sp.
Stenotrophomonas maltophilia

III.
IV.
V.

1.1.

Specia Pseudomonas aeruginosa este cea mai bine cunoscut din punct de vedere

microbiologic i clinic dintre bacilii Gram negativi non-fermentativi (Quinn,1998; Hancock,


1988); fiind un patogen oportunist care determin infecii foarte frecvente n mediul spitalicesc.
Dei colonizeaz ca un comensal organismul uman, devine patogen pentru indivizii
imunocompromii producnd infecii ale tractului urinar, ale aparatului respirator, ale esutului
conjunctiv, dermatite, bacteriemii i infecii sistemice, mai ales la o serie de pacieni fie cu arsuri
severe extinse, cu fibroz chistic sau neoplazici, ca i la pacienii cu SIDA, n condiiile
imunosupresiei secundare unor afeciuni sau medicamentoase produs de citostatice i respectiv
ale imunodeficienei dobndite ca urmare a infeciei cu virusul HIV. P. aeruginosa poate fi de
asemenea, ocazional un agent fitopatogen (Vidal i colab., 2002).
1.1.1. Habitat
Tulpinile de Pseudomonas grupeaz specii bacteriene ubicuitare, ntlnite n sol, pe
suprafaa materiei vegetale, n habitate acvatice dulcicole i marine. Numeroase tulpini sunt
psichrofile i contamineaz produsele alimentare sau farmaceutice conservate. Au fost semnalate
cazuri cnd pot fi izolate din microbiota intestinal a omului i animalelor (Chifiriuc i colab.,
2011).

-8-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

1.1.2. Morfologie, caractere de cultur i cretere


Tulpinile pot produce trei tipuri de colonii: cele izolate din sol sau ap produc colonii
mici de tip R (rugos); tulpinile izolate din clinic produc una dintre cele dou tipuri de colonii
netede (tip S): colonii cu aspect de ou prjit (fig. 2), mari, netede, cu marginile aplatizate i cu
profil ridicat sau colonii cu aspect mucoid, produse de tulpini izolate din secreiile tractului
respirator i urinar, aspect datorat produciei de alginat (Chifiriuc i colab., 2011). Tulpinile care
produc colonii netede i mucoide au capacitate mai mare de colonizare i virulen. P.
aeruginosa este rezistent la fagocitoz i la efectul bactericid al serului datorit capsulei sale
mucoide i posibil datorit LPS (fig. 1). Ca i n cazul altor specii bacteriene Gram negative,
lipidul A din structura LPS mediaz manifestrile patologice ale septicemiilor cu bacterii Gram
negative: febr, hipotensiune, coagulare intravascular diseminat (Beare i colab., 2003;
Chifiriuc i colab., 2011).
Monozaharide

Fig. 1. Reprezentarea diversitii LPS prezente pe suprafaa unei celule de P. aeruginosa (dup Lam i
colab., 2011)

1.1.3. Factori de virulen i rezistena la antibiotice


Tulpinile de P. aeruginosa cresc pe medii de cultur diverse i produc un miros
caracteristic de flori de tei. Coloniile caracteristice sunt netede (S), de culoare verzui-9-

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

fluorescent (fig. 2), datorit piocianinei, un pigment ce difuzeaz n mediul de cultur (Chifiriuc
i colab., 2011). Piocianina este o protein non enzimatic, care se leag la flavoproteinele
sistemului citocrom; este un factor de virulen care interfer cu transferul terminal de electroni,
ceea ce determin un deficit de energie i apoptoz. Funcia sa este de a mpiedica funcia
normal a cililor nazali de la om, de a ntrerupe bariera epiteliului respirator i de a exercita un
efect proinflamator asupra fagocitelor (Chifiriuc i colab., 2011)

Fig. 2. Aspectul tulpinilor de P. aeruginosa ce produc colonii netede (tip S) productoare de diferii pigmeni

Unele tulpini produc pioverdina, pigment fluorescent ce coloreaz mediul de cultur ntr-o
nuan verzuie (fig. 2 stnga), piorubina (rou nchis) sau piomelanina (pigment negru).
Pioverdina este produs n cantitate mare n medii private de Fe (Chifiriuc i colab., 2011) .
Acest pigment secretat n mediu are rol de chelare a fierului i de formare a complexelor feripioverdin, transportate apoi n celula bacterian prin proteinele specifice ale membranei externe
cu rol de receptor de suprafa celular (FpvAI-III) (De Chial i colab., 2003). Pioverdinele de
asemenea acioneaz ca molecule de semnalizare ce induc producerea a doi factori de virulen
secretai: exotoxina A, endoproteaza PrpL (Beare i colab., 2003). Piochelina, este un siderofor
ce poate juca rol n invazie dac competiioneaz cu proteinele chelatoare de fier ale gazdei.
Rolul pigmenilor fluorescen i n virulen nu a fost nc complet elucidat (Beare i colab. ,
2003).
Pentru un patogen oportunist ca P. aeruginosa ca i n cazul altor patogeni, procesul
infecios ncepe cu alterarea sau evitarea mecanismelor de aprare a gazdei (Chifiriuc i colab.,
2011). Patogeneza infeciilor cu Pseudomonas este variat, fiind reflectat n gama larg de
- 10 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

localizri i manifestri ale infeciilor: septicemii, infecii ale tractului urinar, pneumonii i
infecii pulmonare cronice, endocardite, dermatite i osteocondrite (Kiska; Gilligan, 2003).
Capacitatea tulpinilor de P. aeruginosa de a determina un numr impresionant de infecii acute i
cronice se datoreaz unui arsenal de factori de virulen (componente parietale sau extraparietale
ale celulei bacteriene i factori solubili, secretai) pe care tulpinile acestei specii i pot sintetiza.
Factorii de virulen interfer cu mecanismele de aprare ale gazdei, furnizeaz elemente
eseniale pentru creterea bacteriei, intensific potenialul de aderen i invaziv, i lizeaz direct
esuturile gazd (Van Delden i colab., 1998; Chifiriuc i colab., 2011 ).
1.1.3.1. Etapele infeciei cu P. aeruginosa i factorii de virulen implicai
Dup o etap iniial de colonizare, dependent de factori de virulen asociai celulei, procesul
infecios evolueaz fie ctre o infecie cronic, caracterizat printr-o secreie sczut a factorilor
de virulen extracelulari, fie ctre o infecie acut (fig. 3A), caracterizat prin producia nalt a
acestor factori de virulen, a cror sintez este dependent de semnalizarea celular (fig. 3B). n
cursul episoadelor acute ale unei infecii cronice, crete mult producia acestor factori de
virulen dependeni de semnalizarea celular (Van Delden i colab., 1998).

Colonizare
- lezri n prima linie de aprare a organismului gazda
Infecie cronic

Infecie acut

- adeziune
datorat factorilor de virulen
asociai coordonat
celulei
- specific pacienilor cu fibroz
chistic;
- sinteza
a unor cantiti mari de factori de
bacteriene
virulen solubili dependeni de sistemele de semnalizare
- evolueaz cu selectarea de mutante productoare
celular ce conduc la;
de alginat;
- producerea de leziuni tisulare mediate de proteaze i
- reducerea expresiei factorilor de virulen
toxine: invazia vaselor sangvine, diseminarea sistemic,
solubili;
sindromul de rspuns inflamator, insuficiena multipl de
organe i moarte consecutiv.
-producere de leziuni tisulare datorate inflamaiei

cronice.
Fig. 3A. Caracteristici specifice ale procesului infecios cronic i acut (dup Van Delden i colab., 1998).

- 11 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 3B . Reprezentarea schematic a fazelor infeciei cu P. aeruginosa (dup Chifiriuc i colab., 2011).

1.1.3.2. Interaciunea gazd-agent patogen. Speciile bacteriile patogene n general, produc


civa factori de virulen implicai n lezarea tisular, prin aciune direct, sau indirect prin
activarea rspunsului inflamator al gazdei. Celulele bacteriene au capacitatea de a evita
mecanismele de aprare nespecific i specific ale gazdei i de a coloniza cile aeriene, prin
clivarea componentelor complementului i a moleculelor de Ig, precum i prin perturbarea
procesului de clearance mucociliar. Aceste evenimente contribuie la natura persistent a
inflamaiei i la leziunile progresive din bolile pulmonare cronice, care n schimb conduc la o
colonizare bacterian mai intens i la un ciclu de inflamaie autoperpetuat (Engel i colab.,
2003). Majoritatea infeciilor cu Pseudomonas sp. sunt att invazive, ct i toxigenice. Infecia
cu Pseudomonas sp. evolueaz n trei etape succesive (Van Delden i colab., 1998; Chifiriuc i
colab., 2011).:

aderena bacterian i colonizarea;

invazia local;
- 12 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

infecia sistemic generalizat.

Aderena i colonizarea
Pentru a iniia infecia, P. aeruginosa induce dezechilibre ale mecanismelor primei linii
de aprare a organismului gazd. Astfel de dezechilibre pot rezulta din: ruperea sau ocolirea
barierelor normale cutanate sau ale mucoaselor (intervenii chirurgicale, arsuri severe sau
utilizarea de dispozitive medicale), alterarea efectului de barier antiinfecioas a microbiotei
normale a mucoasei de ctre antibioticele cu spectru larg sau alterri ale mecanismelor de
aprare imun (neutropenia indus de chemoterapie, defecte ale mecanismelor de clearance a
mucoaselor n fibroza chistic, SIDA, diabetul zaharat). Colonizarea tractului respirator de ctre
P. aeruginosa necesit aderena fimbrial i poate fi favorizat de producerea unei enzime
proteaza, care degradeaz fibronectina seric pentru a expune receptorii pentru fimbrii existeni
pe suprafaa celulelor epiteliale. Celulele de P. aeruginosa ader la celulele epiteliale ale
tractului respirator superior i ale altor epitelii, prin intermediul fimbriilor (pili de tip IV) (Van
Delden i colab., 1998), cu rol esenial n virulen, n micarea n tirbuon, n procesele de
transformare genetic ca i receptori de fagi (Chifiriuc i colab., 2011). Lezarea tisular de
asemenea joac rol n colonizarea tractului respirator, deoarece P. aeruginosa ader la celulele
epiteliale traheale ale oarecilor infectai cu virusul gripal, dar nu i la epiteliul traheal normal.
Acest tip de aderen este specific agenilor oportuniti i constituie o etap important n
keratite, infecii ale tractului respirator i cele ale tractului urinar cu P. aeruginosa. Colonizarea
mucoaselor cu P. aeruginosa este rezultatul aciunii mai multor factori de virulen asociai
celulei bacteriene, cu rol de adezine, reprezentai de: pili, fimbrii, polizaharide de suprafa i
flageli. Ocazional, P. aeruginosa poate coloniza diferite situsuri ale organismului uman, cu
preferin pentru zonele umede, ca zona perine al, axila, urechea, mucoasa nazal i gtul.
Prevalena colonizrii cu P. aeruginosa la subiecii sntoi prezint rate mai mici dect la cei
spitalizai, mai ales la subiecii tratai cu antibiotice de spectru larg (Rossolini, 2005).
Colonizarea tractului respirator este frecvent la pacienii ventilai mecanic, iar a tractului gastrointestinal la pacienii neoplazici post-chimioterapie. De asemenea, soluiile dezinfectante,
tubulatura echipamentelor respiratorii, robinetele i alte medii umede pot aciona drept
rezervoare ale tulpinilor de P. aeruginosa n mediul spitalicesc (Rossolini, 2005).

- 13 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Invazie i diseminare
Capacitatea P. aeruginosa de a invada esuturile gazdei depinde de capacitatea sa de a
produce enzime i toxine extracelulare, care ntrerup barierele fizice i lezeaz celulele gazd,
precum i de capacitatea de a rezista la fagocitoz i la alte mecanisme de aprare imun ale
organismului gazd (Chifiriuc i colab., 2011). Deseori, invazia esuturilor de ctre P.
aeruginosa este determinat de producerea unor factori de virulen extracelulari importani:
proteaze (LasA, LasB ce determin hemoragii pulmonare n infeciile pulmonare acute
determinate de tulpini MDR de P. aeruginosa; elastaza i proteaza alcalin cu rol n evoluia
infeciilor corneene ns rolul acesteia n infeciile sistemice nu a fost pe deplin elucidat)
hemolizine labile - i stabile-termic, fosfolipaze C i exotoxinele A, S, T, U, Y , ramnolipide
(Van Delden i colab., 1998). Invazia sistemului circulator i diseminarea P. aeruginosa de la
situsurile locale de infecie este mediat att de produi asociai celulei bacteriene ct i de
factori extracelulari responsabili de boli localizate, dei nu este pe deplin cunoscut modul n care
agentul patogen produce infecia sistemic (Chifiriuc i colab., 2011) .
Reglarea expresiei factorilor de virulen. Secreia unora dintre aceti factori necesit
sistemul de secreie de tip III (TTSS), ce permite translocarea unui set de toxine, denumite
proteine efectoare, direct n celulele gazd, unde moduleaz cile de transducie a semnalului,
determinnd citotoxicitatea i blocarea citoscheletului celulelor gazd (Engel i colab., 2003).
Acest sistem de secreie este asociat cu infeciile invazive acute i necesit contactul mediat de
pili dintre bacterii i celule epiteliale (Engel i colab., 2003). De asemenea TTSS este activat de
contactul cu membranele celulelor eucariote i interfer cu transducia semnalului, conducnd la
moartea celular sau la alterri ale rspunsului imun nespecific i specific al gazdei (Engel i
colab., 2003). Sistemele de semnalizare celular controleaz expresia i permit producerea
coordonat dependent de densitatea celular a mai multor factori de virulen extracelulari. De
asemenea, aceste sisteme ce permit comunicarea ntre celulele bacteriene, sunt implicate i n
producerea factorilor care ajut P. aeruginosa s depeasc mecanismele de aprare ale gazdei.
Producerea de factori de virulen extracelulari de ctre un numr mic de bacterii ar putea
conduce probabil la o neutralizare eficient a rspunsului gazdei fa de aceti compui. Ori,
expresia coordonat a genelor de virulen de ctre o ntreag populaie bacterian odat ce a
atins un prag critic al densitii permite celulelor de P. aeruginosa s secrete factori extracelulari
- 14 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

la nivel suficient de nalt pentru a depi mecanismele de aprare ale gazdei. Aceti factori pot
altera balana precar dintre mecanismele de aprare ale gazdei i producerea de toxine
bacteriene conducnd la invazia pe calea vaselor sanguine, diseminare, sindromul de rspuns
inflamator sistemic i n final la moarte. Chiar utilizarea terapiei cu antibioticele corespunztoare
este frecvent ineficient n stoparea infeciei, de aceea procesul ar trebui blocat din timp, nainte
ca expresia genelor de virulen s poat fi activat (Nord i colab., 1975).
1.1.3.3. Mecanisme de rezisten
Severitatea infeciilor cu Pseudomonas sp. rezid n multirezistena la antibiotice, att
natural, ct i dobndit (Chifiriuc i colab., 2011). Rezistena natural este consecina aciunii
mai multor factori: bariera impermeabil oferit de membrana extern i LPS; creterea n
biofilme astfel c, celulele bacteriene chiar sensibile la un antibiotic manifest o rezisten
comportamental sau toleran la antibiotic n condiiile nglobrii acestora n biofilme, situaie
care le confer celulelor protecie fa de concentraiile terapeutice de antibiotice; prezena
plasmidelor R i a factorilor de transfer ai determinanilor genetici de rezisten (RTF) prin
procesul de conjugare i tranducie (Chifiriuc i colab., 2011). Rezistena dobndit se datoreaz
presiunii selective a antibioticelor administrate n mediul spitalicesc. Ineficiena antibioticelor n
tratamentul infeciilor cu Pseudomonas sp. este cel mai dramatic aspect evideniat n cazul
pacienilor cu fibroz chistic, infectai de obicei cu tulpini multirezistente la antibioticele
disponibile i imposibil de tratat (Chifiriuc i colab., 2011). n ultimii ani factorii de rezisten
sunt considerai i factori de virulen. P. aeruginosa prezint rezisten la majoritatea agenilor
antimicrobieni datorit capacitii sale selective de a mpiedica diferite molecule de a ptrunde
prin membrana extern, prin pompele de eflux astfel nct clasele de antibiotice ce rmn active
includ

-lactaminele,

fluoroquinolonele,

aminoglicozidele

colistinul

(www.ecdc.europa.eu/en/activities/surveillance).
n 2011 rezistena P. aeruginosa la carbapeneme n ara noastr a ocupat locul I ntre
rile europene (fig. 4 i fig. 5) (www.ecdc.europa.eu/en/activities/surveillance).

- 15 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig.4. Distributia procentuala a rezistenei P. aeruginosa la carbapeneme n 2011 n Europa


(www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database)

n mod similar i n 2012 Romnia a ocupat locul I printre rile Europei privind
rezistena la carbapeneme (fig. 6 i 7) (www.ecdc.europa.eu/en/activities/surveillance/EARSNet/database).

Fig.5. Distributia procentuala a rezistenei P. aeruginosa la carbapeneme n 2012 n Europa


(www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database)

- 16 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 6. Reprezentarea nivelului rezistenei P.aeruginosa la carbapeneme n 2011 la nivel european


(www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database).

Fig. 7. Reprezentarea nivelului rezistenei P.aeruginosa la carbapeneme n 2012 la nivel european.


(www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database).

- 17 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

1.1.4. Implicarea speciei P. aeruginosa n patologia uman


Infeciile cu P. aeruginosa apar la pacienii spitalizai o perioad ndelungat, astfel la 2/3 din
cazurile semnalate poarta de intrare poate fi reprezentat de (Chifiriuc i colab., 2011):
translocaia digestiv la bolnavii imunocompromii, focare de infecie digestive;
catetere intravasculare sau urinare;
leziuni tegumentare sau ale mucoaselor (arsuri, rni, plgi chirurgicale).
Infeciile nosocomial e cauzate de P. aeruginosa sunt localizate mai frecvent la nivelul
tractului respirator, ale tractului urinar i la nivelul plgilor (Rossolini; Mantengoli, 2005). P.
aeruginosa reprezint una din cele mai importante cauze de pneumonie nosocomial, mai ales la
pacienii ventilai mecanic (Rossolini; Mantengoli, 2005). n general, aceti pacieni au o
probabilitate mai mare de a dezvolta pneumonie nosocomial cu P. aeruginosa, ratele de
mortalitate variind de la 40% la de 60% (Rello i colab., 1997).
Infeciile respiratorii produse de P. aeruginosa apar ndeosebi la indivizii cu leziuni ale
epiteliului tractului respirator inferior sau imunocompromi i (Chifiriuc i colab., 2011) . n
majoritatea cazurilor raportate, infecia tractului respirator inferior la bolnavii cu fibroz chistic
de ctre tulpinile mucoide de P. aeruginosa este dificil de tratat (Chifiriuc i colab., 2011). P.
aeruginosa este un agent patogen de temut la pacienii cu fibroz chistic, care de cele mai multe
ori, dezvolt infecii ale tractului respirator. Epiteliul cilor respiratorii al acestor pacien i
permite colonizarea pe termen lung de ctre P. aeruginosa avnd un rol critic n progresia bolii
pulmonare (Rossolini; Mantengoli, 2005).
Majoritatea bacteriemiilor produse de Pseudomonas sp. sunt infecii nosocomiale (25%
din totalul bacteriemiilor nregistrate n spitale) (Livermore, 2001). Cauza major a bacteriemiei
determinate de Pseudomonas sp. o reprezint dispozitivele medicale contaminate din mediul
spitalicesc unde rata mortalitii depete 10% (http:// medscape.com).
P. aeruginosa este agentul etiologic n cazurile de otit extern (Chifiriuc i colab.,
2011). Prezena speciei a fost rareori semnalat la nivelul analizatorului acustico-vestibular, dar
populeaz adeseori canalul auditiv extern dup rnire, inflamaie sau n condiii de umiditate
crescut. La bolnavii diabetici produce otita invaziv (Chifiriuc i colab., 2011) .
P. aeruginosa este cauza frecvent a keratitei bacteriene, abceselor sclerei, i
endoftalmiei neonatale (http://medscape.com). Tulpinile de Pseudomonas sp. pot coloniza
- 18 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

epiteliul ocular prin ataarea fimbriilor la receptorii reprezentai de acidul sialic. La pacienii
imunocompromii, celulele bacteriene pot prolifera rapid i prin secreia enzimelor (elastaza,
proteaza alcalin i exotoxina A) produc o infecie rapid i distructiv care poate duce la
pierderea ochiului (Chifiriuc i colab., 2011) .
Infeciile tractului urinar determinate de P. aeruginosa sunt de obicei dobndite n
unitile spitaliceti (12% din infeciile urinare nosocomiale) i sunt datorate utilizrii
dispozitivelor medicale contaminate n interveniile chirurgicale sau cateterizrii tractului urinar.
Tulpinile aparinnd speciei Pseudomonas reprezint cei mai adereni ageni patogeni ai
epiteliului vezicii urinare, infecia evolund ascendent sau descendent (Chifiriuc i colab., 2011).
Infecii ale tractului digestiv.
Tulpinile de P. aeruginosa pot produce leziuni la indivizii imunosupresai la nivelul
oricrui segment al tractului gastrointestinal de la cavitatea bucal, faringe la rect, fiind ageni de
temut n etiologia infeciilor perirectale, a diareilor la copii, a gastroenteritelor tipice i
enterocolitelor necrozante (Chifiriuc i colab., 2011) .
Alte localizri: infecii ale pielii, att localizate, ct i difuze, foliculite i forme de acneea
vulgaris, endocardita n special la consumatorii de droguri dup invazia pe cale sanguin
(Chifiriuc i colab., 2011) .
P. aeruginosa poate fi o cauz important de morbiditate i mo rtalitate la copii i adolesceni
bolnavi de SIDA i cu un numr foarte sczut de limfocite CD4+ (Manfredi i colab., 2000).
1.2. Burkholderia pseudomallei este un patogen oportunist, reprezentnd agentul etiologic al
meloidozei, o boal tropical fatal la om i alte mamifere domestice, endemic n SE Asiei, N
Australiei, i alte zone tropicale (Currie; Cheng, 2010). B. pseudomallei este un bacil Gram
negativ aerob, saprotrof n ap, sol, orezrii, material vegetal; crete la 42C, oxideaz glucoza i
lactoza (Chifiriuc i colab., 2011) . Infecia urmeaz inoculrii percutanate sau prin inhalarea
bacteriei prezente n sol, praf i apele de suprafa. Simptomele bolii pot fi strile febrile, tusea,
tulburrile respiratorii, producia de sput (Vietri ; Deshazer, 2007). Este o infecie pulmonar
studiat folosind aerosoli sau inoculnd intranazal animale mici. Ambele metode prezint
dezavantaje inerente pentru c nu pot modela cu exactitate meloidoza pulmonar la om. La
cabaline B. pseudomallei produce morva transmisibil la om (Chifiriuc i colab., 2011). La cal
infecia implic plamnul, evolueaz sistemic, cu leziuni subcutanate, ulcerative i adenopatie.
La om boala poate fi localizat sau sistemic rezultnd o gam larg de simptome (ulceraii
- 19 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

tegumentare sau ale mucoaselor, adenopatie, septicemia) i poate evolua fatal ( Loveleena i
colab., 2004).
1.3. Complexul Burkholderia cepacia (Bcc) cuprinde specii ubicuitare cu efecte benefice dar i
detrimentale plantelor i mediului, izolate din

sol, de pe suprafaa materiei vegetale , a

animalelor, din materia organic n descompunere, din reele le de ap potabil, din mediul
spitalicesc n condiii de umiditate ridicat (Mahenthiralingam i colab., 2005). Specia prezint
interes la bolnavii cu fibroz chistic la care infecia poate evolua cu deteriorarea progresiv a
esutului pulmonar, cu apariia pneumoniei necrozante i a bacteriemiei (Chifiriuc i colab.,
2011). Virulena include o serie de factori, implicnd aderena la celulele epiteliale ale gazdei i
la mucin, prin intermediul pililor, producere de hemolizine, proteaze, endotoxine i structura
unic a compuilor polizaharidici ai LPS care i confer rezistena la fagocitoz, producerea de
melanin ce are rolul de a proteja celulele bacteriene de sistemele microbicide dependente de
oxigen ale neutrofilelor polimorfonucleare (Speert, 2010). n fibroza chistic, infecia pulmonar
cu B. cepacia este n general cronic, refractar la terapia antimicrobian i asociat cu rate
crescute de morbiditate i mortalitate. La un numr semnificativ de pacieni cu fibroz chistic,
pneumonia necrozant evolueaz rapid sau de cele mai multe ori transplantul s-a dovedit a fi
ineficient. Cu toate acestea, muli pacieni cu fibroz chistic rmn c olonizai cu B. cepacia ani
de zile, fr un impact negativ asupra evoluiei clinice. Evoluia diferit a procesului infecios
sugereaz diferene n potenialul epidemiogen, de patogenitate i virulen ntre tulpinile de B.
cepacia (Lipuma i colab., 2001).
1.4. Ralstonia pickettii este o specie ocazional patogen ce determin septicemii nosocomiale i
infecii tisulare. n 1992 organismul a fost rencadrat din genul Pseudomonas n genul
Burkholderia (Ryan i colab., 2007) i, ulterior, n 1995, n genul Pseudomonas. Este o specie
omniprezent n mediul acvatic dar i n cel spitalicesc (Adley; Saieb, 2005; Ryan i colab.,
2006), devenit n ultimul deceniu un agent patogen nosocomial asociat n special indivizilor
imunosupresai (Lacey; Want, 1991; Ryan i colab., 2007). Apariia de noi specii patogene
oportuniste este legat mai ales de un fenotip de rezisten c are le face refractare la antibioticele
utilizate n mod curent n practica medical (Zellweger i colab., 2004). Majoritatea tulpinilor de
R. pickettii izolate din clinic au fost caracterizate ca fiind multirezistente la antibioticele comune
(Zellweger i colab., 2004). R. pickettii este implicat n formarea biofilmelor n conductele de
ap industrial din material plastic (Anderson i colab ., 1990) i a fost izolat din ap industrial
- 20 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

de nalt puritate (Adley; Saieb, 2005; Kulakov i colab., 2002) , fiind deci capabil s
supravieiasc n medii oligotrofice. n plus, specia prezint capacitate biodegradativ ce ajut la
supravieuirea i adaptarea n mediile srace n nutrieni i ar putea servi utilizrilor
biotehnologice (Anderson i colab., 1990).
1.5. Brevundimonas vesicularis este un bacil Gram negativ non-fermentativ aerob (Gilligan i
colab., 2003), izolat din mediul extern, dar i de la pacieni spitalizai (Otto i colab., 1987).
Specia determin abcese dentare, endocardit infecioas, bacteriemii produse n cazul
pacienilor cu maladii autoimune tratai cu medicamente imunosupresoare, antiinflamatoare,
steroidiene pe termen lung, motiv pentru care specia este considerat drept patogen oportunist
(Planes i colab., 1992; Calegari i colab., 1996; Choi i colab., 2006). Numrul redus de cazuri
raportate de infecii cu B. vesicularis la om limiteaz spectrul de afeciuni cauzate de acest agent
patogen, precum i regimurile optime de tratament.
1.6. Brevundimonas diminuta ncadrat pn relativ recent n genul Pseudomonas
(Wellinghausen i colab., 2005), este rspndit n mediul spitalicesc la gazde imunocompromise.
Specia determin infecii n special la nivelul tractului respirator, infecii urinare, emfizem (Chi
i colab., 2004). Specia este rezistent la amoxicilin, amoxicilin-acid clavulanic, ceftazidim,
imipenem,

amikacin,

tobramicin,

gentamicin,

rifampicin,

piperacilin-tazobactam

(Wellinghausen i colab., 2005).


1.7. Stenotrophomonas maltophilia
Dup o ndelungat perioad de incerte poziii taxonomice, specia cunoscut drept
Pseudomonas maltophilia, sau Xanthomonas maltophilia a fost ncadrat n specia
Stenotrophomonas maltophilia. Genul a fost propus n 1993 de Palleroni i Bradbury, tulpina
respectiv fiind izolat nc din 1958 de Hugh de la un pacient cu carcinom oral i denumit P.
maltophilia (Hugh; Ryschenkow, 1960; Hugh; Ryschenkow, 1961). Ulterior, Hugh i
Ryschenkow, l-au rencadrat n specia Bacterium booker iar n 1943 Edwards a izolat tulpina din
lichid pleural i a denumit-o P. maltophilia (Hugh; Leifson, 1963). n 1963 a fost izolat prima
dat specia P. melanogena pentru ca ulterior s fie reclasificat drept P. maltophilia (Komagata
i colab., 1974), aceeai tulpin ce a fost iniial caracterizat drept Pseudomonas alcaligenes
(Komagata i colab., 1974). Aceste informaii au fost folosite pentru a propune rencadrarea P.
maltophilia n X. maltophilia (Swings i colab., 1983). Autorii enumer o serie de factori n
sprijinul afirmaiilor lor, printre care procentul molar G+C coninut ( la P. maltophilia G+C =
- 21 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

63-67,5% iar la X. maltophilia G+C = 63-70%), enzimologia comparativ, absena NADP dehidrogenazei etc. Factorii enumerai mpreun cu alte dovezi au fost utilizai pentru a
reinterpreta statutul taxonomic al speciei X. maltophilia (Van i colab., 1992). Acest lucru a fost
susinut de experi mente PCR, utiliznd un primer specific de Xanthomonas sp. ARNr 16S
(Nesme i colab., 1995). Speciile genului Xanthomonas au fost recunoscute prin prezena unui
singur amplicon PCR specific (480bp), cu toate acestea n cazul X. maltophilia se remarcau
ampliconi suplimentari, fapt ce conducea la ideea c specia X. maltophilia nu putea fi ncadrat
n genul Xanthomonas. Incertitudinile n ceea ce privete clasificarea acestui organism, au
determinat n cele din urm crearea noului gen Stenotrophomonas cu S. maltophilia ca unic
membru (Palleroni i

Bradbury, 1993). Mai recent, Nesme i colab., n 1995 confirm

diferenele dintre S. maltophilia i ceilali membri ai genului Xanthomonas, utiliznd restricia


fragmentelor PCR amplificate pentru gena ARNr 16S. Mai recent, Drancourt i colab., 1997,
propun o nou specie Stenotrophomonas africana ce prezint caracteristici biochimice identice
cu S. maltophilia, exceptnd capacitatea de a asimila cis-aconitatul. Analizele genotipice au
demonstrat omologie de secven ADN de numai 35% ntre cele dou specii.
1.7.1. Morfologie, caractere de cultur i cretere
Bacilii care aparin genului S. maltophilia sunt drepi sau uor incurbai, au o lungime cuprins
ntre 0,5-1,5m, sunt mobili datorit flagelilor polari, pot fi dispui solitar sau n perechi i nu
acumuleaz incluziuni intracelulare de poli--hidroxibutirat. Coloniile sunt netede, strlucitoare,
cu margini ntregi, de culoare alb pn la galben-pal (Chifiriuc i colab., 2011).

Fig. 8. Aspectul culturii


de S. maltophilia pe
geloz snge (dup
Chifiriuc i colab., 2011)

- 22 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Nord i colab., n 1975, au observat -hemoliza la 11 din 31 de tulpini analizate, ns S.


maltophilia nu este considerat o specie -hemolitic. Cu toate acestea, pe agar-snge poate
aprea o coloraie verzuie a mediului n jurul culturii (Gilardi, 1971). Anumite tulpini pot
manifesta o decolorare spre maron a mediului de cretere, fenomen atribuit reaciilor biochimice
secundare n care produii extracelulari se acumuleaz la incubarea tulpinilor la 42C (Hugh i
colab., 1980). S. maltophilia este o specie obligat aerob cu cretere optim la 35C, cu
urmtoarele caracteristici biochimice prezentate n Tabelul 2.
Tabelul 2. Caracteristicile biochimice ale S. maltophilia (adaptat
dup Brooke, 2012)
Test

Cretere

Catalaz
Indofenol oxidaz
5C
18C

Mobilitate

18C

37C
37C

Reacie
+
-++
I
+
+
I
I
+++-

Indol
Lizindecarboxilaz
Ornitindecarboxilaz
Oxidaz
Rou metil
Reacia Voges-Proskauer
Reducerea nitratului la nitrit
Citrat
Fenilalanildezaminaz
Hidroliza esculinei
gelatinei
Tween 80
ureei

+--I---

Sursele de Carbon pentru


cretereglucozarabinoz hidroxibutiratfructozmanitoltrehalozsorbitol

1.7.2. Habitat
Tulpini ale speciei S. maltophilia au fost izolate din medii foarte variate i zone
geografice diferite incluznd Antarctica i alte nie ecologice att n interiorul, ct i n afara
spitalelor. Specia a fost izolat din diferite habitate acvatice cum ar fi rurile, lacurile
hipertrofice, dar i ape mbuteliate, caz n care poate fi responsabil de alterarea proprietilor
organoleptice. Iizuka i Komagata (1964) au raportat izolarea S. maltophilia din petrol i alte
materiale petroliere derivate din cmpurile din Japonia. Tulpini de S. maltophilia au fost
- 23 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

explorate ca poteniali ageni de biocontrol ai rizosferei, nlocuind pesticidele agricole (Berg i


colab., 1996). Avnd n vedere gama larg de ciuperci fitopatogene inhibate de aceast specie, nu
este deloc surprinztor faptul ca S. maltophilia inhib creterea unor fungi patogeni umani ca de
exemplu Candida sp., Aspergillus fumigates.
1.7.3. Factori de virulen
S. maltophilia prezint o gam larg de enzime extracelulare incluznd DN-aze, RN-aze,
fibrinolizin, proteaze, hialuronidaz i elastaz (Arella; Sylvestre, 1979). O caracteristic
important a speciei o reprezint capacitatea de a adera la materiale plastice i de a forma
biofilme. Tulpinile de S. maltophilia au fost izolate de pe suprafeele cateterelor intravenoase,
dispozitivelor protetice (Denton i colab., 2003; Lai i colab., 2006). Tulpinile pot crete i forma
biofilme n sistemele de distribuie a apei potabile reprezentnd un posibil risc de infecie pentru
persoanele imunocompromise. Infeciile pot aprea att la copii, ct i la aduli, iar transmiterea
la persoanele sensibile se realizeaz prin contact direct cu sursa de infecie. S. maltophilia
prezint capacitatea de a forma biofilme pe suprafee variate inclusiv teflon, sticl, materiale
plastice i esuturile gazdei (De Oliveira -Garcia i colab., 2003). Biof ilmele au fost estimate a fi
asociate infeciilor dobndite n mediul spitalicesc n proporie de 65% (Potera, 1999).
Lipopolizaharide
Structura LPS la specia S. maltophilia este cea tipic (lipidul A, miezul oligozaharidic i
antigenul O), totui aceste componente prezint o serie de particulariti, i anume:
-

lipidul A conine resturi de glucozamin fosforilate cu N-acizi grai raportate la S.


maltophilia tulpina ATCC 10257 (Neal; Wilkinson, 1982).

componentele miezului oligozaharidic includ: D-glucoz, D-manoz, Dgalactoz, D-galactozamin, acid D- galacturonic, L-glicero--D-manoheptoz
(Neal; Wilkinson, 1982).

componentele antigenului O cuprind ramnoz, fucoz, xiloz, glucoz (Jucker i


colab., 1996).

La tulpina menionat mai sus s-a demonstrat c lipsesc proteinele din membrana extern,
fapt ce sugereaz ncrcarea pozitiv a suprafeei celulare=>capacitate ridicat a tulpinilor de S.
maltophilia de a adera la teflon i sticl comparativ cu cea a unui izolat de P. aeruginosa cu
suprafaa celular ncrcat negativ.

- 24 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Deficienele LPS pot modifica producia biofilmului la S. maltophilia (Huang i colab.,


2006). S-a demonstrat c deficienele LPS scad virulena tulpinilor de S. maltophilia n infeciile
pulmonare la obolani (McKay i colab., 2003). Modificri n structura LPS

afecteaz

sensibilitatea celulei bacteriene la substane antimicrobiene, cum ar fi peptidele cationice i


aminoglicozidele. Temperatura reprezint un alt factor ce modific compoziia chimic a LPS,
ducnd la schimbri n susceptibilitatea la aminoglicozide (Rahmati-Bahram i colab., 1997).
1.7.4. Manifestri clinice ale infeciei cu S. maltophilia
Infeciile cu tulpini ale speciei S. maltophilia se caracterizeaz printr-un spectru variat
de simptome i manifestri clinice. Specia prezint potenial patogen strict limitat i rareori este
capabil de a provoca afeciuni la indivizi diferii de cei imunocompromii (Southern i colab.,
1974). Bacteriemiile reprezint manifestrile comune ale infeciei cu S. maltophilia (Elting,
1990; Jang i colab., 1992). Ele pot fi secundare unei surse pulmonare, urinare, gastrointestinale
(Aoun, 1992), dei uneori nu este posibil determinarea porii de intrare n orga nism.
Endocardite
Cele mai multe cazuri descrise sunt cele aprute n urma unor complicaii ale inter veniilor
chirurgicale cu dispozitive protetice (Baddour, 1991), alteori infecia poate aprea n perioada
postoperatorie, probabil din cauza colonizrii dispozitivelor vasculare contaminate (Elting,
1990). Au fost enumerate o serie de manifestri cardiace determinate de infecia cu S.
maltophilia incluznd: pericardite (Elting, 1990), infecii consecutive ocului pseudocardiac,
precum i bacteriemii asociate colapsului valvei mitrale (Arpi i colab., 1994).
Infecii ale tractului respirator
Tractul respirator reprezint sursa cea mai frecvent de izolare a S. maltophilia, la
pacienii spitalizai reprezint 56-69% dintre sursele de izolare (Gerner-Smidt i colab., 1995),
Prima citare a izolrii S. maltophilia din tractul respirator al pacienilor cu fibroz chistic
dateaz din 1975 n Danemarca (Frederiksen i colab., 1995). Prevalena a crescut de la 2% n
1975, la 19% n 1993, n Danemarca i de la 0% n 1983 la 10% n 1990 ntr-un singur centru
britanic (Gladman i colab., 1992), i respectiv la 19% ntr -un alt centru britanic i la 30% ntr un centru spaniol (Denton i colab., 1996). Cauzele acestei creteri nu sunt foarte clare, ns un
studiu a sugerat c factorii de risc predispozani sunt reprezentai de cantitatea de antibiotice
antipseudomonade cu care pacienii spitalizai au fost tratai, precum i durata spitalizrii
(Gordon i colab., 1988).
- 25 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Dei anumii autori afirm c majoritatea pacienilor cu S. maltophilia sunt colonizai i


nu infectai (Khardori i colab., 1991), alii consider c infeciile tractului respirator cu S.
maltophilia sunt asociate cu rate crescute de mortalitate (Morrison i colab., 1986), izolarea
tulpinilor de S. maltophilia reprezentnd un predictor al mortalitii (rata mortalitii pacienilor
neotropenici cu pneumonie situndu-se in jurul valorii de 40%).
Infecii oftalmologice
Incidena infeciilor ocular e determinate de S. maltophilia este n continu cretere. O
serie de afeciuni oftalmologice au fost menionate, printre care pot fi amintite: conjunctivite,
keratite, ulcere corneene (Penland; Wilhemus, 1996).
Infecii ale tractului urinar
Dei S. maltophilia a fost frecvent izolat din probe de urin, o serie de autori au
demonstrat c nu exist dovezi suficiente pentru a susine c aceast specie reprezint un agent
patogen al tractului urinar (Gardner i colab., 1970). La majoritatea pacienilor infecia este
dobndit n spital (Laing i colab., 1995) i este de obicei secundar interveniei chirurgicale la
nivelul tractului urinar sau post-cateterizare. Printre infeciile tractului urinar pot fi enumerate:
uretrita, abcesele periuretrale, epididimita. Garcia i colab., au descris n 1981 izolarea speciei
din probe de material seminal de la brbai fertili.
Infecii ale pielii i esuturilor moi
S. maltophilia a fost relativ frecvent izolat din secreii i leziuni cutanate (Gilardi, 1969;
1971). Mai trziu a fost descris o afeciune de celulit asociat cu leziuni nodulare ale pielii
(Vartivarian i colab., 1994). Aceste leziuni pot mima infeciile fungice asociate cu un
prognostic nefavorabil. Patogenul oportunist S. maltophilia a fost de asemenea izolat din infecii
cutaneo-mucoase i perineale n cazul pacienilor cu boli maligne (Vartivarian i colab., 1994).
Infecii gastrointestinale
Zuravleff i Yu n 1982, au citat un caz de bacteriemie consecutiv gastroenteritei, dei nu este
foarte clar dac cele dou evenimente sunt legate cauzal. Autorii au remarcat existena speciei n
microbiota oral a pacienilor cu cancer supui chimioterapiei mielosupresive, ns autorii nu au
observat simptome ale infeciei acute la aceti indivizi.
Ca i ceilali BGNNF, S.maltophilia prezint rezisten intrinsec la o serie de antibiotice
mai ales c toate tulpinile prezint o -lactamaz cromosomal ce confer rezisten la
carbapeneme i la majoritatea antibioticelor -lactamice. De asemenea prezint rezisten la
- 26 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

dezinfectani (Quinn, 1998). Terapia infeciilo r cauzate de tulpini aparinnd speciei S.


maltophilia este dificil de stabilit mai ales datorit rezistenei ridicate ale acestui microorganism
la antibiotice (Vartivarian i colab., 1994). A fost raportat un numr semnificativ de tulpini de S.
maltophilia la care cei mai eficieni ageni antimicrobieni au fost minociclina, ticarcilina cu
acidul clavulanic i biseptolul (Quinn, 1998).
1.8. Genul Acinetobacter cuprinde specii bacteriene non-fermentative, saprotrofe n sol, ap, ap
menajer i hran, comen sale ale tegumentului personalului medical i pacienilor , ns
reprezint ageni patogeni nosocomiali de temut n special n seciile de terapie intensiv
(Chifiriuc i colab., 2011).
1.8.1. Morfologie, caractere de cultur i cretere
Aceti bacili, n faz logaritmic de cretere, devin cocoidali i grupai n diplococi sau n
lanuri de lungimi variabile, n faza staionar de cretere. Speciile genului Acinetobacter sunt
strict aerobe i pot crete la 330C dei unele tulpini prefer temperaturi de 30 0C-420C, iar cele
izolate din mediu 200C-300C (Chifiriuc i colab., 2011) . Reacia oxidazei difereniaz tulpinile
de Acinetobacter sp. de genurile nrudite. Toate tulpinile de Acinetobacter sp. sunt oxidazo
negative neavnd citocrom C, ci doar citocrom b i ocazional citocrom d (Chifiriuc i colab.,
2011). Majoritatea tulpinilor cresc pe medii minerale simple; unele tulpini pot utiliza glucoza i
pot produce hemoliza pe mediu de cultur geloz snge datorit producerii de fosfolipaz C
(Chifiriuc i colab., 2011). Tulpinile de Acinetobacter sp. pot persista n mediu de la cteva zile
la sptmni, chiar n condiii de desicaie (Chifiriuc i colab., 2011). n cadrul genului
Acinetobacter, au fost descrise pe lng A. baumannii, speciile A. johnsonii i A. lwoffii, precum
i A. baumannii/haemolyticus (Quinn, 1998)
A. baumannii este un bacil imobil, oxidazo-negativ al crui habitat natural rmne nc
nedeterminat (www.cdc.gov). Este inclus n familia Moraxellaceae, care include genurile
Acinetobacter, Moraxella, Psychrobacter (Peleg i colab., 2008). Cu toate acestea, specia
colonizeaz mediul din unitile de ngrijire ale sntii i poate fi un agent infecios
nosocomial. Combinaia ntre capacitatea de adaptare la condiiile de mediu i gama larg de
factori de rezisten l face un agent patogen nosocomial de temut (Nordmann, 2004). A.
baumannii reprezint cauza multor focare de infecie la nivel mondial (Villegas; Hartstein,
2003), manifestnd niveluri tot mai ridicate de rezisten. Numeroase semnalri raporteaz
tulpini MDR de A. baumannii izolate din unitile spitaliceti din Europa, America de Nord,
- 27 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Argentina, Brazilia, China, Taiwan, Hong Kong, Japonia, Coreea i din zone ndeprtate ca
Tahiti din Pacificul de Sud (Barbolla i colab., 2003; Houang i colab., 2001; Levin i colab.,
1996). Specia determin infecii la pacienii imunosupresai, la pacieni cu boli grave, pre cum i
la cei tratai cu anibiotice de spectru larg ( Garcia-Garmendia i colab., 200, John i colab., 2006 ).
1.8.2. Manifestri clinice ale infeciei cu A. baumannii
Infeciile determinate de A. baumannii sunt frecvente n unitile de terapie intensiv, caz
n care acestea reprezint principala cauz a pneumoniei, infeciilor tractului urinar,
meningitelor, conjunctivitelor i a bacteriemiei. Mai puin frecvent, specia determin infecii la
nivelul pielii i esuturilor moi, infecii abdominale, infecii ale sistemului nervos central
(Fournier; Richet, 2006). Mai recent, s-a demonstrat c A. baumannii a devenit un agent patogen
major n infeciile asociate plgilor (Aronson i colab., 2006). De cele mai multe ori este dificil
de fcut distincia ntre colonizarea i infecia cu A. baumannii (Joly-Guillou, 2005). Factorii de
risc n colonizare i infecie sunt reprezentai de proceduri invazive, ca de exemplu ventilaia
mecanic, interveniile chirurgicale recente, utilizarea antibioticelor de spectru larg. Infecia a
fost definit drept izolarea unei tulpini dintr-o surs steril n mod normal, n timp ce colonizarea
reprezint izolarea unei tulpini dintr-un eantion clinic, n absena simptomelor clinice specifice
infeciei (Magret i colab., 2011).
Ca i P. aeruginosa, speciile genului Acinetobacter sunt larg rspndite n mediul ambiant
(Quinn, 1998). Anumite tulpini sunt rezistente la dezinfectani iar acestea reprezint cele mai
frecvente microorganisme izolate de pe minile personalului medical (Larson, 1981). 25% din
pacienii sntoi exter nai prezint colonizare la nivelul pielii, iar 7% la nivelul faringelui
(Quinn, 1998).
Dac n urm cu 25 de ani, s-a fost demonstrat c Acinetobacter sp. poate dobndi factori
genetici de rezisten (Goldstein si colab., 1983), n prezent se cunoate faptul c transpozoni
(elemente genetice mobile, integrate n cromosomul bacterian sau localizate la nivel plasmidial)
au rol important n diseminarea determinanilor genetici de rezisten la tulpinile de
Acinetobacter sp. (Palmen; Hellingwerf, 1997). Au fost descrii transpozoni care conin integroni
(din clasa 1) elemente genetice care, dei nu au capacitate de transpozitie, conin gena int i
casete genice ce pot fi mobilizate n ali integroni sau la situsuri secundare din genomul bacterian
(Poirel si colab., 2005).

- 28 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Majoritatea tulpinilor sunt rezistente la penicilin, iar unele izolate clinice sunt rezistente de
asemenea la cefalosporine prin supraproducia unei cefalosporinaze cromozomale. Nivelul de
rezisten la carbapeneme a crescut de la 9% n 1995, la 40% n 2010 (fig. 9) i este ntr-o
continu cretere n prezent, potrivit ECDC (Munoz-Price i Weinstein, 2008). Nivelul de
multirezisten este net superior celorlali ageni patogeni Gram negativi (Lockhart i colab.,
2007). Din acest motiv, este foarte important s se fac disticia ntre colonizarea i infecia cu A.
baumannii, n vederea stabilirii dozelor terapeutice (Shelburme i colab., 2008).

Fig. 9. Reprezentarea nivelului rezistenei A. baumannii la carbapeneme n 2010 Europa ( www.mysticdata.org.)

A. baumannii reprezint cauza unor infecii n multe ri ale Europei (Looveren;


Goossens, 2004). De la nceputul anilor '80, au fost descrise focare de infecie determinate de
tulpini de A. baumannii n Europa, n special n Anglia, Fran a, Germania, Italia, Spania, i
Olanda (Villegas; Hartstein, 2003). Diseminarea tulpinilor MDR de

A. baumannii nu se

limiteaz doar la unitile spitaliceti intraurbane ci are loc la nivel naional ; de exemplu
diseminarea tulpinilor MDR

aparinnd EU II (clona european II) de A. baumannii din

Portugalia (Da Silva i colab., 2007). Transferul internaional de pacieni colonizai a dus la
introducerea i rspndirea epidemiei ulterioare cu tulpini de A. baumannii multirezistente n
rile de Sud din Europa de Nord, cum ar fi Belgia i Germania (Schulte i colab., 2005). Aceste
evenimente subliniaz importana unui screening adecvat precum i a msurilor de control
epidemiologic (Peleg si colab., 2008).
- 29 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

CAPITOLUL 2
MECANISME DE REZISTEN ALE BACILILOR GRAM NEGATIVI NONFERMENTATIVI LA ANTIBIOTICELE -LACTAMICE

Rezistena reprezint capacitatea unui microorganism de a crete n prezena unei


concentraii ridicat e ale unui agent antimicrobian. Bacteriile au o capacitate remarcabil de a
dezvolta rezisten la fiecare nou antibiotic introdus n terapia antiinfecioas.
Incidena tot mai ridicat n ultimii ani a BGNNF se datoreaz att dobndirii unor factori
genetici de rezisten la antibiotice, ct i a unor factori de virulen, care le determin condiia
de patogeni oportuniti. Infeciile datorate BGN NF sunt n prezent mai rspndite i cu evoluie
sever datorit inclusiv antibiorezistenei, ca i riscului de oc endotoxic (Lazr, 2001).
Principalele clase de antibiotice utilizate n tratamentul infeciilor determinate de BGNNF sunt lactamii, aminoglicozidele i quinolonele.
Rezistena la antibiotice poate fi natural (intrinsec) sau dobndit prin intermediul
genelor de rezisten dobndite sau aprute prin mutaii (Jehl i colab., 2010).
2.1. Mecanisme de rezisten natural
Rezistena intrinsec se refer la bacteriile insensibile la un antibiotic, n stare natural,
fr s dobndeasc factori genetici de rezisten de la alte specii sau tulpini bacteriene (Jehl i
colab., 2010).
Rezistena natural este o caracteristic proprie, aparinnd tulpini lor unei specii sau unui
gen, oricare ar fi mediul de izolare. Rezistena natural este ntotdeauna transmisibil la
descendeni (transmitere vertical), materialul genetic codificator fiind localizat n cromosomul
bacterian. Rezistena intrinsec fa de antibiotice face parte dintre caracteristicile fenotipurilor
slbatice ale speciilor bacteriene (Jehl i colab., 2010).
Mecanismele rezistenei naturale
Rezistena natural se produce prin urmtoarele mecanisme:
inta de aciune a antibioticului este inaccesibil;

- 30 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

antibioticul prezint o afinitate sczut pentru int sau inta celular de aciune a
antibioticului lipsete; de exemplu, membrana extern a bacililor Gram negativi
este impermeabil pentru anumite clase de antibiotice (glicopeptide, macrolide,
lincosamide, streptogramine) (Kotra i colab., 2002).

Originea genelor de rezisten la antibiotice n populaiile bacteriene este dubl


(Mihescu i colab., 2007) :

pe de o parte exist, n mod natural, gene de rezisten, care probabil au aprut n


evoluie n populaiile bacteriene din sol i ape, ca modaliti de autoprotecie a
productorilor de antibiotice sau de protecie a speciilor asociate acestora i fa
de substanele nocive produse de exemplu de speciile vegetale asociate;
pe de alt parte datorit unor mutaii ale unor gene constitutive ce codific pentru
anumite enzime din metabolismul bacterian i care au evoluat prin extinderea
specificitii de substrat (de exemplu kinazele i acetil-transferazele care pot
modifica aminoglicozidele prin fosforilare i adenilare).
2.2. Mecanismele rezistenei dobndite
Rezistena dobndit se traduce prin scderea sau pierderea total a sensibilitii unei
tulpini microbiene la unul sau mai multe antibiotice.
Rezistena dobndit la antibiotice poate fi mediat de (Lazr, 2001):
1.

determinani genetici cromosomali;

2. prezena plasmidelor R (de rezisten i multirezisten la antibiotice).


3.

secvene de ADN excedentare (transpozoni, integroni), integrate prin


recombinare;

2.2.1. Rezistena mediat cromosomal (rezistena primar) este datorat unei mutaii a genei care
codific fie inta antibioticului, fie sistemul de transport transmembranar care controleaz
ptrunderea antibioticului n celula bacterian (Lazr, 2001).
Rezistena dobndit prin mutaii
Sub presiunea selectiv a antibioticelor se pot produce modificri genetice prin mutaii
punctiforme ce pot modifica sensibilitatea organismelor la unul sau o clas de antibiotice prin
modificarea structural a intei de aciune a antibioticului. Se pot produce i schimbri genetice
macroevolutive care implic rearanjarea unor secvene mari de ADN prin transpoziie; dac
- 31 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

schimbrile implic deplasarea genelor de rezisten i trecerea lor sub controlul unui nou
promotor organismul devine rezistent (Lazr, 2001).
2.2.2. Rezistena plasmidial
Genele de rezisten sunt localizate fie la nivel plasmidial, fie la nivelul elementelor
genetice mobile de tipul transpozonilor sau integronilor, care se pot deplasa de pe o plasmid pe
alta sau pe cromosom n aceeai sau ntr-o alt tulpin microbian (Liebert 2009).
Plasmidele R (de rezisten transmisibil, cu caracter infecios) sunt elemente genetice
extracromosomale care confer celulei purttoare rezisten simultan la numeroase antibiotice,
la sulfamide, la cationii metalelor grele (Pb, Hg), (Watanabe, 1961) sau radiaii ultraviolete
(Herlea, 1998).
Structura molecular a plasmidelor:
Plasmidele R sunt molecule ADN dublu catenar circular covalent nchis sau deschis. La
speciile bacteriene Gram negative plasmidele R prezint dimensiuni mai mari dect cele descrise
la bacteriile Gram pozitive i pot conine peste 100 de gene. n structura plasmidelor R, genele
de rezisten la antibiotice pot fi localizate n structura unui transpozon. Au fost descrise
plasmide R stabile ns i situaii cnd plasmidele R sunt instabile i se pot elimina spontan, mai
ales dac presiunea selectiv exercitat de antibiotic scade pn la dispariie (Herlea, 1998).
Plasmidele R cuprind n alctuirea lor urmtoarele categorii de determinani genetici:

genele care confer rezisten la diferite antibiotice sau la acelai tip de agent
antimicrobian ( genele ,,r) fac parte din structura unor transpozoni, fiind delimitate de
secvene de inserie (Herlea 1998);

genele care formeaz factorul de transfer al rezistenei - sunt grupate ntr-un transpozon,
se numesc gene tra i codific sinteza proteinelor necesare transferului plasmidei prin
conjugare conferind plasmidei R funcia de conjugon (Lazr, 2001);

secvene de inserie (SI) reprezint cele mai simple elemente genetice transpozabile
(<2,5kb) (Nevers; Saedler, 1977); ele poart gena pentru transpozaz (tnp) responsabil
de procesele de mobilizare i integrare, flancat la extremiti de secvenele repetate
invers (SRS i SRD) (fig. 10); O serie de SI au funcia de a activa expresia genelor
nvecinate (Poirel i colab., 2012). La tulpinile de Acinetobacter sp. au fost descrise pn

- 32 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

n prezent peste 30 SI (Siguier i colab., 2006), printre cele mai frecvente fiind ISAba1,
ISAba4 i ISAba125.
SRS

SRD
tnp
tnp

Fig. 10. Reprezentarea schematic a unei secvene de inserie (dup Partidge, 2011).

secven e de iniiere a procesului de replicare (,, ori);

genele ce asigur replicarea autonom a plasmidei.


Clasificarea plasmidelor R:

1. dup capacitatea de a media prin conjugare transferul intercelular de material genetic


(Herlea, 1998):
plasmidele conjugative (transmisibile) prezint dimensiuni mari (> 30 kb),
capabile s medieze transferul intercelular de material genetic, prezint
operonul tra sau de transfer a mai mult de 25 gene ce codific sinteza pilinei
i asamblarea pililor de sex, replicarea ADN i fenomenul de incompatibilitate
a plasmidelor similare i precum represia expresiei
plasmide auto-transmisibile au

genelor tra; aceste

un rol n diseminarea genelor ce confer

rezisten la antibiotice, la metale grele, precum i a elementelor genetice


transpozabile i a integronilor (Herlea, 1998);
Bryan i colab., (1973) au propus clasificarea plasmidelor R identificate la tulpinile de P.
aeruginosa n patru grupe de incompatibilitate notate P1, P2, P3, P4. La specia amintit anterior,
un numr extrem de redus de plasmide R conjugative au fost ncadrate ulterior n grupul P sau C
(Sagai i colab., 1976 ).
plasmide non-conjugative prezint o regiune implicat n mobilizarea lor de
ctre plasmidele conjugative (regiune mob), prin formarea unor cointegrate
structurale (Smillie i colab., 2010) , fiind astfel indus caracterul de conjugon;
plasmide mobilizabile nu pot iniia conjugarea ns, datorit prezenei
regiunii mob, pot fi mobilizate i transferate la bacteria receptor, n procesul
de conjugare iniiat de o alt plasmid conjugativ ce coexist n bacteria
- 33 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

donor. Pn n prezent au fost descrise

ase familii de plasmide MOB:

MOBF, MOBH, MOBQ, MOBC, MOBP, MOBV (Smillie i colab., 2010) . Din
cele 1730 plasmide descrise n 2009 n baza de date GenBank, cele mai multe
familii de plasmide MOB au fost identificate astfel: familia MOBP a fost cel
mai frecvent identificat (273 plasmide) urmat de familia MOBH. Fiecrei
familii i corespund subfamilii astfel: a fost descris subfamlia MOBF12 ce
corespunde plasmidelor din grupul de incompatibilitate IncF; iar subfamilia
MOBP5 corespunde plasmidelor ColE1-like (Smillie i colab., 2010) .
2. dup capacitatea de a se integra n cromosomul celulei gazd:
Plasmide integrative pot exista n dou stri alternative, integrate reversibil
n cromosomul bacterian (episomi) sau n stare autonom (Herlea, 1998);
Plasmide neintegrative exist n stare autonom neintegrndu-se n
cromosom (Herlea, 1998).
3. dup compatibilitatea de grup: plasmidele asemntoare sunt incompatibile n aceiai
celul; plasmidele incompatibile prezint un grad de omologie de secven (>60%) mai
mare dect cea a plasmidelor compatibile (Herlea, 1998).
Spre deosebire de reprezentanii familiei Enterobacteriaceae, la care plasmidele au fost
clasificate pe baza metodelor moleculare (hibridizare Southern Blot) n 27 de grupe de
incompatibilitate, la genul Acinetobacter informaiile sunt destul de limitate privind plasmidele
transferabile, i mai ales la A. baumannii - patogen oportunist, care determin infecii din ce n ce
mai frecvente n ultimii ani n seciile de terapie int ensiv. Analiza rezultatelor secvenierii
diferitelor replicaze la A. baumannii, a artat c plasmidele genului Acinetobacter reprezint un
tip particular, total diferit fa de al altor organisme procariote (Towner i colab., 2011). Autorii
au elaborat o schem de clasificare a replicazelor A. baumannii, pe baza metodei PBRT (PCR
Based on Replicon Typing) fiind mprite n 19 grupuri notate de la GR1 - GR19, pe baza
omologiei de secven a nucleotidelor. De cele mai multe ori prezena -lactamazelor dobndite
din clasa D (CHLD) la A. baumannii este asociat cu localizarea la nivelul GR6 (repAci6)
(Bertini i colab., 2010; Towner i colab., 2011).

- 34 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

2.2.3. Rezistena mediat de elemente genetice transpozabile


Alturi de SI, transpozonii i integronii reprezint principalele categorii de elemente
genetice transpozabile.
2.2.3.1. Transpozonii sunt secvene de ADN mobile (cu poten ial de transpoziie), care includ n
structura lor gene structurale delimitate la extremiti de SI, a cror mrime variaz ntre 2,19,3kb (Mihescu i colab., 2007). Transpozonii, prin procesul de transpoziie, pot produce
mutaii la nivelul genei n care se inser, pot media rearanjamente genetice, pot dobndi noi
gene contribuind astfel la variabilitatea materialului genetic ntr-o populaie bacterian. Studiul
transpozonilor s-a amplificat odat cu semnalarea faptului c genele de rezisten la antibiotice
pot sa treac de pe o plasmid pe alta. Relocarea transpozonilor duce la instabilitate genetic,
asociat cu modificri fenotipice, dac transpoziia are ca r ezultat inseria unui element
transpozabil ntr-o gen structural (Mihescu i colab., 2007). Dac transpoziia are loc ntr-o
gen reglatoare, o gen care este represat n mod normal, poate fi exprimat constitutiv i la un
nivel superior celui obinuit. Pentru ca un element transpozabil s se insere ca o entitate de sine
stttoare, este necesar ca transpozaza

s recunoasc extremittile sale, caracterizate prin

prezena SRI (secvene repetate invers) ce au rolul de situsuri de recunoatere pentru


transpozaz, enzim ce catalizeaz procesul de transpoziie. Datorit capacit ii de mobilizare ,
transpozonii sunt factori majori ai reorganizrii informa iei genetice i pentru acumularea de
gene de rezisten ntr-o singur plasmid (Poirel i colab., 2012). Transpoziia este o cale rapid
i eficient pentru transferul concomitent al rezistenei la anumite antibiotice sau clase de
antibiotice.
Transpozonii bacterieni pot fi clasificai n dou clase dup complexitatea genetic
(Poirel i colab., 2012)
Clasa I include transpozoni compui ce poart o varietate de gene de
rezisten sub form de secvene centrale delimitate de secvenele de inserie
ce le flancheaz;
Clasa II transpozoni compleci;
Clasa I - Transpozonii compui sunt n mod normal integrai n cromosomul bacterian. Se pot
transpoza dintr-un situs n altul, iar mecanismul de transpoziie se realizeaz printr-o secven
intermediar circular covalent nchis i nu copiaz situsul int in momentul integrrii n ADN.
- 35 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Transpozonii compui conin o serie de gene structurale, delimitate la extremiti de secvene de


inserie (SI) (fig. 11 A), a cror exprimare confer proprieti noi celulei purttoare (rezisten la
antibiotice, sintez de toxine, factori de virulen)
Clasa II Transpozonii compleci prezint secvene SRI terminale mai lungi dect
transpozonii compui, dar nu prezint secvene de inserie. Pot fi localizai la nivelul unor
plasmide cu spectru larg de gazd i mediaz transferul orizontal i vertical al genelor de
rezisten multipl. Transpozonii compleci poart elemente genetice mobile de tipul
integronilor, ce prezint un sistem de integrare situs specific, responsabil de dobndirea de
multiple elemente genetice mici, denumite casete de gene, care conin gene de rezisten la
antibiotice sau codific gene de virulen. Tn compleci sunt grupai n familia Tn3 care include
dou subfamilii: Tn3like i Tn21like (Poirel i colab., 2012).
O categorie separat, din punct de vedere al structurii genetice, o reprezint transpozonii
simpli (Tn), care sunt asemntori SI, dar se deosebesc de acetia prin faptul c secvena
central poart gene a cror expresie fenotipic este decelabil i confer proprieti noi
celulei purttoare (Jury i colab., 2010). Genele structurale sunt flancate de secvene
repetate lungi (1-2 kb), cel mai adesea n ordine inversat (fig. 11 A).

Fig. 11. Reprezentarea schematic a transpozonilor compui Tn2006 (A), Tn2008 (B) i Tn2007 (C) (dup Mugnier
i colab., 2010).

SI ISAba1 (1180bp) a fost identificat la A. baumannii (Corvec i colab., 2003). Iniial

aceast SI a fost raportat doar la tulpinile acestei specii (Partridge i colab., 2011). Aceast SI
- 36 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

este localizat n amonte fa de gena blaOXA-23, n structura transpozonului Tn2008 (fig.11 B),
n structura transpozonul compus Tn2006 gena blaOXA-23 este flancat de dou copii ale SI
ISAba1 orientate n direcie opus (fig.11 A), iar n structura Tn2007 gena blaOXA-23 este
precedat de SI ISAba4 (fig. 11 C) ce difer funcional de ISAba1 (Mugnier i colab., 2010).

2.2.3.2. Integronii sunt structuri modulare cu rol major n evoluia rezistenei la antibiotice.
Integronii sunt secvene de ADN capabile s nglobeze i s medieze deplasarea unor secvene
mobile, scurte de ADN denumite casete genice (Hall; Collis, 1995; Hall; Collis, 1998).
Structura genetic. Un integron conine o secven ce codific integraza (Int1) localizat
la nivelul regiunii conservate 5' i o secven adiacent de recombinare (att), care recunoate
situsul specific de recombinare; regiunea promotor (P) care activeaz expresia genelor situate n
regiunea din aval situsului de recombinare (fig. 12), iar n regiunea conservat 3' , cu o lungime
variabil, se gsesc genele de rezisten la un antibiotic (gena qacE ce confer rezisten la
antiseptice i gena sul1, care codific o dihidropteroat-sintetaz ce mediaz rezistena la
sulfonamide) (Skold 2000).

59 bp

59 bp

59 bp

Fig. 12. Reprezentarea schematic a integronilor din clasa 1. Gena int1 codific pentru tirozin-recombinaz
(integraz), ce catalizeaz recombinarea ntre secvena adiacent de recombinare (59 bp) i situsul de
recombinare (att) rezultnd integrarea sau excizia casetelor genice din regiunea din aval; ORF1, ORF2
( open reading frameshift)=secven cadru de citire (dup Csilla, 2011).

- 37 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Dup integrare, secvenele de recombinare sunt refcute, permind astfel integrarea


ulterioar a altor casete genice. Structura integronilor faciliteaz gruparea pe acelai element
genetic mobil a mai multor gene de rezisten care pot fi ulterior transferate simultan n
popula iile bacteriene. Prin intermediul casetelor genice, complementul genelor de rezisten
poate fi permanent rearanjat i deplasat de pe un replicon pe altul. Un integron poate grupa i
integra casete genice multiple conducnd astfel la apariia multirezistenei la antibiotice (Jury i
colab., 2010).
Pn n prezent au fost descrise 9 clase principale de integroni (Gu i colab., 2007), dintre
care cei din clasa 1 sunt cel mai frecvent semnalai la P. aeruginosa i A. baumannii, localizai la
nivel plasmidial sau n structura unor transpozoni, avnd rol n transferul orizonal al genelor de
rezisten la antibiotice i n procesul evolutiv al multirezistenei i rezistenei extinse la
antibiotice.
Integronii de clas 2 i 3 prezint integraza Int2 respectiv Int3 care prezint omologie de
61% cu Int1 (Gu i colab., 2007). Clasa 2 de integroni deriv din Tn7; integronii din clasele 4 i
5 sunt asociai cu genele de rezisten la trimetoprim a speciilor de Vibrio (Mazel i colab.,
2006).
Dup Mazel, 2006 integronii sunt clasificai n dou grupe :
Integronii de rezisten poart majoritatea casetelor genice ce confer
rezisten la antibiotice i sunt de cele mai multe ori localizai n structura
unui transpozon;
Super-integronii sunt integroni de dimensiuni mari, localizai exclusiv
cromosomal, ce conin gene cu o varietate de funcii.

- 38 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

2.3. REZISTENA BGNNF LA PRINCIPALELE CLASE DE ANTIBIOTICE


2.3.1 REZISTENA LA ANTIBIOTICELE -LACTAMICE
Substanele antimicrobiene acioneaz prin urmtoarele mecanisme de aciune (fig. 13)
(Chifiriuc i colab., 2011):
-

inhibiia sintezei peretelui celular;

inhibiia transportului transmembranar;

inhibiia sintezei proteinelor respectiv a proceselor de transcriere i traducere a materialului


genetic;

inhibiia sintezei acizilor nucleici;

blocarea unei ci metabolice prin inhibiie competitiv.

Fig 13. Principalele inte de aciune ale substanelor antimicrobiene


(http://faculty.irsc.edu/FACULTY/TFischer/micro%20resources.htm).

Antibioticele -lactamice reprezint prima i cea mai utilizat clas de substane


antimicrobiene, cuprinznd un numr mare de compui, naturali, semi-sintetici sau sintetici. Sunt
clasificate pe baza structurii chimice n peniciline, cefalosporine, carbapeneme, monobactami
(Buiuc i colab., 1992; Mihescu i colab., 2007 ) (Tabelul 3).

- 39 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Tabelul 3. Clasificarea antibioticelor -lactamice, dup Buiuc (1992); Mihescu i colab., (2007)

Clase de antibiotice -lactamice


Peniciline
NUCLEUL PENICILINA
acidul 6-aminopenicilanic

Reprezentani
Peniciline naturale:

Penicilina G i V
Benzatinpenicilina G
Procainpenicilina G

Peniciline de semisintez
Specii productoare
Fungi: Penicillium chrysogenum
Aspergillus nidulans
Bacterii: Streptomyces clavuligerus
Nocardia lactamdurans

Aminopeniciline
Carboxipeniciline
Ureidopeniciline

Cefalosporine
NUCLEUL CEFALOSPORINA
acidul 7-aminocefalosporanic
Specii productoare:
Fungi: Cephalosporium chrysogenum
Bacterii: Streptomyces clavuligerus
Carbapeneme
NUCLEUL CARBAPENEM

Izoxazolilpeniciline
Amidinopeniciline
Cefalosporine generaia I

Oxacilina
Mecilinam
Cefazolina
Cefalotina

Cefalosporine generaia a
IIa
Cefalosporine generaia a
IIIa

Cefoxitina
Cefuroxima
Ceftriaxona
Ceftazidim
Imipenem
Ertapenem
Meropenem

Specii productoare
Bacterii: Streptomyces catlea
4

Ampicilina
Amoxicilina
Ticarcilina
Temocilina
Mezlocilina
Azlocilina
Piperacilina

Monobactami
NUCLEUL MONOBACTAM

Aztreonam

Specii productoare
Bacterii: Chromobacterium violaceum

2.3.1.1. Mecanismele de aciune ale antibioticelor -lactamice.


Antibioticele -lactamice inhib ultima etap a sintezei peptidoglicanilor, respectiv formarea
punilor interpeptidice. Aceti compui prezint analogie structural cu dipeptidul terminal Dala-D-ala, care face parte din pentapeptidul mureinic (Chifiriuc i colab., 2011).
Mecanismul aciunii antibioticelor -lactamice const n aceea c substratul transpeptidrii
captul carboxil al D-ala din structura intermediarului dizaharid-tetrapeptid - are omologie
structural strns cu inelul -lactamic.
2.3.1.1.1. Ptrunderea -lactaminelor n celule la bacteriile Gram negative.

- 40 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Antibioticele -lactamice sunt acizi organici cu pKa de ordinul 2.7. -lactaminele sunt solubile n
ap i complet ionizate n soluie, motiv pentru care unele prezint dificulti de traversare a
membranelor (Jehl i colab., 2010). Pentru c inta lor este situat n partea extern a membranei
citoplasmatice, la bacteriile Gram negative membrana extern a peretelui celular reprezint
singurul obstacol ntre -lactamine i inta lor de aciune. Compoziia peretelui celular, variabil
n funcie de specia bacterian considerat, va determina sensibilitatea speciei considerate la lactamine (Jehl i colab., 2010).
a. Ptrunderea pe cale lipofil. Dei nu este principala cale de acces a -lactaminelor spre inta
lor de aciune, aceast cale este important pentru ptrunderea unor antibiotice -lactamice. n
msura n care unele -lactamine sunt lipofile, se poate presupune c ele prefer aceast cale,
dei LPS au un rol important de barier de permeabilitate. Cu ct membrana extern este mai
bogat n LPS i mai srac n fosfolipide, cu att este mai limitant pentru difuzia moleculelor
lipofile. Cu toate acestea, aceast cale este funcional pentru -lactaminele lipofile n anumite
condiii. Trecerea acestor substane prin porii hidrofili este foarte lent, iar n aceste condiii
ptrunderea lipofil este semnificativ (Chifiriuc i colab., 2011).

b. Ptrunderea prin intermediul porinelor.


Porinele sunt proteine transmembranare care au capacitatea de a se agrega pentru a forma canale
(pori), care permit astfel difuzia prin membran a diferitelor molecule hidrofile cu mase
moleculare mai mici de 600 daltoni. Porinele constituie un element cu importan deosebit
pentru speciile bacteriene Gram negative (Jehl i colab., 2010). Pn n prezent nu au fost
descrise mutante viabile total lipsite de porine. O celul bacterian posed adesea mai multe
tipuri de porine, iar trecerea prin aceste canale constituie modalitatea preferenial a lactaminelor hidrofile. La majoritatea speciilor bacteriene Gram negative, porinele sunt proteine
cu mas molecular de 35 40 kDa (Jehl i colab., 2010). La P. aeruginosa se cunosc 64 de
porine ncadrate n trei mari familii: OprD (fig. 14), TonB i OprM (Dinesh i colab., 2003).
Absena porinelor OprD (ce au rolul de a favoriza ptrunderea n celula bacterian a unor
molecule ncrcate pozitiv sau anumitor carbapeneme) este datorat unei mutaii ce poate aprea
cu o frecven relativ nalt (10 -7), sau poate fi cauza unei deleii, substituii sau inserii ce
determin inactivarea genei OprD. Pierderea OprD este frecvent asociat cu rezistena la
- 41 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

imipenem ce necesit aceast porin pentru a traversa membrana extern. Curios este faptul c
trecerea meropenemului nu este influenat de pierderea OprD, ceea ce sugereaz faptul c
diferitele carbapeneme traverseaz membrana extern prin canale diferite. Aminoglicozidele i
colistinul nu traverseaz membrana extern prin intermediul porinelor (Dinesh i colab., 2003).

Fig. 14. Reprezentrea schematic a moleculei porinelor de tip OprD bazat pe studii de cristalografie cu
conformaie beta pliat i respectiv alfa helical la P. aeruginosa (dup Csilla, 2011).

Factorii fizico-chimici care infueneaz ptrunderea antibioticelor -lactamice n celulele


bacteriene sunt reprezentai de hidrofobicitate, mrime i ncrctura moleculelor.
2.3.1.1.2. Producerea de -lactamaze
Cel mai important mecanism de rezisten la -lactamine este reprezentat de sinteza
enzimelor cu efect hidrolizant asupra antibioticelor -lactamice (-lactamaze) (Chifiriuc i
colab., 2011), enzime care reprezint o familie mare cu structur unitar, dar difer prin secvena
aminoacizilor, ce cliveaz ciclul -lactamic i inactiveaz moleculele antibioticului.
Clasificrile acestor enzime sunt foarte complexe, una dintre primele semnalri a fost cea
referitoare la o tulpin bacterian productoare de lactamaz, o enzim cu efect hidrolizant al
legturii -lactamice din structura acestei clase de antibiotice, esenial pentru activitatea
antibioticelor -lactamice, i cu rol de analog al legturii peptidice ce leag aminoacidul D-ala
terminal a tetrapeptidelor n structura lanurilor peptidoglicanului. O singur molecul de lactamazele poate hidroliza peste 100 000 de molecule -lactamice, deci sunt enzime foarte
eficiente dei cu spectru de activitate restrns. (Chifiriuc i colab., 2011).
2.3.1.1.2.1. Clasificarea -lactamazelor
- 42 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

-lactamazele au fost clasificate n funcie de substratul pe care-l hidrolizeaz, de


sensibilitatea la inhibitori, de modul de sintez (constitutiv sau inductibil) i de localizarea
cromosomal sau plasmidial a genelor codificatoare (Mihescu i colab., 2007).
2.3.1.1.2.1.1. Clasificarea -lactamazelor n funcie de spectrul de activitate (fig. 15):
penicilinaze (cele care acioneaz asupra penicilinelor);
cefalosporinaze (hidrolizeaz cefalosporinele); unele au spectru larg de aciune (cele care
hidrolizeaz penicilinele i cefalosporinele);
aztreonamaze (hidrolizeaz monobactamii);
carbapenemaze (acioneaz asupra carbapenemelor).

Fig. 15. Spectrul de activitate al diferitelor tipuri de beta-lactamze.

2.3.1.1.2.1.2. Clasificarea -lactamazelor pe baza secvenei moleculare i tipul de molecule


hidrolizate (Ambler i colab., 1991). Din acest punct de vedere -lactamazele sunt mprite n
patru clase, A, B, C i D pe baza secvenei moleculare i de tipul de molecule hidrolizate. Clasele
A,C i D reunesc enzimele cu resturi de serin la situsul activ, iar n clasa B sunt enzimele zincdependente avnd la situsul activ 4 atomi de Zn (fig. 16).

- 43 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 16. Reprezentarea conformaiei moleculare a -lactamazelor pe baza studiilor de cristalografie, cu secvene
beta pliate i conformaie alfa helical (dup http://www.ebi.ac.uk/pdbe/entry-images/1bsg_cbc600.png).

Mecanismul de aciune al unei serin --lactamazelor, ilustrat n fig. 17 se deruleaz n


urmtoarele etape:
I- enzima formeaz un complex necovalent cu antibioticul;
II -inelul -lactamic este atacat de gruparea lateral hidroxil, liber, a unui rest de serin din
situsul catalitic activ al enzimei i se formeaz un acil-ester covalent;
III - hidroliza acestui ester elibereaz enzima activ i inelul -lactamic inactiv.

Fig. 17. Ilustrarea schematic a etapelor aciunii beta -lactamazelor ((dup Hall i Barlow, 2005).

- 44 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

-lactamazele claselor A i B sunt foarte active fa de benzil-penicilin, respectiv


peniciline i cefalosporine. Enzimele clasei C sunt n general inductibile, dar mutaiile genelor
codificatoare pot duce la supraexpresie. Enzimele clasei D sunt de tip OXA, deoarece
hidrolizeaz oxacilina, antibiotic n general rezistent la -lactamaze (fig.18) (Chifiriuc i colab.,
2011).

Fig. 18. Clasificarea beta-lactamazelor n funcie de localizarea genelor codificatoare i de spectrul de activitate
(adaptat dup Hall i Barlow, 2005).

Enzimele grupate n clasa A sunt cel mai frecvent ntlnite, urmate de cele din clasa C.

n prezent au fost descrise mai mult de 850 de -lactamaze (Queenan; Bush, 2007).
Clasa A de -lactamaze
-lactamazele clasei A prezint spectru ridicat de hidroliz (peniciline, cefalosporine,
carbapeneme, aztreonam) dar sunt sensibile la aciunea acidului clavulanic i a tazobactamului
(Queenan i Bush, 2007). Au fost descrise fenotipuri bacteriene rezultate datorit presiunii
selective din mediul spitalicesc, astfel a fost semnalat fenotipul de rezisten la inhibitor, prima
dat la familia de enzime TEM, denumit IRT (Inhibitor Resistant TEM), descris ulterior i n
cadrul familiei de enzime SHV (Lin i colab., 1998).
- 45 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

n cadrul clasei A a -lactamazelor a fost descris fenotipul determinat de BLSE (lactamaze de spectru extins).
Enzimele de tip BLSE hidrolizeaz penicilinele, cefalosporinele de spectru ngust i pe
cele de spectru extins i monobactamul aztreonam (Patterson; Bonomo, 2005), dar nu pot
hidroliza eficient cefamicinele, carbapenemele i sunt sensibile la inhibitorii de -lactamaze.
Majoritatea enzimelor de tip BLSE provin din familiile TEM, SHV ce prezint omologie de 61%
cu TEM-1 (Jacoby; Munoz-Price, 2005) i CTX-M (Naas i colab., 1999), i mai rar din familiile
de enzime VEB, BES, BEL, GES-1, PER dar pot s nu aparin unei familii bine definite (Naas
i colab., 2008); denumirea acestora indic locul izolrii i identificrii.
BLSE de tip CTX-M, sunt codificate plasmidial, dar provin de la genele cromosomale
preexistente de tip BLSE ale tulpinilor de Kluyvera spp., care sunt organisme nepatogene
comensale (Bonnet 2004).
Enzimele de tipul VEB (,,Vietnamese Extended Spectrum -lactamase) au fost raportate
prima dat (blaVEB-1) la un izolat clinic de Escherichia coli de la un pacient din Vietnam (Poirel
i colab., 1999). BlaVEB-1 confer rezisten la ceftazidim, cefoxitim i monobactami, ns nu
confer rezisten la carbapeneme. Pn n prezent au fost descrise apte variante ale genei
blaVEB-like (http://www.lahey.org./studies). Genele blaVEB-like au fost semnalate la izolate clinice
de enterobacterii n Europa, dar i la P. aeruginosa n Tailanda i Kuveit (Girlich i colab.,
2002), izolate clinice de A. baumannii din Franta, Argentina (Naas i colab., 2006b). VEB-1 a
fost prima -lactamaz de spectru extins identificat la nivelul casetelor genice ale clasei 1 de
integroni (Poirel i colab., 1999), ca parte component a In 53 (Naas i colab., 2001) ce intr n
structura Tn2000.
BLSE de tipul BES (,,Brazilian Extended Spectrum -lactamase) au fost identificate
numai cu varianta BES-1 la un izolat clinic de Serratia marcescens n Rio de Janeiro. BlaBES-1
confer rezisten la peniciline, aztreonam i cefotaxim (Bonnet i colab., 2000 ).
Enzimele de tipul BEL (,,Belgium Extended Spectrum -lactamase) au fost identificate
doar la izolate clinice de P. aeruginosa n Belgia, 2004 (Poirel i colab., 2005) cu varianta BEL 1. Spectrul de hidroliz al acestor enzime este similar celora de tip CTX-M, cu deosebirea c
prezint capacitate mai ridicat de a hidroliza cefotaximul dect ceftazidimul (Poirel i colab.,
2005).

- 46 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

BLSE de tip GES (Guyana Extended Spectrum -lactamase) au fost iniial identificate la
o tulpin de K. pneumoniae (blaGES-1) din Guyana Francez (Poirel i colab., 2000), n prezent se
cunosc 20 de variante genice blaGES-like cu localizare plasmidial sau cromosomal (Poirel i
colab., 2012) sau la nivelul casetelor genice din structura integronilor de clas 1 (Quenan i
Bush, 2007). Deoarece enzimele de tip GES prezint spectru larg de hidroliz ce include
penicilinele, cefalosporinele de spectru extins, au fost clasificate iniial BLSE (Giakkoupi i
colab., 2000). Din 2001 spectrul lor de hidroliz a inclus i imipenemul odat c u raportarea genei
blaGES-2 la un izolat clinic de P. aeruginosa (Poirel i colab., 2001).
Enzimele de tip PER (P. aeruginosa extended resistance) descrise la izolate clinice de P.
aeruginosa n Turcia la un pacient spitalizat anterior n Frana (Nordmann i colab., 1993) au
fost semnalate i n rndul izolatelor clinice de A. baumannii rezistente la ceftazidim (Kolayli i
colab., 2005).
Clasa B de -lactamaze grupeaz enzimele care conin Zn2+ la situsul activ. Tulpinile bacteriene
care produc aceste tipuri de enzime sunt rezistente la peniciline, cefalosporine, carbapeneme i la
inhibitorii de -lactamaze utilizai n clinic (Queenan i Bush, 2007), dar nu prezint capacitatea
de a hidroliza aztreonamul i sunt sensibile la aciunea EDTA.
Genele de tip blaMBL sunt localizate cromosomal, plasmidial sau n strucura diferitelor
casete genice ale integronilor (Queenan i Bush, 2007). Primele metalo--lactamaze detectate au
fost la specii oportuniste, cum ar fi Bacillus cereus, Aeromonas sp. i S. maltophilia, acestea
fiind enzime codificate cromosomal, de obicei asociate cu serin--lactamaze, a cror exprimare
fiind inductibil dup expunerea la antibiotice -lactamice. Cu excepia S. maltophilia, aceste
bacterii nu sunt frecvent asociate cu infeciile nosocomiale iar genele cromosomale pentru
metalo--lactamaze nu sunt uor transferabile (Queenan i Bush, 2007) .
La P. aeruginosa i A. baumannii au fost descrise pn n prezent apte grupe de metalo-lactamaze dobndite: IMP (,,imipenemase), VIM (,,Verona imipenemase), SPM (,,Sa Paolo
metallo--lactamase), GIM (,,German imipenemase), NDM (,, New Delhi metallo-lactamase), AIM (,,Adelaide imipenmase) i SIM (,,Seoul imipenemase). n timp ce enzimele
de tip GIM, SIM i AIM au fost limitate numai la anumite regiuni geografice ale globului, VIM
i IMP prezint distribuie global (Johnson i colab., 2007). ntre enzimele IMP i VIM exist o

- 47 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

diferen de distribuie i anume enzimele de tip IMP au fost descrise iniial i predomin n Asia
iar cele de tip VIM n Europa (Johnson i colab., 2007).

Fig. 19. Relaiile filogenetice ntre cele mai semnalate cinci metalo--lactamaze dobndite la BGNNF (dup
Johnson i colab., 2007).

Enzimele de tip IMP descrise n urm cu 34 de ani (Cornaglia i colab., 2011) n Japonia
s-au rspndit rapid la nivel mondial att la reprezentani ai familiei Enterobacteriaceae ct i la
BGNNF (P. aeruginosa i Acinetobacter sp. n special). Pn n prezent au fost descrise 20
varinate ale genei blaIMP (Cornaglia i colab., 2011).
Enzimele din familia VIM descrise prima dat n Europa n 1990, au n prezent, n 33 de
variante, identificate n cea mai mare parte la izolate clinice de P. aeruginosa (Bonnin i colab.,
2013) i sunt asociate casetelor genice clasei 1 de integroni (Nordmann i colab., 2011).
Enzimele de tip SPM-1 au reprezentat al III-lea grup de metalo--lactamaze dobndite
raportate la nceputul secolului XXI, la tulpini de P. aeruginosa din Brazilia (Toleman i colab.,
2002).
Metalo--lactamaza GIM-1 identificat la cinci pacieni ai unui centru medical din
Germania colonizai cu tulpini multirezistente de P. aeruginosa (Castanheira i colab., 2004),
prezint omologie de 43% cu -lactamaza IMP-1 (Walsh i colab., 2005).
Printre cele mai recent descrise la BGNNF au fost metalo--lactamazele de tip SIM-1 la
tulpini bacteriene de A. baumannii din Coreea de Sud (Mendes i colab., 2006).
Clasa C de -lactamaze

- 48 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Enzimele din aceast aceast clas produc cefalosporinaze de tip AmpC, DHA-1, CMY2, ACT-1, care sunt codificate n mod frecvent, de gene cromosomale dar se observ o
prevalen crescut n ultimii ani a enzimelor din aceast clas codificate plasmidial (Philippon i
colab., 2002). Organismele care exprim fenotipul AmpC sunt rezistente la peniciline,
combinaii de antibiotic -lactamic-inhibitor de -lactamaz i cefalosporine, incluznd
cefoxitin, cefotetan, ceftriaxon i cefotaxim.
Clasa D de -lactamaze
Enzimele acestei clase au fost catalogate ini ial ca fiind oxacilinaze, deoarece
hidrolizeaz oxacilina la un nivel mai ridicat dect alte enzime aparinnd claselor A sau C
(Paterson; Bonomo, 2005). -lactamazele de tip OXA pot determina fenotipuri de rezisten la
peniciline, cefalosporine, cefalosporine de spectru extins (BLSE de tip OXA) i carbapeneme.
BLSE de tip OXA sunt caracteristice tulpinilor speciei P. aeruginosa (Weldhagen i colab.,
2003), ns au fost descrise la multe alte specii bacteriene Gram negative. Majoritatea BLSE de
tip OXA nu hidrolizeaz cefalosporinele de spectru extins, cu excepia OXA-10, care are
capacitatea de a hidroliza cefotaximul, ceftriaxona i aztreonamul (Paterson i Bonomo, 2005).
Alte BLSE de tip OXA sunt reprezentate de OXA-11, -14,-16, -17, -19, -15, -18, -28, -31, -32,35 ce confer rezisten la cefotaxim i uneori la ceftazidim i aztreonam (Danel i colab., 1995;
Danel i colab.,1997, Danel i colab., 1998; Danel i colab., 1999). BLSE de tip OXA au fost
descrise iniial la un izolat clinic de P. aeruginosa de la un pacient spitalizat n Ankara (Paterson
i Bonomo, 2005). n Frana (2001) a fost descris BLSE OXA-10 la un izolat clinic de P.
aeruginosa (Poirel i colab., 2001 ). Prima -lactamaz de tip OXA cu activitate
carbapenemazic a fost descris n 1993, de Paton i colab.,; ea fost izolat de la o tulpin
multirezistent de A. baumannii izolat n 1985 de la un pacient din Scoia i denumit ARI-1
(,,Acinetobacter resistant to imipenem). Secvenierea ARI-1 a demonstrat c aparine CHDL iar
ulterior a fost denumit OXA-23 (Donald i colab., 2000 ). n prezent, se admite c, OXA-23
reprezint un subgrup nou al -lactamazelor de tip OXA cuidentitate de 36% cu OXA-5 i OXA10 din punct de vedere al structurii aminoacizilor. Pn n prezent au fost descrise 9 cluster-e de
-lactamaze de tip OXA cu activitate carbapenemazic, majoritatea la A. baumannii (Queenan i
Bush, 2007), (Tabelul 4). OXA-24 i OXA-40, care difer prin doar doi aminoacizi, au fost
descrise n Spania i Portugalia, la izolate clinice de A. baumannii (Bou i colab., 2000; Da Silva
i colab., 2004; Lopez-Otsoa i colab., 2002). OXA-51 este intrinsec la anumite subpopulaii de
- 49 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

A. baumannii (Heritier i colab., 2005 ), OXA-58 a fost descris la izolate clinice de A. baumannii
din Grecia, Frana, Italia, Romnia, Turcia, Argentina, Kuveit (Coelho i colab., 2006; Heritier i
colab., 2005; Marque i colab., 2005; Poirel i colab., 2005; Vahaboglu i colab., 2006). n
cluster-ul 5 sunt incluse oxacilinazele OXA-55 i OXA-SHE descrise la Shewanella algae
(Queenan i Bush, 2007); n cluster-ul 7 sunt cuprinse OXA-50 i enzimele PoxB culocalizare
cromosomal la P. aeruginosa; cluster-ul 8 cuprinde OXA-60, componente ale genomului
Ralstonia pickettii (Girlich i colab., 2004 ), iar cel din urm cluster include OXA-62,
cromosomal la Pandoraea pnomenusa (Schneider i colab., 2006 ).
Pentru clasificarea -lactamazelor au fost propuse mai multe sisteme, bazate pe
caracteristicile acestora sau pe profilurile substraturilor hidrolizate. Bush i colab., n 1995 au
propus o clasificare funcional a -lactamazelor, completat ulterior n 2010, care includea
aproape 190 de -lactamaze. Acest sistem de clasificare mparte -lactamazele n funcie de
substratul hidrolizat i comportamentul fa de inhibitori, ceea ce a dus la evidenierea a patru
grupuri majore:
A. primul grup cuprinde cefalosporinazele care nu sunt inhibate de acidul clavulanic.
B. n al doilea grup se regsesc penicilinazele, care, n general, sunt sensibile la aciunea
inhibitorilor de -lactamaze. Al doilea grup este submprit n subgrupurile 2a, 2b,
2be, 2br, 2c, 2e i 2f, pe baza ratelor de hidroliz a carbenicilinei, cloxacilinei, BLSE,
ceftazidimului, cefotaximului, carbapenemelor, aztreonamului i pe baza profilurilor
de inhibiie de ctre acidul clavulanic.
C. -lactamazele care sunt inhibate de agentul chelator al metalelor EDTA (acid
etilendiaminotetraacetic) aparin celui de-al treilea grup, cel al metalo--lactamazelor
(Walsh i colab., 2005).
D. al patrulea grup cuprinde -lactamazele care sunt inhibate de acidul clavulanic.
Astfel, enzimele clasei A au ca substrat preferenial penicilinele, iar cele aparinnd clasei C
hidrolizeaz cefalosporinele . Enzimele din clasa B pot hidroliza o gam larg de substraturi,
inclusiv carbapenemele (Walsh i colab., 2005) , care rezist hidrolizei majoritii celorlalte clase
de enzime. Pe de alt parte, -lactamazele clasei D hidrolizeaz -lactaminele de tipul oxacilinei.

- 50 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Tabelul 4. Principalele oxacilinaze la BGNNF ( dup Walther-Rasmussen; Hoiby, 2006; Schneider i colab., 2006 ;
Turton i colab., 2006)
Cluster

Subfamilie

Alte enzime componente

Referina bibliografic

OXA-23 (ARI-1)

OXA-27, OXA-49

Walther-Rasmussen;
Hoiby, 2006.

OXA-24

OXA-25, OXA-26, OXA-40, OXA-72

Walther-Rasmussen;
Hoiby, 2006

OXA-51

OXA-64- OXA-71, OXA-75-OXA-78,

Walther-Rasmussen;

OXA-83, OXA-84, OXA-86-OXA-89,

Hoiby, 2006;

OXA-91, OXA-92, OXA-94, OXA-95,

Turton i colab., 2006

Walther-Rasmussen;

OXA-58

Hoiby, 2006;
5

OXA-55

OXA-SHE

Walther-Rasmussen;
Hoiby, 2006;

OXA-48

OXA-54, OXASAR2

Walther-Rasmussen;
Hoiby, 2006;

OXA-50

OXA-50a-OXA-50d, PoxB

Walther-Rasmussen;
Hoiby, 2006;

OXA-60

OXA-60a-OXA-60d

Walther-Rasmussen;
Hoiby, 2006;

OXA-62

Schneider i colab., 2006

2.3.1.1.2.3. Rezistena prin impermeabilitate este ilustrat de mutaia care implic un deficit
al sintezei porinelor D2, ce determin rezistena tulpinilor de P. aeruginosa la carbapeneme
(Chifiriuc i colab., 2011) .
2.3.1.1.2.4. Rezistena prin mecanisme de eflux este evideniat la P. aeruginosa, specie la
care supraexprimarea celor trei sisteme (MexAB-OprM;

MexCD-OprJ; MexEF-OprN) sub

efectul mutaiilor la nivelul genelor reglatoare, se traduce printr-o rezisten la nivel sczut la lactaminele anti-piocianic, adesea ncruciat cu fluorochinolonele, cloramfenicolul i
tetraciclinele (Jalal; Wretllind, 1998). La P. aeruginosa rezistena dobndit se datoreaz
mecanismelor de impermeabilitate, modificrii afinit ii intei sau mecanismelor de eflux
(Chifiriuc i colab., 2011).

- 51 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

2.3.2. Rezistena la aminoglicozide


Aminoglicozidele sunt antibiotice bactericide de spectru larg, descoperite n anii `40, larg
utilizate, mai ales n asociere cu antibioticele -lactamice, dei prezint ototoxicitate i
nefrotoxicitate (Dworkin 2009). Din punct de vedere structural, aminoglicozidele sunt aminoglucide policationice conectate prin legturi glicozidice.

Structura molecular a gentamicinei

inta de aciune a aminoglicozidelor sunt ribosomii bacterieni (subunitatea 30S la nivelul


situsului receptor (A) i inhib sinteza protei nelor, mai precis perturb procesul de traducere,
inducnd erori de citire, stopeaz traducerea interfernd cu etapele de iniiere, elongaie i
terminare a catenei polipeptidice n curs de sintez.
Mecanismul de rezisten cel mai imporant la aminoglicozide este modificarea
enzimatic a antibioticului. Enzimele care modific aminoglicozidele produc modificri
covalente ale unor grupri specifice amino sau hidroxil, ducnd la modificarea moleculei, care
nu se mai poate lega la ARN 16S (Doi i colab., 2004). Enzimele de modificare sunt ncadrate n
trei mari familii: aminoglicozid-acetil-transferaze (AAC) utilizeaz acetil-CoA ca donor al
gruprii acetil pentru modificarea aminoglicozidelor la gruparea amino din poziiile 1 i 3 ale
inelului deoxistreptaminei i la pozitiile 2' i 6' ale inelului 6-aminohexozei; aminoglicozidadenilil-transferaze (ANT) i aminoglicozid -fosfotransferaze (APH) (Jehl i colab., 2010) .
Dintre aceste mecanisme de rezisten la P. aeruginosa, cel mai frecvent mecanism de
rezisten la aminoglicozide este impermeabilitatea membranei externe.

- 52 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

La A. baumannii, majoritatea genelor ce confer rezisten la aminoglicozide sunt


localizate la nivel plasmidial sau n structura transpozonilor (Devaud i colab., 1982), iar n
anumite cazuri pot fi localizate la nivelul casetelor genice asociate clasei 1 de integroni (Seward;
Towner 1999, Ribera i colab., 2004). Relativ recent a fost descris gena aac(6')I-ad ce confer
rezisten la amikacin, la izolate clinice de A. baumannii din Japonia (Doi i colab., 2004).

2.3.3. Rezistena la quinolone


Quinolonele sunt antibiotice de spectru larg, bactericide. Acestea ptrund n celul prin
intermediul porinelor la nivelul membranei externe i prin difuzie la nivelul membranei
plasmatice (Hooper 1999). Dup ptrunderea n celula bacterian, quinolonele se leag rapid,
selectiv i reversibil la nivelul ADN-girazei i al topoizomerazei IV, enzime bacteriene eseniale
pentru transcriere, replicare i mpachetarea cromosomului bacterian. Quinolonele formeaz un
complex ternar covalent enzim-ADN-antibiotic i induc ruperi ale catenelor de ADN, la nivelul
legturilor fosfodiesterice, inhibnd astfel replicarea ADN. Fenotipul slbatic la P. aeruginosa
este sensibil la toate fluoroquinolonele, dei n terapie cel mai utilizat este ciprofloxacinul.
Rezistena la quinolone este exclusiv cromosomal, rspndindu-se clonal pe vertical odat cu
multiplicarea microorganismului rezistent (Vila i colab., 1997).
Mecanismele principale ale rezistenei tulpinilor de P. aeruginosa la quinolone sunt
reprezentate de modificarea intei de aciune a ADN-girazei (gyrA) i topoizomerazei IV (parC),
sau mutaii ale genelor reglatoare ce coordoneaz supraexprimarea sistemelor de eflux [mexR,
nfxB i mexT (Jalal; Wretllind, 1998)]. Asemntor rezistenei la aminoglicozide, rezistena la
quinolone poate fi consecina unor sisteme de eflux (AdeABC i AdeM) ale membranei celulare,
combinat cu influx sczut prin membrana extern (Peleg i colab., 2008).
Cel mai cunoscut mecanism de rezisten la tulpinile de A. baumannii este asociat cu
mutaii ale genelor gyrA i gyrC care codific pentru subunitatea A a ADN-girazei (Seward i
colab., 1998).

- 53 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

II. Contribuii originale privind studiul markeri -lor fenotipici i molecular i de

rezisten la antibioticele -lactamice la tulpini de bacili Gram negativi non


fermentativi oportuniti.
La nivel european, potrivit ECDC (European Center Disease Control), n 2011 Romnia
a ocupat cea mai nalt rat a rezistenei la carbapeneme la izolate clinice de P. aeruginosa,
datele disponibile n prezent fiind destul de puine i limitate doar la regiunea de nord a rii
(Mereu i colab., 2013). La A. baumannii, caracterizarea contextului genetic al genelor de
rezisten la antibioticele -lactamice a fost raportat numai de spitale din regiunea de vest a rii
(Bonin i colab., 2011).

SCOPUL I OBIECTIVELE TEZEI


Avnd n vedere rezultatele limitate la doar dou regiuni ale rii, raportate n studiile
precedente i datele insuficiente privind caracterizarea genetic a tulpinilor de P. aeruginosa i
A. baumannii circulante n Romnia i rezistente la carbapeneme, aceast tez a avut ca scop:
descifrarea markeri-lor fenotipici i moleculari de rezisten la antibioticele

-lactamice la

tulpini de bacili Gram negativi non fermentativi oportuniti izolai din infecii nosocomiale , n
vederea reducerii riscului epidemiologic i elaborrii unor msuri eficiente de prevenire a
diseminrii clonelor rezistente.
Obiective urmrite:
Determinarea spectrului de sensibilitate la antibiotice -lactamice la tulpini de BGNNF
oportuniti prin metode calitative/cantitative, evidenierea profilurilor de rezisten
fenotipic i confirmarea fenotipurilor BLSE, MBL, AmpC.
Evidenierea genelor de rezisten la carbapeneme (blaVIM, blaIMP, blaSPM, blaBIC, blaAIM,
blaSIM, blaDIM, blaGIM, blaBic), la CHLD (blaOXA-2, blaOXA-10, blaOXA-23, blaOXA-24, blaOXA-48,
blaOXA-50, blaOXA-55, blaOXA-58, blaOXA-60), la BLSE (blaPER, blaTEM, blaSHV, blaCTX-M),
precum i a unor gene ce determin rez istena la aminoglicozide i pompe de ef lux (aac3Ia
i OprD) la tulpinile analizate i investigarea suportului genetic a unor gene pentru MBL
i CHLD.
- 54 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Caracterizarea contextului genetic i a relaiilor de clonalitate a unor tulpini de

P.

aeruginosa productoare de VIM-2 i A. baumannii productoare de OXA-23 rezistente la


carbapeneme, izolate din dou mari unit i spitaliceti din Bucureti, n vederea evalurii
contextului epidemiologic local i elaborrii unor msuri eficiente de prevenire a
diseminrii clonelor rezistente.

- 55 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

CAPITOLUL 3
Obiectivul 1
EVIDENIEREA FENOTIPIC A ANTIBIOREZISTENEI LA TULPINI DE BGNNF
IZOLATE DE LA PACIENI SPITALIZAI
Fenomenul antibiorezistenei are implicaii importante att pentru sntatea uman, ct i
din punct de vedere al interaciunii individ -mediu abiotic. Dac n urm cu 44 de ani frecvena
infeciilor cu microorganisme oportuniste era relativ redus, ele aprnd cel mai frecvent
consecutiv interveniilor chirurgicale la nivelul tractului urinar (Carr i colab., 2007), n prezent
acestea afecteaz aproximativ 30% dintre pacien ii din terapia intensiv (Hall i colab., 2005).
Principalele cauze ale acestui fenomen sunt reprezentate de: utilizarea nejustificat a
antibioticelor; diseminarea speciilor rezistente dar i de absena unor molecule noi de antibiotice.
Factori precum terapia cu antibiotice de spectru larg, aplicarea unor metode invazive de
tratament,

creterea

numrului

de

pacieni

imunocompromii,

virulena

crescut

microorganismelor implicate a condus la creterea incidenei infectiilor cu specii oportuniste n


ultimii ani (Mihescu i colab., 2007 ). Rspndirea acestor microorganisme este facilitat de
globalizare i sporirea numrului cltoriilor internaionale, precum i de creterea numrului de
cazuri de infecii nosocomiale.
Datorit specificitii lor de aciune, antibioticele manifest eficien diferit fa de
diferite specii microbiene; spectrul de activitate al unui antibiotic este definit prin totalitatea
speciilor microbiene sensibile la un anumit antibiotic (Jehl i colab., 2010). i n cadrul aceleiai
specii microbiene pot exista diferene mari de sensibilitate a diferitelor tulpini fa de un anumit
antibiotic, astfel c stabilirea tratamentului cu antibiotice n clinic necesit izolarea tulpinii
microbiene care reprezint agentul etiologic al infeciei respective i determinarea spectrului s u
de sensibilitate la antibiotice.
Determinarea in vitro a eficienei unui antibiotic se realizeaz prin evaluarea a trei
parametri (Jehl i colab., 2010):

- 56 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

concentraia minim activ (CMA)- este concentra ia la care antibioticul poate induce
anumite perturbri n activitatea metabolic a microorganismelor, fr a influena
capacitatea de multiplicare i viabilitatea acestora;

concentraia minin inhibitorie (CMI)- este concentraia la care un antibiotic prezint


efect bacteriostatic asupra microorganismelor;

concentraia minim bactericid (CMB)- este concentraia la care un antibiotic are efect
bactericid asupra microorganismelor.
Cunoaterea acestor parametri prezint o importan clinic deosebit, deoarece pentru

unele antibiotice, concentraia bactericid este foarte greu de atins in vivo.


Dup determinarea spectrului de sensibilitate/rezisten la antibiotice prin tehnici
calitative, se pot efectua testele cantitative pentru determinarea valorii CMI (tulpina microbian
este pus n contact cu concentraii cresctoare ale aceluiai antibiotic) (Jehl i colab., 2010).
Activit i:
Studiul fenotipic al tulpinilor de BGNNF rezistente la antibiotice -lactamice prin metode
calitative;
Studiul fenotipic al tulpinilor de BGNNF rezistente la antibiotice -lactamice prin metode
cantitative.

MATERIALE I METODE
1. Tulpini bacteriene
Un numr de 204 tulpini provenite din dou uniti clinice mari din Bucureti au fost
izolate de la pacieni internai la Institutul Naional de Boli Cardiovasculare (INBCV) Prof.
C.C. Iliescu i la Spitalul Clinic Fundeni (SCF) din Bucureti, n perioada 2012-2013 i
introduse n colecia Laboratorului de Microbiologie al Facultii de Biologie pe medii de cultur
uzuale i speciale.
2. Identificare bacteriilor cu ajutorul sistemului automatizat VITEK2
VITEK2 compact este un sistem automat cu performan ridicat (www.pda.org/bookstore),
care identific i testeaz i sensibilitatea/rezistena la antibiotice a speciilor de microorganisme
- 57 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

folosind cardurile disponibile: identificare bacterii i fungi; testarea sensibilitii/rezistenei la


antibiotice a speciilor bacteriene importante din domeniul clinic (fig. 20).

Fig. 20. Sistemul VITEK2compact (www.pda.org.bookstore)

Identificarea unui microorganism cu ajutorul sistemului VITEK 2 utilizeaz o


metodologie bazat pe compararea caracteristicilor speciei cu datele despre microorganism i
reaciile analizate. Interpretarea rezultatelor permite obinerea profilului biochimic pentru toate
testele prin comparare cu rezultatele introduse n baza de date pentru fiecare taxon pe care
cardul l poate identifica. La speciile bacteriene Gram negative cardul conie 47 teste biochimice
ce permit identificarea a 159 specii i includ de asemenea controlul negativ (fig. 21),
(www.pda.org/bookstore). Rezultatele finale sunt complete ntr-un interval de 2 - 10 ore.

Fig. 21. Sistemul VITEK2 introducerea cardurilor de sensibilitate la antibiotice pentru BGN
(www.pda.org.bookstore).

- 58 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Interpretarea testelor de sensibilitate la antibiotice cu ajutorul sistemului VITEK 2.


Cardul de sensibilitate la antibiotice pentru sistemele VITEK 2 reprezint o metod
automat bazat pe metoda C.M.I., (www.pda.org/bookstore), fiecare card test coninnd 64 de
microcelule (fig. 21). Distribuirea controlului negativ (mediul de cultur), este obligatorie n
toate cardurile, celelalte celulele coninnd diferite cantiti de antibiotic n mediul de cultur,
testate n diferite concentraii. Sistemul VITEK 2 monitorizeaz creterea n fiecare celul a
cardului ntr-o perioada determinat de timp (pn la 18 ore). Pe perioada incubrii, valorile
C.M.I. sunt determinate pentru fiecare antibiotic din card (www.pda.org/bookstore).
3. Identificarea tulpinilor cu ajutorul sistemului automat BD Phoenix (BD, Biosciences,
USA)
BD Pheonix este un sistem automat cu performan ridicat care permite att identificarea ct
i testarea sensibilitii la antibiotice a speciilor bacteriene Gram pozitive i Gram negative (fig.
22). Cu ajutorul acestui sistem identificarea se realizeaz pn la nivel de specie microbian
(Stefaniuk i colab., 2003)
Metodologia sistemului BD Pheonix ine cont de caracteristicile biochimice ale
microorganismului analizat. Cardul de identificare conine 45 de microgodeuri cu s ubstane
biochimice convenionale, cromogene i fluorogene, ce permit analiza a 20 de reacii enzimatice
utiliznd 16 glucide i alte 7 surse de carbon. Cardul se inoculeaz cu bulion ID Phoenix,
suspensie microbian 0,5 McFarland, apoi este supus titrrii. Rezultatele, furnizate pentru bacilii
Gram negativi aerobi n 2-12 ore. (http://www.bd.com). Respectivele identificri ce merg pn la
rezultate de specie permit alegerea antibioticelor necesare ulterior testrilor.

Fig. 22. BD Phoenix Sistem automat de identificare si testare a sensibilitatii la antibiotice (http://www.bd.com).

- 59 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Mediile de cultur i soluiile utilizate pentru identificarea tulpinilor de bacterii patogene sunt
descrise n Anexa nr. 1.
4. Conservarea tulpinilor microbiene
Tulpinile izolate i identificate au fost conservate pe termen lung fr modificarea
particularitilor biologice, a structurii antigenice sau a virulenei, n vederea utilizrii lor
ulterioare. Conservarea tulpinilor microbiene s-a realizat att pe mediu semisolid O.M.S.,
repartizat n tuburi de hemoliz i depozitat la 20C, ct i pe mediu bulion cu glicerol 20%
(depozitat la -80C). Din culturile conservate s-au efectuat pasaje pe medii proaspete, n vederea
obinerii culturilor de lucru. Din tulpinile microbiene pasate s-a extras ADN tulpinilor de interes
n vederea evidenierii markerilor genetici ai rezistenei la antibioticele -lactamice.
5. Determinarea spectrului de sensibilitate la antibioticele -lactamice prin metode
calitative metoda disc-difuzimetric (CLSI, 2012).
Metoda difuzimetric (Kirby-Bauer) permite determinarea concomitent a spectrului de
sensibilitate/rezisten a tulpinii testate i determinarea valorii C.M.I., n vederea stabilirii
dozelor terapeutice de antibiotice (Chifiriuc i colab., 2011).
Testarea sensibilitii la antibiotice a tulpinilor de BGNNF studiate a fost realizat prin
metoda difuzimetric (Kirby-Bauer), standardizat, (CLSI 2012). Tulpinile au fost cultivate pe
plci cu geloz simpl pentru obinerea unor colonii izolate, cu incubare timp de 16-18 ore, la
37C . Dup incubare au fost selectate cteva colonii izolate, ce au fost suspendate n soluie de
clorur de sodiu steril 0,9% pentru pregtirea inoculului bacterian de 10 6 UFC/ml, a crui
turbiditate a fost ajustat nefelometric cu etalon McFarland 0,5. Fiecare suspensie bacterian
astfel obinut a fost inoculat pe cte o plac cu agar Mueller-Hinton (BioMrieux) cu un
tampon steril ce a fost n prealabil mbibat n inoculul bacterian. Plcile cu mediu MuellerHinton dup inoculare au fost lsate s se usuce nainte de aplicarea discurilor cu antibiotice. La
distane egale au fost plasate discuri impregnate cu soluii de antibiotice de o anumit
concentraie care s difuzeze n mediu, realiznd un gradient de concentraie invers proporional
cu diametrul zonei de difuzie, deci cu distana fa de disc. Plcile au fost incubate timp de 16-18
- 60 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

h la 35 2C, cu capacul n jos. Controlul de calitate a fost realizat prin testarea pe o alt plac,
n aceleai condiii, a tulpinii de referin adevate: Ps. aeruginosa ATCC 27853. Citirea
rezultatelor s-a realizat prin msurarea diametrelor zonelor de inhibiie generate de diferite
antibiotice, cu ajutorul unei rigle gradate. Interpretarea rezultatelor s-a realizat n funcie de
dimensiunea zonelor de inhibiie, exprimnd rezultatul prin folosirea termenilor de sensibil (S),
rezistent (R) sau intermediar (I), conform tabelelor cu puncte critice standardizate i
corespunztoare metodei de lucru (tabele CLSI, 2012). Termenii S, I, R definesc i categoriile de
antibiotice, n funcie de efectul lor clinic (Jehl i colab., 2010):
categoria S nseamn c exist probabilitate mare ca antibioticul s elimine infecia
determinat de tulpina testat (CMI are valori net inferioare celor ale concentraiilor
umorale obinuite n urma administrrii unei doze obinuite);
categoria I semnific probabilitatea ca antibioticul s fie eficient in vivo prin administrare
local sau prin realizarea n mod fiziologic a concentraiilor mari n organe sau esuturi
la nivelul crora este localizat procesul infecios;
categoria R nseamn c, administrarea antibioticului nu va determina eliminarea din
organism a microorganismului a crui sensibilitate a fost testat sau rezultatul
tratamentului este imprevizibil.
S-a inut cont de faptul c aparia coloniilor bacteriene la marginea sau n interiorul zonei de
inhibiie se poate datora mai multor factori: cultura luat n lucru a fost mixt sau suprainfectat;
cultura a fost

pur dar a prezentat heterorezisten; apariia mutantelor heterorezistente;

dezvoltarea tardiv a unor celule sensibile (Mihescu i colab., 2007).

Pentru fam. Pseudomonadaceae a fost folosit urmtoarea schem de antibiotice (Tabelul 5, 6 i


7):
Tabelul 5. Antibioticele folosite pentru testarea sensibilitii la antibiotice la P. aeruginosa

Antibiotic
PiperacilinTazobactam

Abreviere Clasa
TZP

-lactamin/inhibitor de lactamaz

Concentraie

Productor

110

BioMrieux

Piperacilin

PIP

peniciline

100

Aztreonam

ATM

monobactami

30

- 61 -

Continuare
pag. 62

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Ticarcilin

TIC

peniciline

75

Ceftazidim

CAZ

cefeme IIIG

30

Cefepim

FEP

cefeme IVG

30

Cefalotin

CL

cefeme IG

50

Imipenem

IPM

carbapeneme

10

Pentru a permite citirea interpretativ i evidenierea fenotipului caracteristic anumitor lactamaze, distribuia discurilor cu antibiotice n plci a fost urmtoarea (fig. 23)

Fig. 23. Distribuia discurilor cu antibiotice n plci.

Pentru detectarea producerii de cefalosporinaz inductibil, codificat cromosomal de ctre


tulpinile de P. aeruginosa, discul de imipenem a fost plasat lng un alt antibiotic cu nucleu lactamic

(piperacilin-tazobactam,

ceftazidim).

Imipenemul

induce

producerea

unei

cefalosporinaze ce hidrolizeaz piperacilina sau ceftazidimul (Vedel, 2005). n afara efectului


antagonist, prezena unei cefalosporinaze inductibile poate fi sugerat de apariia fenomenului
key-hole (gaur de cheie), evideniat n prezena acelorai antibiotice (Livermore i colab., 2006).

Tabelul 6. Antibioticele folosite pentru testarea sensibilit ii la antibiotice la A. baumannii

Antibiotic

Abreviere

Clasa

Concentraia

Productor

PiperacilinTazobactam

TZP

Penicilina
Inhibitor
-lactamina

110

BioMerieux

- 62 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Piperacilin

PIP

Peniciline

100

Ceftazidim

CAZ

Cefem IIIG

30

Cefepim

FEP

Cefem IVG

30

Imipenem

IPM

Carbapenem

10

AmpicilinSulbactam

AMS

-lactamaz

10

Ceftriaxona

CRO

Cefalosporine

20

Gentamicina

Aminoglicozide

10

Ciprofloxacin
Amikacin

CIP
AK

Fluoroquinolone 5
30

Tetraciclin

TE

Tetracicline

TrimethoprimSXT
sulfamethoxazol

Inhibitor
folat

Continuare pag. 63

30
de 125/23.75

Tabelul 7. Antibioticele folosite pentru testarea sensibilit ii la antibiotice la S. maltophilia

Antibiotic

Abreviere

Clasa

Ticarcilin-acid
clavulanic

TIC

-lactamaz

Minociclin

Tetracicline

Levofloxacin

LEV

Fluoroquinolone 5

Ceftazidim

CAZ

Cefem IIIG

TrimethoprimSXT
sulfamethoxazol
Chloramfenicol

Inhibitor
folat

Concentraia

Productor
BioMerieux

30

30
de 125/23.75

- 63 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

6. Determinarea spectrului de sensibilitate la antibioticele -lactamice prin metode


cantitative - metoda E-Test (Epsilometer Test)= Gradient Diffusion Method.
Detectarea prezenei metalo--lactamazelor la tulpinile de BGNNF analizate, care au
manifestat rezisten la imipenem prin testul difuzimetric, s-a realizat cu benzi E-test MBL (AB
Biodisk, Suedia). Este o metod pentru testarea cantitativ a susceptibilitii antimicrobiene
(Lazr i colab., 2004) ; astfel un gradient antimicrobian dintr-un strip n plastic difuzeaz n
mediul agar MH inoculat cu organismul de testat. Valoarea CMI este citit direct de pe scala din
partea superioar a benzii la punctul n care elipsa zonei de inhibiie a creterii intersecteaz
stripul. Benzile E-test MBL ncorporeaz gradiente de concentraie a doi ageni antimicrobieni:
imipenem (IPM) (de la 4 la 256 g/ml) i imipenem + EDTA (IPI) (de la 1 la 64 g/ml). Etest
MBL este n primul rnd utilizat ca un test de diagnostic, iar valorile C.M.I. citite din E-test
MBL pot s nu fie echivalente n mod substanial echivalent cu CMI-urile din stripurile E-test ale
imipenemului (Lazr i colab., 2004).
Controlul calitii s-a realizat prin testarea pe o alt plac, n aceleai condiii a tulpinii de
referin P. aeruginosa ATCC 27853.

Fig. 24. Confirmarea fenotipului MBL la tulpini de P.aeruginosa prin reducerea zonelor de inhibiie elipsoidale la
E-Test i refacerea zonelor de inhibiie la IMP n prezena EDTA.

Zona de inhibiie a creterii microorganismului testat are aspect de elips, al crui


diametru variaz direct proporional cu gradientul de concentraie al antibioticului difuzat n
mediu, diminundu-se odat cu scderea concentraiei, astfel c, la o anumit valoare, zona de
- 64 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

inhibiie a creterii va intersecta banda, concentraia nscris pe band la acest nivel indicnd
valoarea C.M I. (Lazr i colab., 2004).
Alt metod alternativ

de detectare a fenotipului MBL (metalo--lactamaze) este:

metoda discurilor cu imipenem (IPM) impregnate cu EDTA. Metoda const n utilizarea


discurilor de imipenem impregnate cu EDTA; reducerea CMI de 4 ori pentru combinaia
imipenem-EDTA fa de discul ce conine numai imipenem indic prezena unei MBL [Chifiriuc
i colab., 2011(fig. 24)].
7. Analiza rezultatelor obinute
Rezultatele obinute au fost prelucrate utiliznd programul Microsoft Excel.

REZULTATE I DISCUII
Tulpinile izolate au provenit din seciile de terapie intensiv, unde presiunea selectiv
asupra bacteriilor a fost ridicat, procentul tulpinilor din primul tip de produse patologice, cele
provenite din situsuri anatomice nesterile, colonizate cu microbiota normal (64,2%) (secreii
plag, secreii traheobronhice, exsudate, lavaje bronho-alveolare) fiind net superior celui de-al
doilea tip de produse patologice, provenite din caviti normal sterile, reprezentate de
primoculturi, lichid pleural i catetere (35,7%). Tulpinile au fost identificate n unitiile
respective, prin metoda automat de identificare VITEK2 compact (www.pda.org/bookstore) i
BD Phoenix (http://www.bd.com).
BGNNF se caracterizeaz printr-o rezisten crescut la substane antimicrobiene i
dezinfectante, prin mecanisme intrinseci, naturale sau dobndite. Rezistena la antibiotice poate
fi dobndit chiar n cursul tratamentului cu antibiotic, fapt ce necesit testarea tulpinilor izolate
succesiv de la acelai pacient (Chifiriuc i colab., 2011). Tulpinile de BGNNF analizate au
prezentat un nivel ridicat de multirezisten. Termenul de MDR este definit ca rezistena
concomitent a unei tulpini la cel puin un agent antimicrobian din trei sau mai multe clase de
antibiotice, excluznd rezistena intrinsec a fiecrei specii (Magiorakos i colab., 2012).
Rezistena extins (XDR) reprezint rezistena unei tulpini microbiene la cel puin un agent
antimicrobian din mai multe clase de antibiotice, cu conservarea sensibilitii la una sau maxim
dou clase de antibiotice (Magiorakos i colab., 2012).
- 65 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Panrezistena ( PDR) reprezint rezisten a unei tulpini bacteriene la toi agenii


antimicrobieni din toate clasele de antibiotice recomandate pentru a fi testate pentru specia
respectiv (Magiorakos i colab., 2012).
Fenotipul slbatic de rezisten la P. aeruginosa este legat de producerea unei
cefalosporinaze inductibile de ctre aminopeniciline i cefalosporinele din prima i a doua
generaie, cuplat cu o impermeabilitate i de un sistem de eflux inductibil (Jehl i colab., 2010).
Prezint rezisten natural i la asocierea aminopenicilinelor cu inhibitorii de -lactamaze. Sunt
natural sensibile la carboxipeniciline (carbenicilina, ticarcilina), la ureidopeniciline (azolcilina,
piperacilina), la anumite cefalosporine din generaia a treia (ceftazidim, cefsulodin,
cefoperazon), la toate cefalosporinele de generaia a patra, la monobactame i la carbapeneme
(imipenem i meropenem) (Jehl i colab., 2010).
Un numr de 112 tulpini de BGNNF au fost izolate i analizate pe parcursul anului 2012
de la Institutul de Boli Cardiovasculare Prof. ,,C.C. Iliescu. Tulpinile de BGNNF analizate n
2012 au fost izolate de la pacieni spitalizai cu diferite afeciuni cardiovasculare, sursele de
izolare fiind foarte variate (fig. 25).

Fig. 25. Distribuia tulpinilor de BGNNF izolate de la Institutul de Boli Cardiovasculare C.C. Iliescu i
Spitalul Clinic Fundeni din Bucureti pe specii i surse de izolare.

Analiza interpretativ a rezultatelor testelor difuzimetrice a permis stabilirea patternurilor de rezisten caracteristice tulpinilor analizate: cefalosporinaz constitutiv plus metalo-- 66 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

lactamaz, expresia unei pompe de eflux, sau defect de porine (fig. 26); cefalosporinaz
inductibil (fig. 27), precum i BLSE (fig. 28).

Fig. 26. Fenotip de cefalosporinaz constitutiv + metalo--lactamaz la tulpini de P. aeruginosa.

Fig.27. Fenotip de cefalosporinaz inductibil la o tulpin de P. aeruginosa.

- 67 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 28. Fenotip BLSE la o tulpin de P. aeruginosa.

Realizarea antibiogramei difuzimetrice pentru cele 53 de tulpini de P. aeruginosa izolate


din diferite probe biologice (exsudate plgi, secreii traheobronhice, sput, coprocultur) a
relevat faptul c tulpinile analizate prezint fenotipuri de rezisten dobndit la antibioticele lactamice utilizate (fig. 29).
Tulpinile de P. aeruginosa sunt natural sensibile la antibioticele testate, deci prezint
exclusiv fenotipuri de rezisten dobndit la aceste antibiotice (Strateva i colab., 2009).
Un procent semnificativ (34,6%) dintre tulpinile analizate sunt rezistente la imipenem, astfel
nct acest antibiotic rmne o opiune pentru tratamentul infeciilor datorate tulpinilor
productoare de BLSE, ns cu precauie; 19,23% dintre tulpini au fost rezistente la inhibitorul
de betalactamaz, iar 50% dintre tulpini au prezentat rezisten la gentamicin manifestnd
astfel MDR (Magiorakos i colab., 2012) .
Rezistena tulpinilor de P. aeruginosa la aceast gam de antibiotice se poate traduce prin
prezena unei cefalosporinaze de spectru larg, care ns nu explic i rezistena la imipenem.
Prezena unei carbapenemaze din clasa A, poate explica rezistena tulpinilor la peniciline,
cefalosporine i carbapeneme, dar nu i pe cea la aztreonam. Prezena unei metalo -lactamaze,
dei confer tulpinilor rezisten la majoritatea -lactaminelor, inclusiv la carbapeneme, nu
explic rezistena la aztreonam (Walsh i colab., 2005). Pe baza studiilor genetice, enzimele care
- 68 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

hidrolizeaz carbapenemele -beta-lactamazele au fost ncadrate n patru grupe A, B, C i D.


MBL aparin grupului B, fiind enzime care necesit pentru activitatea enzimatic cofactori
reprezentai de cationi divaleni, i sunt inhibate de aciunea ionilor metalici chelatori (zinc sau
cadmiu) (Walsh i colab., 2005). Situsul de legare a ionilor metalici este responsabil de scderea
sensibilitii acestor enzime la inhibitorii de -lactami ce includ i carbapenemii. MBL sunt
sensibile la aciunea chelatorilor metalici de tipul EDTA i la compui ce conin gruparea tiol,
aceti inhibitori ai MBL sunt folosii pentru detectarea MBL (Walsh i colab., 2005).
Printre cele mai rspndite gene responsabile pentru producerea MBL la tulpinile de P.
aeruginosa sunt blaVIMlike i blaIMPlike, gene localizate frecvent l nivelul elementelor genetice
mobile de tipul integronilor iar transferul lor se realizeaz pe orizontal (Bush, 1998; Bennett,
1999).

Fig. 29. Distribuia markerilor de rezisten la antibiotice la tulpini de P. aeruginosa izolate din exsudate plgi,
secreii traheobronsice, coprocultur i sput n 2012 .

Pentru confirmarea fenotipurilor de rezisten enzimatic la antibioticele beta-lactamice


au fost utilizate benzi E-test, impregnate cu diferite concentraii de antibiotice, care permit
stabilirea valorii C.M.I. i confirmarea fenotipic a prezenei unor -lactamaze de tipul MBL
(fig. 30), BLSE i AmpC (Mihescu i colab., 2007). Pentru a investiga dac rezistena la
imipenem a celor 53 tulpini este mediat de metalo--lactamaze s-a realizat testul de detectare a
MBL prin metoda E-test MBL, care conine imipenem (IPM) i respectiv IPM cu EDTA (IPI).
- 69 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Prezena metalo--lactamazei a fost confirmat de o valoare a raportului dintre C.M.I. IPM i


C.M.I. IPI 8 (Laz i colab., 2004). Astfel, conform rezultatelor obinute cu benzile E-test
MBL, 15 dintre tulpinile testate din primul tip de produse patologice prezint metalo-lactamaze, n timp ce 6 dintre tulpini nu prezint metalo--lactamaze, ci sunt rezistente la
imipenem prin alt mecanism, probabil prin mecanisme ne-enzimatice sau enzimatice prin sinteza
de alte -lactamaze (cu excepia metalo--lactamazelor), care hidrolizeaz carbapenemele.
Formele de rezisten la carbapeneme cel mai frecvent ntlnite la tulpinile de P. aeruginosa sunt
mediate de ptrunderea ineficient a carbapenemilor (mutaii la nivelul porinelor i prezena unor
pompe de eflux (OprD) i/sau de sinteza de -lactamaze care hidrolizeaz carbapenemii
(Chifiriuc i colab., 2011).
Rezultatele metodei E-test au confirmat prezenta fenotipului MBL pentru 15 din cele 53
tulpini de P. aeruginosa (Tabelul 8) analizate din sursele de izolare reprezentate de situsuri
nesterile (exsudate plgi, secreie traheobronhic coprocultur, i sput).

Fig. 30 . Confirmarea fenotipului MBL la o tulpin de P. aeruginosa prin reducerea zonelor de inhibiie elipsoidale
n E-Test i refacerea zonelor de inhibiie la IMP n prezena EDTA.
Tabelul nr. 8. Valorile CMI obinute i valoarea raportului dintre acestea pentru tulpinile analizate
Tulpina

IPM

IPI

IPM/IPI

Concluzii

P. aeruginosa
160 secreie plag

48

24

MBL +

P. aeruginosa
31 coprocultur

MBL+
IPM+EDTA> IPM

P. aeruginosa
273 secreie traheal

24

12

MBL +

- 70 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
P. aeruginosa
118 secreie traheal

16

MBL+/-

P. aeruginosa
202 secreie plag

256

12

21,33

MBL+

P. aeruginosa
80 secreie traheal

256

12

21,33

MBL+

P. aeruginosa
200 secreie traheal

256

42

MBL+

P. aeruginosa
175 escar

256

42

MBL+

P. aeruginosa
73 secreie traheal

256

85,33

MBL+

P. aeruginosa
75 secreie traheal

32

MBL+/-

P. aeruginosa
144 secreie plag

256

1,5

170,66

MBL+

P. aeruginosa
207 secreie traheal

256

1,5

170,66

MBL+

P. aeruginosa
803 secreie traheal

MBL+
IPM+EDTA>IPM

P. aeruginosa
202 secreie traheal

256

85,33

MBL+

P. aeruginosa
67 plag

0,25

12

MBL+

Rezultatele obinute prin metoda difuzimetric pentru tulpinile de P. aeruginosa izolate


din situsuri sterile a artat c 57,89% din tulpini sunt rezistente la imipenem, 36,84% din tulpini
sunt rezistente la piperacilin, iar 52,63% la gentamicin (fig. 31).

Fig. 31. Distribuia markerilor de rezisten la antibiotice la tulpini de P. aeruginosa izolate din situsuri sterile n
2012.

- 71 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 32. Confirmarea fenotipului MBL la tulpini de P. aeruginosa- aspect E-Test MBL i ESBL nedeterminat
(suprapunerea mai multor mecanisme de R).

Din cele 18 tulpini de P. aeruginosa izolate din situsuri sterile (uroculturi, hemoculturi, catetere
contaminate) 6 au prezentat fenotip MBL (Tabelul 9, fig. 32). Fosfomicina ar putea fi luat n
consideraie n tratamentul infeciilor cauzate de tulpini MDR de P. aeruginosa. Activitatea
antimicrobian a fosfomicinei mpotriva tulpinilor MDR de P. aeruginosa poate fi de asemenea
mbuntit n combinaie cu alte antibiotice. Cu toate acestea, sunt necesare cercetri
suplimentare n vederea stabilirii eficacitii clinice sau microbiologice de terapie a fosfomicinei
n infeciile cauzate de tulpini de BGNNF MDR, XDR sau PDR (Falagas i colab., 2009).
Tabelul nr. 9. Valorile CMI obinute i valoarea raportului dintre acestea pentru tulpinile analizate
Tulpina

IPM

IPI

IPM/IPI

Concluzii

P. aeruginosa
243 urocultur

MBL+
IPM+EDTA> IPM

P. aeruginosa
158 urocultur

MBL+
IPM+EDTA> IPM

P. aeruginosa
195 urocultur

0,75

0,32

P.aeruginosa
299 hemocultur
venoas
P. aeruginosa
474 urocultur

0,032

MBL+
IPM+EDTA> IPM

P. aeruginosa
373 cateter

1,25

MBL+
IPM+EDTA> IPM

MBL+
IPM+EDTA> IPM
8

- 72 -

MBL+
IPM+EDTA> IPM

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Testarea sensibilitii la antibiotice la tulpinile de A.baumannii a evideniat un procent


semnificativ de tulpini PDR (93%) [Magiorakos i colab., 2012 (fig.33)].

Fig. 33. Fenotip de panrezisten la o tulpin de A. baumannii.

Fig. 34. Fenotip de metalo--lactamaz la o tulpin de A. baumannii.

- 73 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 35. Fenotip BLSE la o tulpin de A. baumannii.

Cel mai mare procent de rezisten detectat la tulpinile de A. baumannii analizate din
situsuri nesterile s-a obsevat la antibioticele -lactamice: 79% au prezentat rezisten la
piperacilin i ceftriaxon; 75% dintre tulpini au manifestat rezisten la piperacilin -tazobactam
i la imipenem, procente net superioare celor obinute n cazul tulpinilor de P. aeruginosa (fig.
36). Majoritatea tulpinilor au prezentat fenotipuri de rezisten prin suprapunerea mai multor
mecanisme: rezistena la imipenem prin producere de metalo--lactamaz sau prezena lactamazelor de spectru extins (Chifiriuc i colab., 2011).

Fig. 36. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii izolate din situsuri nesterile n
2012.

- 74 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Din cele 29 de tulpini de A. baumannii din sursele de izolare exsudate plgi, secreii
traheobronhice, coprocultur i sput 12 au prezentat fenotip MBL [Lazr i colab., 2004
(Tabelul 10, fig. 37)].
Tabelul 10. Valorile CMI obinute i valoarea raportului dintre acestea pentru tulpinile analizate
Tulpina

IPM

IPI

IPM/IPI

Concluzii

A.baumannii
20 coprocultur

MBL+

A.baumannii

32

16

MBL+

16

16

MBL+

16

16

MBL+

24

MBL+

1,5

5,33

MBL+

77secreie traheal
A.baumannii
432exudat
faringian
A.baumannii
352 exudat nazal
A.baumannii
200secreie
traheal
A.baumannii
1858secreie

IPM+EDTA>IPM

traheal
A.baumannii

16

16

MBL+

32

MBL+

32

MBL+

MBL+

221secreie
traheal
A.baumannii
26secreie traheal
171secreie
traheal
A.baumannii
293secreie

IPM+EDTA>IPM

traheal
A.baumannii

340 exudat traheal


A.baumannii

MBL+
IPM+EDTA>IPM

516 exudat traheal

MBL+
IPM+EDTA>IPM

- 75 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 37. Confirmarea fenotipului MBL la o tulpin de A. baumannii.

Din cele 6 tulpini de A. baumannii izolate din situsuri sterile, toate au prezentat rezisten
la ceftriaxon i cefepim, iar 5 au manifestat concomitent rezisten la piperacilin, inhibitorul de
-lactamin, ceftazidim i ciprofloxacin [CLSI, 2012 (fig. 38)].

Fig. 38. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii izolate din situsuri sterile n
2012.

Din cele 6 tulpini de A. baumannii izolate din situsuri sterile, 4 au fost definite ca XDR,
iar 5 tulpini au prezentat fenotip MBL (Tabelul 11).
- 76 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Tabelul 11.Valorile CMI obinute i valoarea raportului dintre acestea pentru tulpinile analizate
Tulpina
A.baumannii
247 urocultur
A.baumannii
373 cateter

IPM
8

IPI
1

IPM/IPI
8

Concluzii
MBL+

0,032

250

MBL+
IPM+EDTA> IPM

A.baumannii
342secreie
cateteter
A.baumannii
2366
hemocultur
venoas
A.baumannii
200
secreiecateter

0,032

250

MBL+
IPM+EDTA> IPM

MBL+

MBL+

Testarea la substane antimicrobiene a celor 6 tulpini de S. maltophilia izolate pe


parcursul anului 2012 a evideniat nivel ridicat de rezisten la levofloxacin i cefalosporine de
generaia a III -a (66,6%) [CLSI, 2012 (fig. 39, 40)], n paralel cu sensibilitatea la ticarcilin,
cloramfenicol i trimetoprim-sulfametoxazol (50% dintre tulpini). Rezultate similare celor
obinute de noi n cazul rezistenei la cefalosporine de generaie a III-a au fost raportate n Arabia
(Naeem i colab., 2012), unde 58% dintre tulpinile izolate (n= 222) de la pacienii spitalizai n
secia de terapie intensiv dintr-un spital din Riyadh, au prezentat rezisten la ceftazidim. Cea
mai frecvent combinaie de fenotipuri circulante la cele 6 tulpini analizate a fost rezistena la
ceftazidim, minociclin i levofloxacin i sensibilitatea la ticarcilin, cloranfenicol i trimetoprimsulfametoxazol (fig. 40). Fenotipul de rezisten la trimethoprim -sulfametoxazol este excepional
la S. maltophilia (Toleman i colab., 2007), cu toate acestea, a fost detectat la 33,3% dintre
tulpinile analizate. Rezistena izolatelor clinice de S. maltophilia la trimetoprim-sulfametoxazol a
fost raportat nc din 2007, de Toleman i colab., n cadul unui studiu multicentric ce includea
izolate provenite din Europa, S.U.A. i Australia, demonstrnd c rezistena la SXT este cel mai
frecvent asociat clasei 1 de integroni (gena sul1 a fost detectatact la nivelul regiunii conservate
3').

- 77 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 39. Fenotip de rezisten la cefalosporinele de generaia a III-a la S. maltophilia.

Fig. 40. Distribuia markerilor de rezisten la antibiotice la tulpini de S. maltophilia izolate din situsuri nesterile n
2012.

- 78 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Pe parcursul anului 2013 au fost izolate i analizate un numr de 92 de tulpini de


BGNNF provenite de la pacieni ai INBCV Prof. ,,C.CIliescu i Spitalului Clinic Fundeni din
Bucureti, internai n seciile de terapie intensiv. Terapia intensiv reprezint locul adecvat
pentru monitorizarea i trata mentul pacienilor cu instabilitate sever, care necesit ngrijire
deosebit. ngrijirea n seciile de terapie intensiv reprezint nivelul cel mai ridicat de asi sten
din spital (mai mare dect cel disponibil n terapia intermediar/postoperator sau alte secii ale
spitalului (Hall i colab., 2005). Asigurarea suportu lui funciilor vitale n aceast secie, cu risc
ridicat, care crete rata de supravieuire la pacieni cu patologii tot mai complexe, a dus i la
creterea riscului de infecii severe, marea majoritate cu microorganism e oportuniste multi i
panrezistente la antibiotice. Cu ct durata de spitalizare este mai mare cu att riscul infeciilor
nosocomiale este mai ridicat (Hall i colab., 2005).
Analiznd distribuia tulpinilor de BGNNF izolate n 2013, corelat cu sursele de izolare
(fig. 41), s-a observat c numrul tulpinilor (53) provenite din situsuri nesterile este net superior
celui provenite din situsuri sterile (27 tulpini); situaie similar celei identificate n 2012, n cazul
tulpinilor analizate de la pacieni ai INBCV Prof. ,,C.C. Iliescu. De asemenea s-a constatat c
tulpinile de P. aeruginosa (61.9%) au fost cel mai frecvent izolate pe parcursul anului 2013
comparativ cu celelalte specii de BGNNF.

Fig. 41. Distribuia tulpinilor de BGNNF izolate de la INBCV

Prof. C.C. Iliescu i Spitalul Clinic

Fundeni din Bucureti n 2013 pe specii i surse de izolare.

- 79 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Evaluarea profilurilor de rezisten pentru tulpinile de P. aeruginosa izolate din


secreii traheale, secreii plag, exsudate, lavaje bronho-alveolare, coprocultur i sput n
2013 a artat c majoritatea tulpinilor au manifestat un nivel de rezisten ridicat la
majoritatea claselor de antibiotice testate [CLSI, 2012 (fig. 42)]: -lactamice (100% imipenem, 90,9% - meropenem, 66,6% cefalosporine de generaie a III-a si a IV-a);
aminoglicozide (75% - gentamicina, 60,6% - amikacina i tobramicina); fluoroquinolone
(66,6% - ciprofloxacin, 54,5% - levofloxacin).
Interpretnd nivelurile de rezisten la antibiotice ale tulpinilor de P. aeruginosa,
izolate din secreii traheale, secreii plag, exsudate, lavaje bronho-alveolare coprocultur
i sput n 2013, s-a observat niveluri net superioare rezistenei identificate n cazul
tulpinilor de P. aeruginosa analizate n 2012 din acelea i tipuri de produse patologice
(100%/34,6% - imipenem; 39,39%/19,23% - inhibitorul de -lactamaz; 75%/50% gentamicin).
Analiza profilurilor de rezisten n cazul tulpinilor de P. aeruginosa izolate din
situsuri sterile a artat niveluri de rezisten ridicat la urmatoarele clase de antibiotice
[CLSI, 2012 (fig. 43)]: -lactamice (100% - imipenem i

meropenem, 50% -

cefalosporine de generaia a III-a i 44% - cefalosporine de generaie a IV-a);


aminoglicozide (61,1% - gentamicin, 50% - amikacin i tobramicin); fluoroquinolone
(44% - ciprofloxacin i levofloxacin).
n ceea ce privete tulpinile de P. aeruginosa izolate din situsuri sterile, n 2013
s-a constatat creterea nivelului de rezisten la urmtoarele antibiotice comparativ cu
tulpinile de P. aeruginosa izolate din surse similare n 2012: 100%/57,89% - imipenem;
50%/36,8% - piperacilin; 50%/42% - ceftazidim; 22%/10% - inhibitorul de -lactamaz;
61,1%/52,6 gentamicin. Rezistena la carbapeneme la P. aeruginosa este adesea
asociat cu rezistena i la alte antibiotice, ceea ce limiteaz opiunile terapeutice
(Livermore, 2001).
Mereu i colab., n 2013 au analizat mecanismele de rezisten la carbapeneme
la 106 tulpini de P. aeruginosa i A. baumannii rezistente la carbapeneme, izolate de la
cinci spitale din Iai n perioada 2008-2012, precum i nrudirea genetic a acestora. Din
cele 90 de tulpini de P. aeruginosa rezistente la carbapeneme, 47 au fost pozitive la
screening-ul prin E-Test pentru producerea de MBL.
- 80 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Conform Compartimentului de Prevenire i Control al Infeciilor Nosocomiale,


din Institutul Clinic Fundeni, incidena cazurilor de infecii nosocomiale pe trimestrul I al
anului 2013 a fost de 0,68% iar n aceeai perioad a anului 2014 a crescut la 0,80%.
Monitorizarea rezistenei agenilor nosocomiali s -a realizat prin studii comparative la
nivel de unitate spitaliceasc ntre perioade diferite ale anului i ani diferii cu consecin
asupra politicii de administrare a antibioticelor n unitatea respectiv i de diseminare a
rezultatelor la nivel naional i internaional.
Date recente furnizate de EARSS (Reteaua European de Supraveghere a
Rezistenei la Antibiotice) privind procentele de rezisten la antibiotice a tulpinilor de P.
aeruginosa din Romnia, arat un procent de 12,5% rezisten la carbapeneme i
ceftazidim; 25% la piperacilin i quinolone, i 37% pentru aminoglicozide
(www.rvm.earss.nl.). Datele furnizate nu sunt ns concludente datorit numrului mic de
izolate luate n studiu.
Investigarea a 526 tulpini de P. aeruginosa izolate ntr-un spital din Serbia a
artat un nivel de rezisten de 31% la imipenem, procent inferior celor identificate n
acest studiu n 2012 (54,8%) i 2013 (100%), iar tulpinile au fost definite XDR n
proporie de 29,4%, situaie diferit de cea identifica t n studiul nostru n 2012 (aprox.
30% MDR) i n 2013 (aprox. 80% XDR) (Jovcic i colab., 2011). Investigarea a 4761
tulpini de P. aeruginosa izolate n perioada 2004-2008 de la pacieni internai n seciile
de terapie intensiv n spitale din Szeged au evidentiat rezultate similare, toate tulpinile
fiind rezistente la carbapeneme (Csilla, 2011).
Samuelson i colab., n 2010 au semnalat nivelurile crescute ale rezistenei la
carbapeneme la 13 tulpini de P. aeruginosa izolate n perioada 1999-2007, din Norvegia
i Suedia. Toate tulpinile au fost rezistente la imipenem i meropenem i au prezentat
fenotip MDR, rezultate similare celor obinute n studiul de fa.
Rezultate similare celor obtinute pentru tulpinile izolate n 2012, au fost raportate
n Brazilia, unde, din 512 izolate de P. aeruginosa, 57,6% au fost rezistente la imipenem,
toate fiind sensibile la colistin, iar 50,6% au fost rezistente la amikacin (Zavascki i
colab., 2007).

- 81 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 42. Distribuia markerilor de rezisten la antibiotice la tulpini de P. aeruginosa izolate din secreii traheale,
secreii plag , exsudate, lavaje bronho-alveolare, coporcultur i sput n 2013.

Fig. 43. Distribuia markerilor de rezisten la antibiotice la tulpini de P. aeruginosa izolate situsuri sterile
n 2013.

- 82 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 44. Distribuia markerilor de rezisten la antibiotice la tulpini de P. aeruginosa cu surse de izolare
necunoscute.

Testarea sensibilitii la antibiotice a tulpinilor de A. baumannii izolate n 2013 a


evideniat un nu mr mare mare de tulpini cu rezisten multipl la antibiotice (CLSI, 2012),
astfel 81,25% dintre tulpinile analizate au fost MDR cu sensibilitate la colistin. Cel mai mare
procent de rezisten ntlnit n cazul tulpinilor de A. baumannii analizate n 2013 a fost observat
la antibioticele -lactamice: 100% au prezentat rezisten la imipenem, piperacilin -tazobactam,
piperacilin, ceftazidim i cefepim; 93,75% au prezentat rezisten la trimethoprimsulfametoxazol; 75% dintre tulpini au fost rezistente la ticarcilin, meropenem i ciprofloxacin;
62,5% au prezentat rezisten la amikacin i 50% dintre tulpini au fost rezistente la gentamicin,
procente inferioare celor identificate n cazul tulpinilor de A.baumannii analizate n anul 2012.
Toate tulpinile au prezentat fenotip de rezisten la imipenem iar 75% din tulpini au fost
rezistente la meropenem prin producere de carbapenemaz. Testarea sensibilitii la
aminoglicozide a evideniat c 31,25% din tulpini au prezentat fenotipul de rezisten la
amikacin + tobramicin + gentamicin. Rezistena la fluoroquinolone este mediat de
modificarea intei (Hancock, 1998). n cazul tulpinilor de A. baumannii analizate n 2013,
43,75% dintre tulpinile analizate au fost rezistente la ambele quinolone testate; 75% din tulpini
au fost rezistente la o quinolon (ciprofloxacin) i 50% au fost rezistente la cea de -a doua
quinolon testat (levofloxacin), (CLSI, 2012).

- 83 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Niveluri sczute ale sensibilitii au fost raportate i de ali autori. Borcan n 2012, n
cadrul tezei de doctorat a artat nivelul ridicat al rezistenei BGN izolai din infecii respiratorii
severe de la pacieni ventilai mecanic ai Spitalului Clinic Fundeni: 34% dintre tulpinile de A.
baumannii analizate (214) au fost PDR.
Un studiu care a inclus 13 tulpini de A. baumannii rezistente la carbapeneme, izolate n
spitale din Timioara, Arad i Reita nu a raportat prezena MBL ci numai a CHLD (Bonin i
colab., 2011).
Cernat i colab., n 2007 au raportat o prevalen crescut a MBL (120 tulpini rezistente
la imipenem) la tulpini de A. baumannii izolate la Institutul de Cardiologie din Bucuresti n
perioada 2003-2006.
Rezultate similare au fost descrise ntr-un studiu efectuat ntr-un spital din Palermo, pe un
numr de 61 de tulpini de A. baumannii rezistente la carbapeneme, care au fost n proporie de
100% sensibile la colistin i 100% rezistente la cefalosporine, la combinaii de -lactamininhibitor de -lactamaz i la fluorochinolone, sensibilitatea la aminoglicozide fiind variabil,
cea mai activ fiind tobramicina, iar cea mai puin activ gentamicina (Mammina i colab.,
2012).
Niveluri sczute ale sensibilitii la carbapeneme au fost raportate i n seciile de terapie
intensiv a trei spitale din Lituania, astfel din cele 444 tulpini de A. baumannii izolate n perioada
2010-2011, 98,8% au fost rezistente la imipenem i meropenem iar tulpinile au fost MDR n
proporie de 95% (Povilonis i colab., 2013), rezultate similare celor obinute de noi.
Higgins i colab., n 2010 au semnalat de asemenea niveluri extrem de sczute ale
sensibilitii la carbapeneme (4,46%) a 515 tulpini de A. baumannii, consoriul global incluznd
tulpini din mediul spitalicesc din Europa (Germania, Turcia, Suedia, Italia, Spania), America de
Nord (S.U.A.) i America Latin (Argentina, Mexic), Asia (Coreea), Africa de Sud i Australia.

- 84 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 45. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii izolate din secreii i exsudate n 2013.

Evaluarea profilurilor de rezisten pentru tulpinile de A. baumannii izolate din secreii,


exsudate i sput n 2013 (fig. 45 ), a artat niveluri superioare rezisten ei la acelai tip de agent
antimicrobian celor identificate n cazul tulpinilor de A. baumannii provenite din aceleasi tipuri
de produse patologice izolate n 2012, respectiv: piperacilin, tazobactam (100%/76%);
piperacilin (100%/79%).

Fig. 46. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii izolate din uroculturi i catetere.

- 85 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Analiznd nivelurile de rezisten la antibiotice ale tulpinilor de A. baumannii izolate din


primoculturi n 2013 (fig. 46) s-a constatat niveluri mai ridicate ale rezistenei la acelasi tip de
agent antimicrobian, spre exemplu la ceftazidim (100%/85,7%) i ciprofloxacin (75%/85,7%).

Fig. 47. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii izolate din surse de izolare necunoscute.

Testarea la substane antimicrobiene a celor 11 tulpini de S. maltophilia izolate pe


parcursul anului 2013 (fig. 48, 49) a evideniat procente inferioare de rezisten la levofloxacin
(45,45%) i cefalosporine de genera ie a III-a (9,09%), tulpinilor de S. maltophilia analizate pe
parcursul anului 2012 (66,6%/66,6%), n paralel cu sensibilitatea la cloramfenicol (54,54%/50%)
i trimetoprim-sulfametoxazol (45,45%/50%) (CLSI, 2012).

- 86 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 48. Distribuia markerilor de rezisten la antibiotice la tulpini de S. maltophilia izolate din secreii traheale,
secreii plag, exsudate, sput n 2013.

Fig. 49. Distribuia markerilor de rezisten la antibiotice la tulpini de S. maltophilia izolate din urocultur n 2013.

Testarea sensibilitii la antibiotice a tulpinilor de E. brevis izolate n 2013 a evideniat c cele


trei tulpini izolate din situsuri sterile au fost MDR (fig. 50) (Magiorakos i colab., 2012) .

- 87 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 50. Distribuia markerilor de rezisten la antibiotice la tulpini de E. brevis izolate din situsuri sterile.

Tulpinile de A. baumannii/haemolyticus analizate n 2013 din secreii i exsudate nazale au fost


multirezistente (Magiorakos i colab., 2012), tulpinile analizate au fost rezistente la imipenem
prin producere de metalo-carbapenemaz (fig. 51).

Fig. 51. Distribuia markerilor de rezisten la antibiotice la tulpini de A. baumannii/haemolyticus izolate din
situsuri nesterile.

- 88 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Tulpina de A. baumannii/haemolyticus izolat din urocultur a prezentat rezisten la


piperacilin-tazobactam,

piperacilin,

ceftazidim,

ceftriaxon,

imipenem,

meropenem,

gentamicin, tetraciclin, trimethoprim-sulfometoxazol, ticarcilin, amikacin manifestnd


fenotip MDR (Magiorakos i colab., 2012) .
Tulpina de A. lwoffii izolat din lichid pleural, analizat in 2013 a fost de asemenea MDR
(Magiorakos i colab., 2012).
Conform Compartimentului de Prevenire i Control al Infeciilor Nosocomia le din
Institutul Clinic Fundeni n primul trimestru al anului 2013 au fost izolate 9 tulpini de bacili
Gram negativi productoare de metalo--lactamaz i 11 tulpini productoare de BLSE n timp
ce n primul trimestru al anului 2014 s-a constatat o scdere a numrului de tulpini productoare
de metalo--lactamaz (n=3) i o cretere a celor productoare de BLSE (n=28).
Rezultate similare au fost obinute i de Idomir i colab., 2009, analiznd 108 tulpini de
Acinetobacter sp. izolate de la pacieni aflai n seciile de terapie intensiv, ortopedie, chirurgie
plastic ai Spitalului de Urgent Braov, n perioada 2008-2009 (87%-A. baumannii; 11,4%-A.
calcoaceticus; 0,93%-A. lwoffii; 0,93%-A. baumannii/haemolyticus). Toate tulpinile luate n
studiu au prezentat multirezisten.
Mishra i colab., n 2013 au raportat niveluri ridicate ale rezistenei la antibiotice a 497
tulpini de A. baumannii/haemolyticus i A. lwoffii izolate de la Spitalul Universitar din Nepal pe
o perioad de 6 luni, astfel c 95% din tulpini au fost MDR iar 12,9 % BLSE.

CONCLUZII
1. Analiza distribuiei tulpinilor de BGNNF izolate n 2013, corelat cu sursele de izolare, a
relevat faptul c numrul tulpinilor (n=54) provenite din situsuri nesterile este net
superior celui provenit din situsuri sterile (n=28 tulpini); situaie similar celei
identificate n 2012, n cazul tulpinilor analizate de la pacieni ai Institutului de Boli
Cardiovasculare Prof. ,,C.C. Iliescu (n=86/26). De asemenea s-a constatat c tulpinile
de P. aeruginosa (61,9%) au fost cel mai frecvent izolate pe parcursul anului 2013
comparativ cu celelalte specii de BGNNF.
- 89 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

2. Analiza profilurilor de rezisten la antibiotice ale tulpinilor de P. aeruginosa, izolate din


situsuri nesterile n 2013, a evideniat niveluri net superioare antibiorezistenei
identificate n cazul tulpinilor de P. aeruginosa analizate n 2012 din aceleai tipuri de
produse patologice (100%/34,6% - imipenem; 39,39%/19,23% - inhibitorul de lactamaz; 75%/50% - gentamicin).
3. Interpretarea tulpinilor de P. aeruginosa izolate din situsuri sterile, n 2013 a artat
creterea nivelului de rezisten la urmatoarele antibiotice comparativ cu tulpinile de P.
aeruginosa izolate din surse similare n 2012: 100%/57,89% - imipenem; 50%/36,8% piperacilin; 50%/42% - ceftazidim; 22%/10% - inhibitorul de -lactamaz; 61,1%/52,6
gentamicin.
4. Evaluarea profilurilor de rezisten pentru tulpinile de A. baumannii izolate din situsuri
nesterile n 2013, a artat niveluri superioare ale rezistenei la acelai tip de agent
antimicrobian celor identificate n cazul tulpinilor de A. baumannii provenite din aceleai
tipuri de produse patologice izolate n 2012, respectiv: piperacilin, tazobactam
(100%/76%); piperacilin (100%/79%).
5. Analiznd nivelurile de rezisten la antibiotice ale tulpinilor de A. baumannii izolate din
situsuri sterile n 2013 s-a constatat niveluri mai ridicate ale rezistenei la acelasi tip de
agent antimicrobian, spre exemplu la ceftazidim (100%/85,7%) i ciprofloxacin
(75%/85,7%).
6. Testarea la substane antimicrobiene a celor 11 tulpini de S. maltophilia izolate pe
parcursul anului 2013 a evideniat niveluri inferioare de rezisten la levofloxacin
(45,45%) i cefalosporine de generatie a III-a (9,09%), tulpinilor de S. maltophilia
analizate pe parcursul anului 2012 (66,6%/66,6%), paralel cu sensibilitatea la
cloranfenicol (54,54%/50%) i trimethoprim -sulfametoxazol (45,45%/50%).

- 90 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

OBIECTIVUL 2
EVIDENIEREA GENOTIPIC A ANTIBIOREZISTENEI LA TULPINI DE BGNNF
Apariia rezistenei la antibiotice e ste un fenomen evolutiv cauzat de presiunea selectiv a
factorilor de mediu (Greenwood, 1998). Din momentul introducerii antibioticelor n medicina
uman, utilizarea antibioticelor a exercitat o presiune pentru selectarea unor tulpini bacteriene cu
capacitatea natural de a rezista la aciunea agenilor antimicrobieni , fiind purttoare de
determinani genetici mobili de rezisten de tipul transpozonilor sau integronilor (Partridge,
2009). Muli dintre aceti factori de rezisten pot fi transferai i diseminai ntre diferite tulpini
microbiene, fr bariere de gen i specie.
Genele de rezisten la antibioticele -lactamice au fost descoperite nainte de
introducerea penicilinei n terapia antiinfecios. Originea genelor de rezisten la antibiotice nu
este clar (Cornaglia i colab., 2011). Perioada de la nceputul tratamentului cu antibiotice
(aproximativ cu 70 de ani n urm), pn la emergena bacteriilor care exprim mecanisme
eficiente de rezisten, este mult prea scurt pentru a explica dezvoltare a factorilor de rezisten
din proteine celulare, prin mutaie spontan.
Pn n prezent au fost descrise 9 tipuri de metalo--lactamaze dobndite (Cornaglia i
colab., 2011), cele mai importante din punct de vedere al diseminrii epidemiologice i
relevanei clinice sunt blaVIMlike, blaSPMlike, blaIPMlike i blaNDMlike.

Activiti:
1. Screening-ul genelor codificatoare ale rezistenei la antibiotice -lactamice, aminoglicozide i
pompe de eflux la tulpini de BGNNF izolate din infecii nosocomiale prin metoda PCR.
2. Investigarea suportului genetic al genelor pentru metalo--lactamaze i clasa D a lactamazelor prin PCR i secveniere.

- 91 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
MATERIALE I METODE
1.TULPINI BACTERIENE

n studiul genotipic al rezistenei la carbapeneme au fost selectate 102 de tul pini de


BGNNF rezistente la carbapeneme (Tabelul 12, 13 i 14) dintr-un numr total de 204 de tulpini
analizate fenotipic n perioada studiului.
Tabelul 12. Tulpinile de P. aeruginosa utilizate n studiu, codificarea utilizat i sursele de izolare ale acestora
Nr. crt.
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45

Codificarea utilizat n cursul


experimentelor
1
2
5
6
7
8
9
10
11
12
13
15
16
17
20
21
22
23
26
30
31
36
37
41
43
45
46
47
48
49
53
54
57
58
59
D
F
L
O
P
R

i
r
g

Codul de laborator al tulpinii de P.


aeruginosa
75
144
80
207
432
175
73
200
803
202
273
160
67
304
289
568
238
163
31
299 III
236
484
483
474
519
428
420
521
562
794
605
829
15
243
543
1571
1247
1640
1656
1619
1275
1622
305/2
348
598

- 92 -

Sursa de izolare
secreie traheal
secreie plag
secreie traheal
secreie traheal
exsudat faringian
escar
secretie traheal
secreie traheal
secreie traheal
secreie plag
secreie plag
secreie plag
plag
urocultur
hemocultur
cateter
herectomie
hemocultur
coprocultur
hemocultur
secretie plag
hemocultur
hemocultur
urocultur
hemocultur
secreie traheal
secreie traheal
cateter
secreie traheal
secreie plag
secreie traheal
secreie plag
Sput
urocultur
secreie traheal
exsudat faringian
varf cateter
lavaje bronho-alveolare
Secreie (aspirat tracheal)
exsudat nazal
secreie plag
exsudat nazal
necunoscut
necunoscut
necunoscut

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Tabelul 13. Tulpinile de A. baumannii, A. baumannii/haemolyticus i A. lwoffii utilizate n studiu, codificarea


utilizat i sursele de izolare ale acestora
1
2
3
4
5
6
7

Codificarea utilizat n cursul


experimentelor
3
4
14
18
19
24
25

Codul de laborator al tulpinii de A.


baumannii
77 A. baumannii
352 A. baumannii
200 A. baumannii
171 A. baumannii
26 A. baumannii
221 A. baumannii
1858 A. baumannii

secreie traheal
exsudat nazal
secreie traheal
secreie traheal
secreie traheal
secreie traheal
secreie traheal

8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44

27
28
29
32
33
34
35
38
39
40
42
50
51
52
60
A
n
55
T
61
62
j
s
h
q
a
p
l
c
b
v
t
I
S
V
W
X

340 A. baumannii
293 III A. baumannii
516 III A. baumannii
275 A. baumannii
296 A. baumannii
293 III A. baumannii
293 I A. baumannii
373 A. baumannii
342 A. baumannii
340 A. baumannii
779 A. baumannii
588 A. baumannii
769 A. baumannii
523 A. baumannii
591 A. baumannii
1447 A. baumannii
383 A. baumannii
20 A. baumannii
210 A. baumannii
341 A. baumannii
669 A. baumannii
38 A. baumannii
313 A. baumannii
501 A. baumannii
521 A. baumannii
261 A. baumannii
605 A. baumannii
361 A. baumannii
497 A. baumannii
225 A. baumannii
628 A. baumannii
391/2 A. baumannii
1592 A. baumannii/haemolyticus
1580 A. baumannii/haemolyticus
1605 A. baumannii/haemolyticus
1590 A. baumannii/haemolyticus
1294/2 A. lwoffii

exsudat tracheal
secreie traheal
exsudat tracheal
secreie traheal
secreie traheal
secreie traheal
secreie traheal
secreie cateter
Secreie
secreie traheal
cateter
cateter venos
secreie plag
secreie plag
secreie traheala
urocultur
necunoscut
coprocultur
urocultur
secreie traheal
cateter
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
necunoscut
secretie bronic
urocultur
exsudat nazal
exsudat nazal
lichid pleural

Nr. crt.

- 93 -

Sursa de izolare

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Tabelul 14. Tulpinile de S. maltophilia i E. brevis utilizate n studiu, codificarea utilizat i sursele de izolare ale
acestora
Nr. crt.
1
2
3
4
5
6
7
8
9
10
11
12
13

Codificarea utilizat n cursul


experimentelor
B
C
E
G
H
J
K
M
N
Q
o
e
w

Codul de laborator al tulpinii de S.


maltophilia si E. brevis
1539 S. maltophilia
2590 S. maltophilia
1383 S. maltophilia
734 S. maltophilia
202 S. maltophilia
225 S. maltophilia
570 E. brevis
2632 S. maltophilia
1294/1 E. brevis
679 E. brevis
37 S. maltophilia
506 S. maltophilia
762 S. maltophilia

Sursa de izolare
secreie bronic
exsudat faringian
exsudat nazal
urocultur
urocultur
sput
urocultur
exsudat faringian
lichid pleural
hemocultur
necunoscut
necunoscut
necunoscut

2. Reacia PCR (Polymerase Chain Reaction= Reacia de polimerizare n lan) este o


metod de amplificare enzimatic in vitro a unei anumite secvene de ADN . Din punct de vedere
chimic, reacia PCR est e constituit din cicluri succesive de replicare ADN in vitro, folosind 2
primeri oligonucleotidici ce hibridizeaz cu cele dou catene ale matriei. Diferena esenial
ntre o asemenea reacie de replicare i un proces de replicare ADN in vivo, este reprezentat de
faptul c n reac ia PCR etapa de desfacere a dublului helix matri i respectiv, cea de ataare a
primerilor, nu sunt realizate enzimatic ci prin parcurgerea unor trepte de temperatur, iar singura
enzim folosit n reacie este o ADN polimeraza dependent de ADN (Vassu i colab., 2001).
Obinerea ADN bacterian pentru screening-ul genelor de rezisten s-a realizat prin
metoda lizei bacteriene datorat ocului termic. Pentru aceasta tulpinile bacteriene au fost
nsmnate n mediu lichid BHI (Broth Hearth Infusion) la 37C, 24 ore cu agitare 10000 r.p.m.
n etapa urmtoare s-a realizat centrifugarea a 1,5 ml din cultura bacterian obinut n mediu
lichid timp de 15 min. la 10000 r.p.m., s-a ndeprtat supernatantul, etap urmat de adugarea a
1 ml ap distilat peste sedimentul celular, dup care probele au fost nclzite la 100C timp de
10 min. i rcite brusc la -20C. Verificarea produsului obinut s-a realizat prin electroforez n
gel de agaroz 1% i colorare cu bromur de etidiu 3,5g/ml.
n urma observrii fenotipurilor bacteriene obinute cu ajutorul testelor anterioare, s-a
realizat verificarea existenei ctorva gene frecvent asociate cu producerea de -lactamaze, lactamaze de spectru extins i aminoglicozide utiliznd mixul de reacie - GoTaq Green Master
Mix (Promega, USA): blaVIM, blaIMP, blaSPM, blaBIC, blaAIM, blaSIM, blaDIM, blaGIM, blaBic, blaPER1,
aac3Ia, blaOXA-2, blaOXA-10, blaOXA-23, blaOXA-24, blaOXA-50, blaOXA-55, blaOXA-58, blaOXA-60 i blaOXA- 94 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
69,

blaGES (tabelul 15) pentru familiile Pseudomonadaceae i Moraxellaceae a cror prezen n

genomurile bacteriene a fost evideniat pentru aceleai specii circulante n alte regiuni ale
globului. Pentru amplificarea acestor gene, au fost folosii primeri descrii n literatur, conform
tabelului nr.15.
Programul de amplificare s-a realizat conform urmtoarelor condiii:
94C 10 min
94C 30s
52C 40s
36 cicluri
72C 50s
72C 5 min.
Excepie: aac-3-Ia si blaPER-1 cu urmatoarele conditii de amplificare:
94C 5 min
94C 30s
55C 30s
35 cicluri
72C 1 min
72C 10 min.
Tabelul nr. 15. Secvena primerilor i dimensiunea ampliconilor obtinui n experimentele multiplex i simplex PCR
Primeri
GES-C
GES-D
Pre-OXA-58prom
Pre-OXA-58B
OXA-55/1
OXA-55/2

Secvena primerilor
5GTTTTGCAATGTGCTCAACG 3
5TGCCATAGCAATAGGCGTAG 3
5TTATCAAAATCCAATCGG C 3
5TAACCTCAAACTTCTAATTC 3
5CATCTACCTTTAAAATTCCC 3
5AGCTGTTCCTGCTTGAGCAC 3

S
AS

5AATCCGGCGCTCATCCAT C 3
5GGTCGGCGACTGAGGCGG 3

869

5AAAGGAGTTGTCTCATGCTGTCTCG 3
5AACCTACAGGCGCGCGTCTCACGGTG 3
5'-ATGAGTTATCTATTTTTGTC-3'
5'-TGTCAAGCTCTTAAATAATA-3'
5 GCCAAAGGCACGATAGTTGT3
5 GCGTCCGAGTTGACTGCCGG3

501

blaOXA-2

OXA-60A
OXA-60B
OXA-23-F
OXA-23-R
OXA-2-F
OXA-2-R

blaOXA-10

OXA-10-F
OXA-10-R

5 TCTTTCGAGTACGGCATTAGC3
5 CCAATGATGCCCTCACTTTCC3

759

blaOXA-48

OXA-F
OXA-R
IMP-F
IMP-R
SPM-F
SPM-R
AIM-F
AIM-R
VIM-F
VIM-R
GIM-F
GIM-R
BIC-F
BIC-R
SIM-F

5GCGTGGTTAAGGATGAACAC 3
5CATCAAGTTCAACCCAACCG 3
5GGAATAGAGTGGCTTAA(C/T)TCT C 3
5GGTTTAA(C/T)AAAACAACCACC 3
5AAAATCTGGGTACGCAAACG 3
5ACATTATCCGCTGGAACAGG 3
5CTGAAGGTGTACGGAAACAC 3
5GTTCGGCCACCTCGAATTG 3
5GATGGTGTTTGGTCGCATA 3
5CGAATGCGCAGCACCAG 3
5TCGACACACCTTGGTCTGAA 3
5AACTTCCAACTTTGCCATGC 3
5TATGCAGCTCCTTTAAGGGC 3
5TCATTGGCGGTGCCGTACAC 3
5TACAAGGGATTCGGCATCG 3

Gena

blaGES
Subgrup 4 (OXA-58)
Subgrup 5
(Shewanella OXA-55)
Subgrup 7 (OXA-50)
Subgrup 8 (OXA-60)

blaOXA-23

blaIMP
blaSPM
blaAIM
blaVIM
blaGIM
blaBIC
blaSIM

- 95 -

Nr. bp

Referina

371
934

701

Queenan i Bush,
(2007)

Woodford i
colab., (2006)
De Champs i
colab., (2002)
Naas i colab.,
(2000)

438
232
789

Poirel i colab.,
(2011)

322
390
477
537
570

Continuare pag.
96

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

blaNDM
blaDIM
blaKPC
aac-3-Ia
blaPER

SIM-R
NDM-F
NDM-R
DIM-F
DIM-R
KPC-Fm
KPC-Rm

5TAATGGCCTGTTCCCATGTG 3
5GGTTTGGCGATCTGGTTTTC 3
5CGGAATGGCTCATCACGATC 3
5GCTTGTCTTCGCTTGCTAACG 3
5CGTTCGGCTGGATTGATTTG 3
5CGTCTAGTTCTGCTGTCTTG 3
5CTTGTCATCCTTGTTAGGCG 3

aac-3-Ia F
aac-3-IaR

5'-ATGGGCATCATTCGCACA-3'
5'-TCTCGGCTTGAACGAATTGT-3'

PER-F
PER-R

621
699
271
484

DQ370505

925

Jiang i colab.,
2005

blaTEM

TEM-F
TEM-R

5'-AATTTGGGCTTAGGGCAGAA-3'
5'-ATGAATGTCATTATAAAAGC-3'
5'-ATGAGTTTTCAACATTTTCG-3'
5'-TTACCAATGCTTAATCAG TG-3'

blaSHV

SHV-F
SHV-R

5'-GCCCTCACTCAAGGATGTAT-3'
5'-TTAGCGTTGCCAGTGCTCGA-3'

888

blaCTX-M

CTX-M-F
CTX-M-R

5-CGCTGTTGTTAGGAAGTGTG-3
5-GGCTGGGTGAAGTAAGTGAC-3

730

861

Eftekar i colab.,
2005

Naas i
colab., 1999
Israil i colab.,
2013

Componentele reaciei de amplificare sunt prezentate n Tabelul 16.


Tabelul 16. Componentele reaciei PCR
Concentraia
Gena

blaVIM,blaIMP,
blaSPM,blaBIC,
blaAIM,blaSIM,
blaDIM,blaGIM,
blaBic, blaPER1,
aac3Ia, blaGES
blaOXA-2,
blaOXA-10,
blaOXA-23,
blaOXA-24,
blaOXA-50,
blaOXA-55,
blaOXA-58,
blaOXA-60

Volum final
primeri

MgCl2

dNTP

ADN-TaqPol

tampon reacie

ADN

0,5 M

1,2 mM

2 M

0,2 Ul

1X

10X

20l

3. INVESTIGAREA SUPORTULUI GENETIC AL GENELOR PENTRU


METALO--LACTAMAZE I CHLD
Obinerea ADN bacterian pentru screening-ul genelor de rezisten de tip blaVIM

like

blaOXA-23 like s-a realizat utiliznd kit-ul de extracie ADN genomic Pure Link Mini Kit. Pentru
aceasta, din tulpinile bacteriene s-a realizat o suspensie 0,5McFarland care s-a centrifugat 10
- 96 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

min. la 10000 r.p.m., s-a ndeprtat supernatantul iar sedimentul a fost resuspendat n 180 l
soluie tampon de digestie (Genomic Digestion Buffer). n etapa urmtoare s-au adaugat 180 l
soluie proteinaz K i s-a realizat incubarea la 55C, cu vortexare ocazional, pn la liza
complet. Ulterior s-au adaugat 20 l solutie RNA-za A i 200 l soluie tampon de liz
(Binding Buffer), urmat de vortexare pn la obinerea unei soluii omogene. Au urmat etapele
de splare: n prima etap cu 500 l soluie tampon de splare nr.1 (Wash Buffer no.1), iar n
cea de-a doua etap cu 500 l soluie tampon de splare nr.2 (Wash Buffer no.2), fiecare dintre
etape fiind urmat de cte o centrifugare timp de 1-3 min. la 10000 r.p.m. n ultima etap s-au
adaugat 100 l soluie tampon de eluie (Genomic Elution Buffer), s-a incubat pentru 1min. la
temperatura camerei, urmat de centrifugare pentru 1min. la 10000 r.p.m. i rcire brusc la 20C. Verificarea produsului obinut s-a realizat prin electroforez n gel de agaroz 1% colorat
cu bromur de etidiu 3,5g/ml.
Pentru secveniere reaciile PCR au fost realizate utiliznd mix de reacie TaKaRa
[Premix Taq DNA Polymerase (TaKaRa Taq, Takara Bio Inc, Japonia)], urmnd programul
de amplificare prezentat n continuare:

94C 5 min
94C 30s
50C 50s
72C 1,5 min
72C 5 min.

30 cicluri- clasa 1 Integroni (RHS-RHR)

94C 5 min
94C 30s
55C 50s
72C 1,5 min
72C 1,5 min.

30 cicluri- blaOXA-23

Suportul genetic al genei blaVIMlike a fost investigat cu primeri pentru regiunile conservate
(5CS-3CS) ale integronilor de clasa 1(RHS-RHR) (Tabelul 17). Amplificarea genei blaOXA-23
s-a realizat cu ajutorul primerilor OXA23A (GATGTGTCATAGTATTCGTCG) i OXA23B
(TCACAACAACTAAAAGCACTG) care flancheaz un fragment intern al genei de 501bp i
conform protocolului descris n literatur (Poirel i colab., 2011).
Verificarea produsului obinut s-a realizat prin electroforez n gel de agaroz 1,5% , 1
or, la 80V, colorat cu bromur de etidiu 3,5g/ml. Ampliconii au fost secveniati utiliznd
secveniatorul ABI 3730xl DNA (Applied Biosystems, Foster City, CA) la Institutul de
- 97 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Genomic din Beijing (Beijing, China), iar identitatea MBL i CHLD a fost stabilit prin analiza
secvenelor utiliznd soft-ul ChromasLite 2.1.1 (www.technelysium.com.au) i compararea cu
baza de date NCBI cu ajutorul programului BLAST (http://www.ncbi.nlm.nih.gov).
Tabelul 17. Primerii utilizai pentru secvenierea produilor PCR
Primeri

Secvena primerilor (5'-3')

ZonaTarget

Referina

RHS

GTGGGTCGATGTTTGATGTT

5'-CS clasa 1 integroni

RHR

GCTGTGAGCAATTATGTGCTTAGTGC

3'-CS clasa 1 integroni

OXA23A

GATGTGTCATAGTATTCGTCG

blaOXA-23

OXA23B

TCACAACAACTAAAAGCACTG

blaOXA-23

Partridge
i colab.,
2011
AfzalShah i
colab.,
2001

4. Analiza statistic a rezultatelor obinute


Unde a fost cazul, rezultatele obinute au fost prelucrate statistic cu softwarele GraphPad
Prism, InStat (GraphPad) i Excel (Microsoft), utiliznd testele Anova cu o singur variabil
(One-way Analysisof Variance). Valori ale lui P<0.05 au fost considerate semnificative.

REZULTATE I DISCUII
1. SCREENING-UL GENELOR CODIFICATOARE
ANTIBIOTICE -LACTAMICE,

ALE REZISTENEI LA

AMINOGLICOZIDE I POMPE DE EFLUX LA

TULPINI DE BGNNF PRIN METODA PCR


Screening-ul molecular al rezistenei la carbapeneme a evideniat o diversitate genetic
ridicat (de la una pn la trei gene de rezisten la aceeai tulpin). Genele de rezisten la
carbapeneme au fost detectate la tulpini de P. aeruginosa (36) i de A. baumannii (26) din
INBCV ,,Prof. C.C. Iliescu. n SCF ordinea descresctoare a frecvenei genelor de rezisten la
carbapeneme a fost urmtoarea: A.baumannii (15 tulpini); P. aeruginosa (12 tulpini); A.
baumanii/haemolyticus (2 tulpini).
La SCF cele mai frecvente gene de rezisten la carbapeneme au fost: blaOXA23like (15
tulpini), blaOXA10 like (12 tulpini) i blaVIMlike (7 tulpini).

- 98 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Au fost detectate gene comune ambelor uniti spitaliceti (blaOXA23like, blaVIMlike), dar i
gene specifice fiecrei uniti spitaliceti (n CCI blaOXA50like) iar n SCF (blaSPMlike, blaOXA10like,
blaOXA60like).
Screening-ul genotipic al rezistenei la carbapeneme a demonstrat prezena n ordine
descresctoare a urmtoarelor gene: blaOXA50like ( 80% din P. aeruginosa), blaOXA23like (75,92%
din A. baumanii i A. baumannii/haemolyticus), blaVIMlike (53,33% din P. aeruginosa),
blaOXA10like (26,66% din P. aeruginosa), blaOXA60like (8,88% din P. aeruginosa), blaSPMlike i
blaOXA55like ( 6,66% din P. aeruginosa ), (fig. 52 i 53 ).
n ceea ce privete rezistena mediat de -lactamazele de spectru extins, acestea au fost
detectate exclusiv n INBCV Prof. C.C. Iliescu, fiind reprezentate n ordine descresctoare de:
blaGESlike (66,6% din P. aeruginosa); blaTEMlike (33,3% din A. baumannii i 13,3% din P.
aeruginosa); blaCTX-Mlike (8,88% din A. baumannii i 6,66% din P. aeruginosa); blaPERlike (5,55%
din A. baumannii) (fig 52 i 53). Prevalena ridicat a tulpinilor de P. aeruginosa i A. baumanii
productoare de BLSE din spitale din Bucureti accentueaz necesitatea detectrii imediate a
tulpinilor ce adpostesc gene pentru BLSE i implementarea imediat a msurilor de control
epidemiologic (Gheorghe i colab., 2014b).
Din punct de vedere al rezistenei la aminoglicozide, a fost testat doar gena aac3Ia, aceasta
fiind prezent la 75% din tulpinile de A. baumannii/haemolyticus din Spitalul Clinic Fundeni;
18,5% din tulpinile de A. baumannii din SCF i 9,25% din tulpinile de A. baumannii din INBCV
Prof. C.C. Iliescu; 13,33% din tulpinile de P. aeruginosa din prima unitate spitaliceasc i 8,88%
din tulpinile de P. aeruginosa din cea de-a doua unitate spitaliceasc (fig. 54).
ntruct rezistena dobandit la carbapeneme este adeseori corelat la BGNNF cu mutaii la
nivelul porinelor care determin

o scdere a permeabilittii acestora i n final creterea

rezistenei la carbapeneme, testare a genelor OprDlike a demonstrat prezena acestora la 20% din
tulpinile de P. aeruginosa din cea de-a doua unitate spitaliceasc (fig.54).

- 99 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig.52. Reprezentarea grafic a distribuiei genelor de rezisten la carbapeneme si BLSE la BGNNF analizate pe
specii. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate genele de rezisten la
carbapeneme i BLSE identificate la tulpinile analizate. Interpretarea statistic a fost realizat cu metoda One-way
Analysis of Variance (ANOVA), *P < 0.05.

Fig.53. Reprezentarea grafic a distribuiei comparative a genelor de rezisten la carbapeneme i BLSE n cele dou
uniti spitaliceti. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate genele de

- 100 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
rezisten la carbapeneme i BLSE identificate la tulpinile analizate. CCI = INBCV Prof. C.C. Iliescu, SCF =
Spitalul Clinic Fundeni. Interpretarea statistic a fost realizat cu testul one way Anova, *P < 0.05; **=P<0.01.

Fig. 54. Reprezentarea grafic a distribuiei genelor de rezisten la aminoglicozide i pentru pompe de eflux la
BGNNF. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate genele de rezisten la
aminoglicozide i pompe de eflux identificate la tulpini le analizate. CCI = INBCV Prof. C.C. Iliescu, SCF =
Spitalul Clinic Fundeni. Interpretarea statistic a fost realizat cu testul one way Anova, *P < 0.05.

Analiza distribuiei tulpinilor de BGNNF pe surse de izolare a artat c rezistena la


carbapeneme a fost identificat la tulpini provenite din secreie traheal (32,35%) urmat de
tulpini provenite din surse de izolare necunoscute (14,70%), tulpini provenite din secreie plag,
exsudat nazal i hemocultur (9,80%), tulpini izolate din catetere (7,84%) i tulpini izolate din
exsudat faringian i urocultur (5,88 %) (fig. 55).

- 101 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 55. Reprezentarea grafic a tulpinilor de BGNNF ce prezint gene de rezisten la carbapeneme analizate pe
surse de izolare. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate sursele de
izolare ale tulpinilor ce prezint gene de rezisten la carbapeneme. Interpretarea statistic a fost realizat cu testul
one way Anova.

n ceea ce privete rezistena tulpinilor de BGNNF la BLSE corelat cu sursele de izolare


a demonstrat c, similar rezistenei la carbapeneme un procent semnificativ de tulpini (22,54%)
provin din secreie traheal (fig. 56).

- 102 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Fig. 56. Reprezentarea grafic a tulpinilor de BGNNF ce prezint gene de rezisten la BLSE analizate pe surse de
izolare. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate sursele de izolare ale
tulpinilor ce prezint gene de rezisten la BLSE. Interpretarea statistic a fost realizat cu testul one way Anova.

n ceea ce privete rezistena tulpinilor de BGNNF la aminoglicozide corelat cu sursele


de izolare a demonstrat c 7, 84% din tulpini provin din secreie traheal (fig. 57) iar prezena
porinelor de tip OprD like a fost identificat la 5,88% din tulpini provenite din secreii de plag
(fig. 58).

Fig. 57. Reprezentarea grafic a tulpinilor de BGNNF ce prezint gene de rezisten la aminoglicozide analizate pe
surse de izolare. Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate sursele de
izolare ale tulpinilor ce prezint gene de rezisten la aminoglicozide. Interpretarea statistic a fost realizat cu
testul one way Anova.

- 103 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Fig. 58. Reprezentarea grafic a tulpinilor de BGNNF ce prezint gene de tip OprDlike analizate pe surse de izolare.
Pe axa X este reprezentat numrul tulpinilor analizate iar pe axa Y sunt reprezentate sursele de izolare ale tulpinilor
ce prezint gene de tip OprDlike. Interpretarea statistic a fost realizat cu testul one way Anova.

Rezultatele detectrii prin PCR a genei blaVIMlike la tulpinile de P. aeruginosa analizate


sunt listate n fig. 52 i 53, iar imaginile de electroforez sunt prezentate n fig. 59 i 60, gena
fiind detectat la mai mult de jumatate din tulpinile de P. aeruginosa luate n studiu.
L

1 2

3 4 5 6

7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 M

390bp
bp

Fig. 59. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaVIMlike: L- Marker de greutate molecularGeneRuler 1400 bp (Fermentas), 1,2,5,6,7,8,9,10,11,12,13,15,16,17,20,21,22,23,26-P. aeruginosa;
3,4,14,18,19,24,25-A.baumannii; M control negativ.

Beta-lactamazele din familia VIM au fost descrise prima dat n Europa n 1990, ulterior
fiind semnalate ca avnd distribuie global. n prezent, -lactamazele blaVIMlike constau n 33 de
variante, identificate n cea mai mare parte la izolate clinice de P. aeruginosa (Bonnin i colab.,
2013) i asociate casetelor genice ale integronilor din clasa 1 (Nordmann i colab., 2011).
Metalo--lactamazele VIM prezint specificitate de substrat mai ridicat comparativ cu cele din
familia IMP, fiind capabile s hidrolizeze 6--metoxi-penicilinele; n plus acestea prezint cea
mai mare afinitate pentru carbapeneme (Docquier i colab., 2003).
La nivel european, metalo--lactamazele de tip VIM au fost semnalate n Grecia (VIM-1,
VIM-2, VIM-4, VIM-12 SI VIM-17) la izolate clinice de P. aeruginosa i Enterobacteriaceae
(Cornaglia i colab., 2011). Gena blaVIM-4 a fost descris prima dat la izolate clinice de P.
aeruginosa din Grecia n 2001, ulterior semnalat n Suedia (Pournaras i colab., 2002),
reprezint o variant a genei blaVIM-1 avnd o substituie la nivelul unui singur aminoaci d
- 104 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

(Docquier i colab., 2003 ). Italia a fost prima ar european n care a fost raportat metalo -lactamaza VIM-1 i VIM-14 (Mazzariol i colab., 2010). n Turcia, prima metalo--lactamaz
semnalat a fost VIM-5 la izolate clinice de Klebsiella pneumoniae (Midilli i colab., 2003),
ulterior VIM-1 i VIM -2 la izolate clinice de P. aeruginosa (Poirel i colab., 2000), i mai recent
a fost semnalat co-expresia metalo--lactamazei VIM-2 cu BLSE PER-1 la tulpini clinice de P.
aeruginosa (Yakupogullari i colab., 2008).
Prima metalo--lactamaz descris n Frana a fost VIM-2, n 1996 la izolate clinice de P.
aeruginosa (Poirel i colab., 2000). n ciuda fapului ca me talo--lactamazele de tip VIM au
ptruns rapid i n Spania, metalo--lactamaza VIM-2 fiind raportat la izolate clinice de P.
aeruginosa (Pena i colab., 2007), prevalena acestora ramne relativ scazut, ulterior doar 2 noi
variante (VIM-13 i VIM -20) fiind descrise n literatur (Juan i colab., 2008). Tulpini
multirezistente de P. aeruginosa productoare de carbapenemaze de tipul blaVIM-2 au fost
raportate i n Belgia (Deplano i colab., 2007). Genele blaVIM-2 i blaVIM-4 au fost semnalate i n
Norvegia i Suedia, ele aflndu-se n cocirculaie cu blaIMP-14 la izolate clinice de P. aeruginosa
(Samuelson i colab., 2010). n Germania au fost semnalate -lactamazele VIM-1, VIM-2, VIM15 i VIM-16 la izolate clinice de P. aeruginosa provenite de la pacieni ai spitalelor dintr-un
singur ora (Schneider i colab., 2008).
Gena blaVIM-2 a fost semnalat n rndul izolatelor clinice de P. aeruginosa fiind raportat
i n Austria (Duljasz i colab., 2009), Polonia, Bulgaria, Ungaria (Walsh i colab., 2005),
Serbia, Croaia (Cornaglia i colab., 2011) i Rusia (Toleman si colab., 2007). Prima metalo-lactamaz semnalat la izolate clinice de P. aeruginosa n Ungaria a fost VIM-4 (Libisch i
colab., 2005).
La nivel global, -lactamazele din familia VIM au fost descrise n Coreea (Walsh i
colab., 2005), VIM-2 la izolate clinice de P. aeruginosa i A. baumannii; n Taivan, prima
metalo--lactamaz descris a fost VIM-3 (Yan i colab., 2001), n America de Sud a fost
semnalat metalo--lactamaza VIM-2 n rndul izolatelor clinice de P. aeruginosa (Pasteran i
colab., 2005); n SUA prima metalo--lactamaz descris a fost VIM-7 (Toleman i colab.,
2004).

- 105 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

26 27 28 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 47 48 49 50 51 AT M

390bp
bp

Fig. 60. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaVIMlike: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas), 26, 30, 31, 36, 37, 41, 43, 45, 46, 47, 48, 49, 53, 54, 57, 58, 59 - P. aeruginosa;
27, 28, 29, 32, 33, 34, 35, 38, 39, 40, 42, 50, 51, 52, 55, 56, 60 - A. baumannii; AT - P. aeruginosa 27853 i M
control negativ.

Rezultatele testrii prin PCR a carbapenemazei blaSPMlike sunt ilustrate n figura 52 i 53,
iar imaginile de electroforez n gel de agaroz a ampliconilor obtinui sunt prezentai n fig. 61,
ce demostreaz prezena acestei metalo --lactamaze la aproximativ 7% dintre tulpinile de P.
aeruginosa analizate.
L 1 2 3 4

5 6

8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 M

789bp

Fig. 61. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaSPMlike: L - Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 20, 21, 22, 23 - P. aeruginosa; 3, 4, 14,
18, 19, 24, 25 - A. baumannii; M control negativ.

Metalo--lactamaza SPM (Sao Paulo metallo--lactamase) este cea mai comun


carbapenemaz n rndul izolatelor clinice de P. aeruginosa din Sao Paolo (Toleman i colab.,
2002), ulterior rspndindu-se rapid n toat Brazilia ns cu diferene de la o regiune la alta.
Prima semnalare a genei blaSPM-1 n afara Braziliei, a fost n Elveia la un izolat clinic de P.
aeruginosa provenit de la un pacient ngrijit de o asistent medical originar din Brazilia (Salabi

- 106 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

i colab., 2010). Gena a fost detectat de asemenea n Iran (Shahcheraghi i colab., 2011 ) i n
Spania (Villaln i colab., 2013).
Majoritatea enzimelor CHDL au fost descrise la A. baumannii (fig. 62) i sunt OXA-23 ,OXA-24
,OXA-58 ,OXA-143 (dobndite), OXA-51 (intrinsec)

OXA-23
Europa (ubiquitar inclusiv n
Romnia), Australia,
Tahiti, China, Singapore, Vietnam,
SUA, Brazilia, Pakistan.
Localizare: plasmidial sau
cromosomal.
Elemente asociate: ISAba1, ISAba4

OXA-51

OXA-24
Spania, Belgia, Frana, SUA,

Intrinsec la A. baumannii, cu
distribuie global.

Portugalia

Localizare: cromosomal.

Localizare: plasmidial
(OXA40)/cromosomal.

Elemente asociate: ISAba1.

Nu prezint elemente asociate.

OXA-58
Frana, Spania, Belgia, Romnia,
Turcia, Grecia, UK, Italia, Austria,
Argentina, Australia, Statele Unite,
Pakistan
Localizare: plasmidial sau
cromosomal.
Elemente asociate: ISAba1,
ISAba2, ISAba3, IS18.

OXA143
Subgrup nou de CHDL identificat n
Brazilia
Localizare: plasmidial.
Nu este asociat cu SI sau localizat
pe integroni.

Fig. 62. Distribuia i contextul genetic al enzimelor CHDL la A. baumannii (dup Peleg i colab., 2008) .

- 107 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Rezultatele testrii prin PCR a CHLD blaOXA-23like sunt ilustrate n fig. 52 i 53, iar
imaginile de electroforez n gel de agaroz a ampliconilor obtinui sunt prezentate n fig. 63-66
[( fig. 63 - tulpini izolate de la pacieni ai SCF); fig. 64, 65, 66 - tulpini izolate de la pacieni ai
INBCV ,,Prof. C.C. Iliescu)], gena fiind identificat la aproximativ 76% dintre tulpinile de A.
baumannii i A. baumannii/haemolyticus luate n studiu.
L

A B C D E F G H I

J K L M N O P Q R S V W X M

501bp

Fig. 63. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-23like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas), A - A. baumannii; B, C, E, G, H, J; M - S.maltophilia; D, F, L, O, P,
R, - P. aeruginosa; I, S, W, V - A. baumannii/haemolyticus; X - A. lwoffii; K, N, Q - E. brevis; i M control
negativ.

1 2 3 4 5 6

7 8 9 10 11 12 13 14 15 16 17 18 19 M

501bp

Fig. 64. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-23like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17 - P. aeruginosa; 3, 4, 14,
18, 19 - A. baumannii; M control negativ.

- 108 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 43 45 AT M

501bp

Fig. 65. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-23like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 20,21, 22, 23, 26, 30, 31, 36, 37, 41, 43, 45 - P. aeruginosa; 24, 25, 27,
28, 29, 32, 33, 34, 35, 38, 39, 40, 42 A . baumannii; M control negativ.

L 46 47 48 49 50 51 52 53 54 55 56 57 58 59

501bp

Fig. 66. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-23like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 46, 47, 48, 49, 53, 54, 57, 58, 59 - P. aeruginosa; 50, 51, 52, 55, 56 - A.
baumannii.

- 109 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

BLSE de tipul blaOXA-50like au fost detectate la aproximativ 80% dintre tulpinile de P.


aeruginosa analizate (fig. 67 i 68). Enzimele de tip OXA-50 i PoxB aparin cluster-ului 6 de
oxacilinaze (Walther-Rasmussen i Hoiby, 2006) i prezint localizare cromosomal.
L 1 2 3 4

5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 M

869
bp

Fig. 67. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-50 like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 20, 21, 22, 23 - P.
aeruginosa; 3, 4, 14, 18, 19, 24, 25 - A. baumannii; M control negativ.

L 57 58 59 60

869bp

Fig. 68. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-50like: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 46, 47, 48, 49, 53, 54, 57, 58, 59 - P. aeruginosa.

Din electroforegram se observ ampliconul de aproximativ 371 bp, ceea ce confirm


prezena unei -lactamaze de tip blaGESlike la doar dou tulpini de P. aeruginosa din SCF (fig. 69)
n timp ce la INBCV gena a fost detectat la 26 de tulpini de P. aeruginosa (fig. 70 i 71).
- 110 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Gena blaGESlike (Guyana Extended Spectrum -lactamase) a fost iniial identificat la o


tulpin de K. pneumoniae (blaGES-1) din Guyana Francez (Poirel i colab., 2000). Enzimele de
tipul GES-1 similar celorlalte -lactamaze de spectru extins (clasa A, Ambler) nu hidrolizeaz
monobactamii i sunt inhibate de acidul clavulanic, piperacilin -tazobactam i imipenem (Poirel
i colab., 2000). Pn n prezent au fost identificate 20 de variante genice blaGESlike (Poirel i
colab., 2012). -lactamaza GES-1 a fost identificat i n Argentina, Brazilia, Portugalia la
izolate clinice de K. pneumonia i P. aeruginosa (Naas i colab., 2008), GES-2 a fost identificat
la izolate clinice de P. aeruginosa din Afica de Sud; GES-5, GES-6, GES-7, GES-8, la izolate de
P. aeruginosa din Grecia; GES-3, GES-4, n Japonia; GES-5 n Corea, China i Brazilia (Naas i
colab., 2008). -lactamaze de spectru extins GES-11 i GES-14 au fost identificate i la A.
baumannii, ambele gene fiind detectate la nivelul casetelor genice din clasa 1 de integroni
(Bonnin i colab., 2011).
L

A B

C D E

F G H

371 bp

Fig. 69. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaGES like: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas), A- A. baumannii; B, C, E, G, H - S. maltophilia; D, F - P. aeruginosa.

L 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 M
L 49 50 51 53 54 57 58 59 60 AT M

371 bp

Fig. 70. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaGESlike: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 20, 21, 22, 23, 49, 53, 54,
57, 58, 59 - P. aeruginosa; 3, 4, 14, 18, 19, 24, 50, 51, 60 - A. baumannii; AT- P. aeruginosa - 27853; M control
negativ.

- 111 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 47 48 AT M

371 bp

Fig. 71. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaGES like: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 26, 30, 31, 36, 37, 41, 43, 45, 46, 47, 48 - P. aeruginosa; 25, 27, 28, 29, 32, 33, 34,
35, 38, 39, 40, 42 - A.baumannii; AT - P. aeruginosa - 27853; M - control negativ.

Din electroforegram se observ ampliconul de aproximativ 925 bp, ceea ce confirm


prezena unei -lactamaze de tip blaPERlike la doar doua tulpini de A. baumannii din SCF(fig. 72).
Gena blaPERlike (P. aeruginosa extended resistance) a fost iniial descris la izolate clinice
de P. aeruginosa n Turcia la un pacient spitalizat anterior n Frana (Nordmann i colab., 1993).
n prezent au fost descrise apte variante ale genei blaPERlike ce pot fi grupate n dou subgrupuri
(Poirel i colab., 2012), primul grup include variantele genice blaPER-1, blaPER-3, blaPER-4, blaPER-5
i blaPER-7, n timp ce al II-lea grup include variantele genice blaPER-2 i blaPER-6 care difer cu
doar 22 de aminoacizi de celelalte variante genice din primul grup i prezint 85% omologie cu
blaPER-1 (Bonnin i colab., 2011). Izolate clinice de P. aeruginosa i A. baumannii blaPER-1 au fost
semnalate n Frana, Grecia, Japonia, Rusia i mai recent n Romnia (Poirel i colab., 2012).

- 112 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 AT M

925bp

Fig. 72. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaPERlike: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 20, 21, 22, 23 - P. aeruginosa; 3, 4, 14,
18, 19, 24, 25 - A. baumannii; AT - P. aeruginosa 27853; M control negativ.

Din electroforegram se observ ampliconul de aproximativ 861 bp, ceea ce confirm


prezena unei -lactamaze de tip blaTEMlike la tulpini de P. aeruginosa i A. baumannii exclusiv
din Institutul de Boli Cardiovasculare Prof. ,,C.C. Iliescu (fig. 73).
n prezent se cunosc 196 variante ale genei blaTEMlike (Poirel i colab., 2012), majoritatea
fiind determinante de fenotipuri BLSE (http://www.lahey.org./studies) i clasificate n patru
grupe dup caracteristicile biochimice (Poirel i colab., 2012): -lactamaze de spectru larg (ex.
TEM-1) ce hidrolizeaz penicilinele i cefalosporinele de prim generaie; -lactamaze TEM
rezistente la inhibitori (prezint spectru similar de hidroliz cu prima categorie ns nu sunt
inhibate de acidul clavulanic, (Salverda i colab., 2010); BLSE TEM ce hidrolizeaz penicilinele,
cefalosporinele inclusiv ceftazidimul i cefoxitimul (Robin i colab., 2007); -lactamaze TEM de
spectru extins ce hidrolizeaz cefalosporinele i inhibitorii (Partridge, 2011). ); -lactamaza
TEM a fost identificat n structura transpozonului Tn3like la o tulpin de P. aeruginosa izolat n
Frana, cu varianta blaTEM-21 (Dubois i colab., 2002 a,b).

- 113 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 AT M
MM

861bp

Fig. 73. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaTEM like: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 15, 16, 17, 20, 21, 22, 23, 26, 30, 31, 36, 37 - P. aeruginosa; 18, 19, 24, 25, 27, 28,
29, 32, 33, 34, 35, 38, 39 - A. baumannii; AT - P. aeruginosa 27853; M - control negativ.

BLSE blaCTX-Mlike au fost destul de puin detectate la BGNNF analizate n cele dou
uniti spitaliceti din Bucureti: 6,66% din P. aeruginosa i 8,88% din A. baumannii exclusiv n
prima unitate spitaliceasc (fig. 74).
Beta-lactamaza blaCTX-Mlike a fost descris iniial la o tulpin de E. coli izolat n Munich
(Bauernfeind i colab., 1990). BLSE de tipul blaCTX-Mlike confer rezisten la peniciline,
cefalosporine, inclusiv la ceftazidim i cefotaxim (Bonnet, 2004). n prezent se cunosc 291
variante blaCTX-Mlike grupate n 5 clustere (http://www.lahey.org./studies): cluster-ul CTX-M-1 ce
include -lactamazele cu impact clinic major ca de exemplu CTX-M-15, CTX-M-3 si CTX-M-1,
dar i CTX-M-10/12/22/23/28/30/32/34/36/37/42/52/54/57/58/60/61 (Rossolini i colab., 2008),
cluster larg rspndit n Europa, Asia i America de Nord (Livermore i colab., 2007; Bush,
2008); cluster-ul CTX-M-2 include variantele CTX-M-8/40/63; cluster-ul CTX-M-9; cluster-ul
CTX-M-25 cu variantele sale (Rossolini i colab., 2008).
Originea blaCTX-Mlike este reprezentat de diferite specii de Kluyvera: K. georgiana a fost
considerata progenitorul blaCTX-M-8 i blaCTX-M-9, iar K. ascorbata i K. cryocrescens sunt
considerati progenitorii blaCTX-M-1 i blaCTX-M-2 (Bonnet, 2004). n ciuda faptului c -lactamazele
blaCTX-Mlike au fost destul de rar identificate la BGNNF, a fost semnalat un izolat clinic de A.
baumannii blaCTX-M-2 n Japonia (Nagano i colab., 2004); i alte dou izolate clinice de A.
baumannii blaCTX-M-43 i blaCTX-M-2 n Bolivia i Pensilvania (Celenza i colab., 2006; AdamsHaduch i colab., 2008).
- 114 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L A B C D E F G H I J K L M N O P R Q S W X V AT M

544b
p

Fig. 74. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaCTX-Mlike: L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas), A - A. baumannii; B, C, E, G, H, J; M - S. maltophilia; D, F, L, O, P,
R, - P. aeruginosa; I, S, W, V - A. baumannii/haemolyticus; X - A. lwoffii; K, N, Q - E. brevis; i M control
negativ.

BLSE blaOXA-10 a fost detectat la aprox. 27% dintre tulpinile de P. aeruginosa luate n
studiu exclusiv din cea de-a doua unitate spitaliceasc (fig. 75).
L A B C D E F G H I J K L M N O P R Q S W X V AT M

759bp

Fig. 75. Electroforegrama ampliconilor obtinui prin PCR pentru gena blaOXA-10like : L- Marker de greutate
molecular GeneRuler 1400 bp (Fermentas), A - A. baumannii; B, C, E, G, H, J; M - S. maltophilia; D, F, L, O, P,
R, - P. aeruginosa; I, S, W, V - A. baumannii/haemolyticus; X - A. lwoffii; K, N, Q - E. brevis; i M control
negativ.

- 115 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Rezistena la aminoglicozide a fost investigat prin gena aac3Ia, aceasta fiind prezent la
75% din tulpinile de A. baumannii/haemolyticus din SCF; 18,5% din tulpinile de A. baumannii
din Spitalul Clinic Fundeni i 9,25% din tulpi nile de A. baumannii din INBCV Prof. C.C. Iliescu;
13,33% din tulpinile de P. aeruginosa din prima unitate spitaliceasc i 8,88% din tulpinile de P.
aeruginosa din cea de-a doua unitate spitaliceasc (fig. 54, 76, 77, 78).
Bacteriile rezistente la aminoglicozode dobndesc determinani de rezisten ce codifica
pentru enzimele care modific aminoglicozidele sau devin rezistente prin muta ii care determin
reducerea acumulrii de aminoglicozide n celule bacteriene (Hancock, 1998). Cele mai
rspndite enzime care modific aminoglicozidele la izolatele clinice de P. aeruginosa sunt
reprezentate de: AAC(6')-II-acetil-transferaz ce determin rezisten la gentamicin,
tobramicin i netilmicin, AAC(3)-I ce confer rezistenta la gentamicin, AAC(3)-II- confer
rezisten la gentamicin, tobramicin i netilmicin i AAC(6 ')-I care determin rezisten la
tobramicin, netilmicin i amikacin precum i adenilil-transferaza ANT(2 ')-I care confer
rezisten la gentamicin i tobramicin (Rossolini; Mantengoli, 2005)
L 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 AT M

484 bp

Fig. 76. Electroforegrama ampliconilor obtinui prin PCR pentru gena aac3Ia: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 1, 2, 5, 6, 7, 8, 9, 10, 11, 12, 13, 15, 16, 17, 20, 21, 22, 23 - P. aeruginosa; 3, 4, 14,
18, 19 - A. baumannii; AT - P. aeruginosa 27853; M control negativ.

- 116 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

L 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 47 48 49 50 51 AT M

484 bp

Fig. 77. Electroforegrama ampliconilor obtinui prin PCR pentru gena aac3Ia: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 26, 30, 31, 36, 37, 41, 43, 45, 46, 47, 48, 49 - P. aeruginosa; 24, 25 , 27, 28, 29,
32, 33, 34, 35, 38, 39, 40, 42, 50, 51 - A. baumannii; AT - P. aeruginosa - 27853; M - control negativ.

L 53 54 57 58 59 60 AT M

484 bp

Fig. 78. Electroforegrama ampliconilor obtinui prin PCR pentru gena aac3Ia: L- Marker de greutate molecular
GeneRuler 1400 bp (Fermentas); 53, 54, 57, 58, 59 - P. aeruginosa; 60 - A. baumannii; AT - P. aeruginosa 27853;
M - control negativ.

2. SUPORTUL GENETIC AL GENELOR PENTRU MBL I CHLD


n cadrul Proiectului Bilateral Romania-China au fost secveniate 4 tulpini P. aeruginosa
blaVIMlike i 10 tulpini de A. baumannii blaOXA-23like, secvenele ampliconilor obtinui n reac iile
PCR fiind reprezentate n anexa nr.2.

- 117 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Prezena integronilor de clas 1 a fost confirmat la toate cele patru izolate de P.


aeruginosa productoare de MBL precum i la o tulpin de A. baumannii blaOXA-23like. Reaciile
cu primerii pentru regiunile conservate ale integronilor de clas 1 i primerii pentru genele
blaVIMlike au evideniat c nu to i integronii detectati poseda genele pentru MBL, fiind identificat
o singur tulpin de P. aeruginosa blaVIM-4. Tulpina P. aeruginosa nr.15 conine un integron de
clas 1 de 1,7kb, cu dou casete genice, blaVIM-4 urmat de aadb (fig. 79), (nr. acces din
GenBank- FM179467.1)
5CS

blaVIM-4

aadb

3CS

Fig. 79. Structura integronului de clas 1 din tulpina de P. aeruginosa nr.15.

Studiul prezent reprezint prima descriere a genei blaVIM-4 la izolate clinice de P.


aeruginosa din Romnia (Gheorghe i colab., 2014a). Pn n prezent, n Romania a fost
raportat doar metalo--lactamaza VIM-2 la tulpini de A. baumannii izolate de la pacieni ai
Institutului de Cardiologie din Bucureti, n perioada 2003-2006 (Cernat i colab., 2007); P.
aeruginosa provenite de la pacieni din spitale din Bucureti (Stru i colab., 2010);

P.

aeruginosa izolate clinice de la pacieni din cinci spitale din Iai n perioada 2008-2012 (Mereu
i colab., 2013). Rezistena la aminoglicozide a fost reprezentat n structura acestui integron
prin caseta genic aadb (adeniltransferaz) ce confer rezisten la streptomicin (Partridge i
colab., 2009).
Integroni de clas 1, de 1,5 kb au fost detectai la tulpinile de P.aeruginosa nr.10,12 i
17, care nu produc MBL (fig. 80) ci adpostesc CHLD (blaOXA-31), urmat de o caset genic ce
conine adeniltransferaz (aadA2a) ce confer rezisten la streptomicin (nr. acces din
GenBank- AF294653.1).
5CS

blaOXA-31

aadA2a

3CS

Fig. 80. Structura integronilor de clas 1 din tulpinile de P. aeruginosa nr.10, 12 i 17.

Un integron de clas 1 de 1,4kb a fost detectat i la tulpina A de A. baumannii luat n


studiu, care poart -lactamaza de clasa D blaOXA-20 n cea de-a III-a caset genic, n timp ce
prima caset genic conine acetiltransferaza aacA4, ce confer rezistena la amikacin (Partridge
i colab., 2009); iar cea de-a doua caset genica contine o secven cadru de citire (ORF=open
- 118 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

reading frameshift), (fig. 81). Prezena integronilor ce conin casetele genice aacA4orfOOXA20 pot reprezenta un indicativ al prezenei unei tulpini epidemice, ce aparine Complexului
Clonal 92 (Clona European II), ns acest supoziie necesit confirmri ulterioare (Post i
colab., 2010).
5CS

aacA4

orfO

blaOXA-20

Fig. 81. Structura integronului de clas 1 din tulpina de A. baumannii nr. A

Secvenierea ampliconilor blaOXA-23like la cele 10 tulpini de A. baumannii luate n studiu,


au condus la urmtoarele rezultate, prezentate n tabelul 18, secvenele fiind prezente n anexa 2.
Analiza secvenelor a demonstrat c toate cele 10 tulpini de A. baumannii prezint gena
blaOXA-23 (GQ861438.1).
Tabelul 18. Tulpinile de A. baumannii utilizate n studiu codificarea, sursele de izolare ale acestora i -lactamaza
identificat n urma analizei secven elor

Codul de
laborator al
tulpinii de A.
baumannii
352

19

26

Secreie traheal

blaOXA-23

GQ861438.1

27

340

exsudat traheal

blaOXA-23

GQ861438.1

34

293 I

Secreie traheal

blaOXA-23

GQ861438.1

35

293 II

Seccreie traheal

blaOXA-23

GQ861438.1

38

373

Sectreie cateter

blaOXA-23

GQ861438.1

39

342

Secreie traheal

blaOXA-23

GQ861438.1

1447

urocultur

blaOXA-23

GQ861438.1

225

necunoscut

blaOXA-23

GQ861438.1

10

383

necunoscut

blaOXA-23

GQ861438.1

Nr.
crt.

Codificarea utilizat
n cursul
experimentelor

Sursa de izolare

CHLD

Nr. acces
din
GenBank

exsudat nazal

blaOXA-23

GQ861438.1

- 119 -

3CS

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

CONCLUZII
1. Screening-ul genotipic al rezistenei la carbapeneme a demonstrat prezena genelor blaVIMlike la
53,33% din tulpinile de P. aeruginosa, blaSPMlike a fost detectat la 6,66% din tulpinile de P.
aeruginosa i a -lactamazelor de tip OXA (blaOXA50like la 80% din tulpinile de P. aeruginosa,
blaOXA10like la 26,66% din tulpinile de P. aeruginosa, blaOXA60like la 8,88% din tulpinile de P.
aeruginosa, blaOXA55like la 6,66% din tulpinile de P. aeruginosa).
2. Genele de tip blaOXA23like aparinnd -lactamazelor din clasa D au fost detectate la 75,92%
din tulpinile de A. baumanii i A. baumannii/haemolyticus.
3. Rezistena me diat de -lactamazele de spectru extins a fost detectat exclusiv la tulpinile
izolate n INBCV Prof. C.C. Iliescu, fiind identificate n ordine descresctoare: blaGESlike la
66,6% din tulpinile de P. aeruginosa, blaTEMlike la 33,3% din tulpinile de A. baumannii i 13,3%
din tulpinile de P. aeruginosa, blaCTX-Mlike la 8,88% din tulpinile de A. baumannii i 6,66% din
tulpinile de P. aeruginosa, i blaPERlike identificate numai la 5,55% din tulpinile de A. baumannii.
4. Rezistena la aminoglicozide media t de gena aac3Ia a fost prezent la 75% din tulpinile de A.
baumannii/haemolyticus din Spitalul Clinic Fundeni; 18,5% din tulpinile de A. baumannii i
13,33% din tulpinile de P. aeruginosa din Spitalul Clinic Fundeni i 9,25% din tulpinile de A.
baumannii, respectiv 8,88% din tulpinile de P. aeruginosa din INBCV Prof. C.C. Iliescu.
5. Prezentul studiu raporteaz pentru prima dat prezena genei blaVIM-4 la tulpini de P.
aeruginosa din Romnia gena fiind identificat n structura integronilor din clasa 1 i asociat cu
rezistena la aminoglicozide (streptomicin).

- 120 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Obiectivul 3
CARACTERIZAREA GENETIC A TULPINILOR DE PSEUDOMONAS AERUGINOSA
BLAVIM -2 I ACINETOBACTER BAUMANNII BLAOXA-23 REZISTENTE LA
CARBAPENEME CIRCULANTE N ROMNIA
P. aeruginosa i A. baumannii sunt recunoscui ca patogeni oportuniti a cror inciden
este ntr-o permenent cretere mai ales n unitile de terapie intensiv, frecvent asociate cu
eecuri terapeutice determinate de fenotipuri de multirezisten. La aceste

dou genuri,

rezistena la carbapeneme este de cele mai multe ori determinat de producerea de -lactamaze,
metalo--lactamaze la P. aeruginosa i -lactamaze din clasa D (de tip OXA) la A. baumannii
(Post i colab., 2010).
Enzimele din familiile VIM, IMP i mai recent NDM reprezint cele mai rspndite MBL
raportate la nivel global la izolate clinice de P. aeruginosa (Castanheira i colab., 2014). Pn n
prezent au fost descrise 33 de variante de -lactamaze din familia VIM, identificate n cea mai
mare parte la izolate clinice de P. aeruginosa (Bonnin i colab., 2013 ) i asociate casetelor
genice ale clasei 1 de integroni. -lactamaza VIM-2, endemic n anumite ari europene i
mediteraneene este localizat la nivelul casetelor genice ale integronilor de clas 1 i/sau Tn402like (Castanheira si colab., 2014).
La nivel european, metalo--lactamazele din familia VIM au fost semnalate n Frana
(VIM-2) n 1996 la izolate clinice de P. aeruginosa (Poirel i colab., 2000), Polonia, Bulgaria,
Ungaria [VIM-2 la tulpini de P. aeruginosa (Walsh i colab., 2005)]; Austria [VIM-2 la tulpini
clinice de P. aeruginosa (Duljasz i colab., 2009); Serbia, Croaia (Cornaglia i colab., 2011);
Ungaria [VIM-4 (Libisch i colab., 2005); Portugalia [VIM-2 la tulpini de P. aeruginosa
(Quinteira; Peixe, 2006)]; Spania [VIM-2 la izolate clinice de P. aeruginosa (Pena i colab.,
2007)], Belgia (Deplano i colab., 2007) Germania [VIM-1,2,15,16 (Schneider i colab., 2008)];
Grecia, Suedia [VIM-4 la izolate clinice de P. aeruginosa i Enterobacteriaceae (Cornaglia i
colab., 2011)], Norvegia si Suedia [VIM-2 si VIM-4 (Samuelson i colab., 2010 )]; Italia
(Mazzariol i colab., 2010), Turcia cu varianta VIM-5 la izolate clinice de

- 121 -

Klebsiella

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

pneumoniae (Midilli i colab., 2003), urmate de VIM -1 i VIM -2 la izolate clinice de P.


aeruginosa (Poirel i colab., 2000).
Prezena pe plan internaional a complexului clonal CC235 la P. aeruginosa, situat pe
diverse elemente genetice mobile (plasmide, transpozoni, integroni), sugereaz rspndirea
global a acestei clone, combinat cu variabilitatea local, rezultat prin dobndirea de
determinani MDR (Hamidian i colab., 2011). Capacitatea P. aeruginosa CC235 de a dobndi
multipli determinani de rezisten poate fi ilustrat prin diversitatea mare de -lactamaze
asociate acestui complex clonal (Bonin i colab., 2011).
La A. baumannii CHLD au distribuie global (Xiaohui si colab., 2013). Pn n prezent
au fost descrise patru grupe de CHLD dobndite la A. baumannii, denumite OXA-23, OXA-24/40, OXA-58 i OXA-143 (Walsh i colab., 2005), constatndu-se diferene n ceea ce privete
distribuia lor n Europa (Karah i colab., 2011). Tulpini de A. baumannii productoare de
blaOXA-23 au fost semnalate n Bulgaria (Woodford i colab., 2011), Republica Ceh, Romnia
(Bonin i colab., 2011), Grecia, Franta, Italia (Xiaohui i colab., 2013). Aceste

enzime,

contribuie n prezent, la rezistena la carbapeneme la A. baumannii n ri ca Marea Britanie,


Frana, Grecia, Singapore, Corea i Italia ( Xiaohui i colab., 2013). Tulpini epidemice
productoare de blaOXA23 au fost atribuite complexului clonal CC92, blaOXA23 fiind localizat att
la nivel cromosomal, ct i pe diferite tipuri plasmidiale, i asociate diferitelor structuri genetice,
cele mai frecvente fiind transpozonii Tn2006 i Tn2008 (Xiaohui i colab., 2013). Aceste date,
sugereaz c, diseminarea blaOXA-23 a fost determinat de selecia unor clone epidemice
productoare de OXA23

i/sau de dobndirea de rezisten la carbapeneme prin transfer

orizontal de gene (Walsh si colab., 2005).


Romnia este una dintre rile europene cu cele mai ridicate procente de multirezisten
(inclusiv rezistena la carbapeneme), la izolate clinice de P. aeruginosa i A. baumannii (Nigro
i colab., 2011). Datele disponibile cu privire la caracterizarea acestor specii sunt destul de
putine i limitate la numai dou regiuni ale rii (nord-est i vest) (Mereu i colab., 2013; Bonin
i colab., 2011).
Scopul acestui studiu a fost caracterizarea complexelor clonale identificate, a tipurilor de
plasmide i a elementelor genetice mobile asociate cu diseminarea clonelor rezistente de P.
aeruginosa blaVIM-2 i A. baumannii blaOXA-23 identificate n dou uniti spitaliceti din
- 122 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Bucureti, n vederea evalurii contextului epidemiolo gic local i elaborrii unor msuri eficiente
de prevenire a diseminrii clonelor rezistente.
MATERIALE I METODE
1.Tulpini bacteriene
Screening-ul fenotipic a cuprins un numr de 204 tulpini de BGNNF din care 84 au fost
rezistente la carbapeneme. A fost selectat un numr de 56 de tulpini izolate de la pacieni
internai la INBCV Prof. C.C. Iliescu i la SCF din Bucureti, n perioada 2012-2013, tulpini
introduse n colecia Laboratorului de Microbiologie al Facultii de Biologie i luate n lucru pe
perioada bursei Erasmus din cadrul Departamentului de Microbiologie al Facultatii de Farmacie
a Universitatii din Porto, Porto (Portugalia).
2. Identificarea tulpinilor bacteriene
S-a realizat prin sistemul automatizat VITEK2 i secventiere rpoB (RNA-polymerase -subunit
encoding gene) n cazul tulpinilor de A. baumannii (Gundi i colab, 2009).
3. Teste biochimice de evideniere a producerii de carbapenemaze
3.1. Testul Blue-Carba- difereniaz tulpinile cu activitate metalo-carbapenemazic de cele cu
activitate non metalo - carbapenemazic prin schimbarea culorii mediului de la verde la galben
datorit variaiei pH -ului mediului de cultur ce conine antibiotic (Pires i colab., 2013).
Materiale necesare:
Tulpina microbian de 24h;
Plci cu 96 godeuri;
Soluie de albastru Brom-timol pH=6;
Soluie de albastru Brom-timol pH=7;
ZnSO4;
Tienam.
Mod de lucru:

Tulpina microbian de 24h se nsmnteaz n 100 l mediu de cultur (ce conine


soluia de albastru Brom-timol pH=6, 60mg Tienam, 10l ZnSO4)

nsmnarea tulpinii microbiene de 24h n 100 l mediu de cultur - Solu ie de


albastru Brom-timol pH=7, utilizat drept control pozitiv;
- 123 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Incubare la 37C, 2h cu agitare uoar;

Citirea rezultatelor - schimbarea culorii mediului de cultur datorit variaiei pH-ului


a mediului de cultur indic hidroliza inelului -lactamic (Pires i colab., 2013).

3.2. Extracia -lactamazelor i analiza spectrofotometric a acestora


3.2.1. Extracia de -lactamaze
Activitatea -lactamazic a fost evaluat pe baza testului de hidroliz a nitrocefinului i
prin analizele spectrofotometrice utiliznd extracte brute de -lactamaze tratate cu diferite
concentraii de imipenem (Bernabeu i colab., 2012) .
Materiale necesare:
Tulpina microbian de 24h;
Mediu de cultura TSB+ IPM;
Centrifug cu rcire;
A.F.S. (ap fiziologic steril);
Ap ultrapur;
Nitrocefin.
Mod de lucru:

Tulpina microbian de 24h se inoculeaz n 50ml TSB+IPM 2g/ml;

Incubare la 37C, 2h ;

Centrifugare la 3000 r.p.m., 4C, 10 minute;

Descrcare supernatant;

Adugare 10ml soluie A.F.S n fiecare tub i resuspendare sediment;

Centrifugare 3000 r.p.m., 4C, 10 minute i descrcare supernatant;

Adaugare 500l ap ultrapur i resuspendare sediment;

Transferul extractelor n tuburi Eppendorf de 1,5ml;

Congelarea extractului;

Decongelarea extractului prin submersie pe baia de ap pentru 1minut;

Repetarea ultimelor 2 etape pn la obinerea unui rezultat pozitiv la testul


nitrocefinului.

3.2.2. Testul de hidroliz a nitrocefinului:

- 124 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Se pun n contact 3l soluie nitrocefin cu 3l extract brut (dup ce n prealabil a


fost centrifugat) din tulpina testat;
Se amestec cu pipeta prin aspirare;
Schimbarea culorii de la rou la galben indic rezultatul pozitiv, respectiv
prezena -lactamazelor (Bernabeu i colab., 2012) .
3.2.3. Analizele spectrofotometrice
Analizele spectrofotometrice au fost efectuate la spectrofotometrul UV 1700 PharmaSpec
Shimadzu utilizand 10l extract brut, 10l IPM, 980 l ap ultrapur. Activitatea -lactamazic
a fost evaluat masurnd absorbana imipenemului la 390nm, 1min la 28C. Rezultatele pozitive
au fost date de scderea absorbanei IPM la 390nm , ce indic hidroliza inelului -lactamic
(Bernabeu i colab., 2012).
4. Investigarea genelor de rezisten la MBL i CHLD la tulpini de BGNNF, analiza
coninutului plasmidial i studiul suportului genetic al integronilor de clas 1 i al
transpozonilor prin PCR Mapping i secveniere.
Obinerea ADN bacterian pentru screening-ul genelor s-a realizat utiliznd metoda de
extracie alcalin a ADN. Pentru aceasta, 1-5 colonii din culturile bacteriene au fost suspendate
n 20 l soluie NaOH + SDS. n etapa urmtoare s-a realizat amplificarea la 95C 5 min, urmat
de adugarea a 180 l solutie tampon TE1x n fiecare tub Eppendorf, centrifugare 3min. la
13000 r.p.m. i pstrare la -4C. n urma identificrii preliminare a unor gene de rezisten la
carbapeneme, CHLD i -lactamaze de spectru extins (BLSE), obinute cu ajutorul testelor
anterioare, s-a realizat verificarea existenei ctorva gene frecvent asociate cu producerea de
BLSE, n cadrul laboratorului de microbiologie al Faculttii de Farmacie din cadrul Universit ii
din Porto, Porto (Portugalia) utiliznd urmtoarele mix-uri de reacie - GoTaq Green Master
Mix (Promega, USA); HotStarTaq Master Mix Kit (Quiagen, USA) i TaKaRa [Premix Taq
DNA Polymerase (TaKaRa Taq, Takara Bio Inc, Japonia)].Verificarea produsului obinut s-a
realizat prin electroforez n gel de agaroz 1,5% i 2%, 45min la 90V, colorat cu bromur de
etidiu 3,5g/ml.
Programul de amplificare s-a realizat conform urmtoarelor condiii:

- 125 -

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

MULTIPLEX PCR CARBA: blaVIMlike, blaIMPlike, blaNDMlike, blaKPClike, blaOXA-48like;


MULTIPLEX PCR Minor ESBL: blaBELlike, blaGESlike, blaPERlike i blaVEBlike:
95C 15 min
94C 30s
57C 90s
72C 90s
72C 10 min.

30 cicluri

MULTIPLEX PCR OXA-CARBA: blaOXA-23like, blaOXA-24like; blaOXA-51like, blaOXA-58like:


94C 5 min
94C 25s
52C 40s
30 cicluri
72C 50s
72C 6 min.
MULTIPLEX PCR blaSPMlike, blaGIMlike, blaSIMlike:
94C 5 min
94C 30s
52C 40s
36 cicluri
72C 50s
72C 5 min.

blaPER-1
94C 10 min
94C 1min
50C 1min
72C 1min
72C 7 min.
blaPER-2
94C 10 min
94C 1min
52C 1min
72C 1,5min
72C 7 min.

blaVIM (CDS)
94C 2 min
94C 1min
55C 1min

32 cicluri

72C 3min
72C 7 min.
30 cicluri

INT1Fw-INT1Rv
94C 2 min
94C 30s
69C 30s
72C 1min
72C 8 min.

35 cicluri
- 126 -

30 cicluri

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

INT1Rv-VIM2like Rv
94C 10 min
94C 1min
62C 1min
72C 1,5min
72C 10 min.

VIM2like Fw/qacER
94C 10 min
94C 1min
58C 1min
72C 2min
72C 10 min.
INT1Rv-VEBRv
94C 10 min
94C 1min
58C 1min
72C 1,5min
72C 10 min.

58C 1min
72C 2min
72C 10 min.

35 cicluri

35 cicluri

GR.1-GR.19-identificarea grupurilor
de replicaze la A. baumannii
94C 7 min
95C 30s
52C 30s
72C 1,5min
72C 5min.

35 cicluri

30 cicluri

ISAba1Rv-OXA-23Rv
ISAba1Fw-OXA-23Fw
95C 5 min
95C 45s
54C 45s
72C 3min
72C 5min.

35 cicluri

36 cicluri

CLASA 1 Integroni (5CS-3CS)


94C 10 min
94C 1min
Tabelul 19. Secvena primerilor i dimensiunea ampliconilor ob inui n experimentele de multiplex i
simplex PCR

127

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
Gena
blaOXA-23group
bla OXA-24/40group
blaOXA-58group
blaOXA-51group
blaIMP
blaVIM
blaNDM
blaKPC
blaOXA-48
blaPER
blaGES
blaBEL
blaVEB

Primeri

Secvena primerilor

Nr. bp

Referina

501

Bogaerts i colab.,

OXA-23-F

5'-CCCCGAGTCAGATTGTTCAAGG-3'

OXA-23-R

5'-TACGTCGCGCAAGTTCCTGA-3'

OXA-24/40-F
OXA-24/40-R

5 GCAGAAAGAAGTAAARCGGGT3

OXA-58-F

5 GGGGCTTGTGCTGAGCATAGT 3

OXA-58-R

5 CCACTTGCCCATCTGCCTTT 3

OXA-51-F

5-TAATGCTTTGATCGGCCTTG-3

OXA-51-R

5-TGGATTGCACTTCATCTTGG-3

IMP-F

5ACAYGGYTTRGTDGTKCTTG 3

IMP-R

5GGTTTAAYAAARCAACCACC 3

VIM-F

5 TGTCCGTGATGGTGATGAGT 3

VIM-R

5 ATTCAGCCAGATCGGCATC 3

NDM-F

5ACTTGGCCTTGCTGTCCTT 3

NDM-R

5CATTAGCCGCTGCATTGAT 3

KPC-F

5TCGCCGTCTAGTTCTGCTGTCTTG 3

KPC-R

5ACAGCTCCGCCACCGTCAT 3

OXA-48-F

5ATGCGTGTATTAGCCTTATCG 3

OXA-48-R

5CATCCTTAACCACGCCCAAATC 3

PER-F

5AGTGTGGGGGCCTGAACGAT 3

PER-R

5GCAACCTGCGCAATRATAGCTT 3

GES-F

5CTGGCAGGGATGGCTCACTC 3

GES-R

5TTCCGATCAGCCACCTCTCA 3

BEL-F

5CGACAATGCCGCAGCTAACC3

BEL-R

5CAGAAGCAATTAATAACGCCC3

VEB-F

5CGACTTCCATTTCCCGATGC3
5TGTTGGGGTTGCCCAATTTT3

TEM-F
TEM-R
CTX-M-F
CTX-M-R
SPM-F

5'-ATGAGTTTTCAACATTTTCG-3'
5'-TTACCAATGCTTAATCAGTG-3'
5-CGCTGTTGTTAGGAAGTGTG-3
5-GGCTGGGTGAAGTAAGTGAC-3
5AAAATCTGGGTACGCAAACG 3

SPM-R

5ACATTATCCGCTGGAACAGG 3

Gr1

gr1-F

5 -CATAGAAATACAGCCTATAAAG-3

(p1ABSDF001)

gr1-R

5 -TTCTTCTAGCTCTACCAAAAT-3

GR2

gr2-F

5 -AGTAGAACAACGTTTAATTTTATTGGC-3

(Aci1/Aci2)

gr2-R

5 -CCACTTTTTTTAGGTATGGGTATAG-3

blaCTX-M
blaSPM

270

5 CCAACCWGTCAACCAACCTA3

VEB-R
blaTEM

2013

GR3

gr3-F

5-TAATTAATGCCAGTTATAACCTTG-3

(Aci3/Aci7)

gr3-R

5 -GTATCGAGTACACCTATTTTTTGT-3

GR4

gr4-F

5-GTCCATGCTGAGAGCTATGT-3

(Aci4)

gr4-R

5-TACGTCCCTTTTTATGTTGC-3

GR5
(Aci5)

gr5-F
gr5-R

5-AGAATGGGGAACTTTAAAGA-3
5-GACGCTGGGCATCTGTTAAC-3

600
353

Woodford i
colab., 2006

232
390
621
798
699
700
371
450
390
861
730
271

Eftekar i colab.,
2005
Israil i colab.,
2013
Poirel i colab.,
2011

330

Bertini i colab.,
2010

851
505
Bertini i colab.,
2010

128

508

Continuare pag.
129

220

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GR6
(Aci6)

gr6-F
gr6-R

5-AGCAAGTACGTGGGACTAAT-3
5 - AAGCAATGAAACAGGCTAAT-3

662

GR7
(p3ABSDF002)
GR8

gr7-F
gr7-R
gr8-F

5-GAACAGTTTAGTTGTGAAAG-3
5-TCTCTAAATTTTTCAGGCTC-3
5-AATTAATCGTAAAGGATAATGC-3

885

[Aci8, repM (Aci9)]

gr8-R

5 -GACATAGCGATCAAATAAGC-3

GR9

gr9-F

5-GCAAGTTATACATTAAGCCT-3

(p3ABSDF0009)

gr9-R

5-AAAAATAAACGCTCTGATGC-3

GR10

gr10-F

5-TTTCACTAGCTACCAACTAA-3

(AciX)

gr10-R

5 -ACACGTTGGTTTGGAGTC-3

GR11

gr11-F

5-GGCTATTCAAAACAAAGTTAC-3

(p1ABAYE0001 )

gr11-R

5-GTTTCCTCTCTTACACTTTT-3

GR12

gr12-F

5-TCATTGGTATTCGTTTTTCAAAACC-3

(p2ABSDF0001)

gr12-R

5 -ATTTCACGCTTACCTATTTGTC-3

GR13

gr13-F

5-CAAGATCGTGAAATTACAGA-3

(p3ABAYE0002 )

gr13-R

5-CTGTTTATAATTTGGGTCGT-3

GR14

gr14-F

5-TTAAATGGGTGCGGTAATTT-3

(p4ABAYE0001)

gr14-R

5-GCTTACCTTTCAAAACTTTG-3

GR15

gr15-F

5-GGAAATAAAAATGATGAGTCC-3

(p3ABSDF0018)

gr15-R

5-ATAAGTTGTTTTTGTTGTATTCG-3'

GR16

gr16-F

5-CTCGAGTTCAGGCTATTTTT-3

(repApAB49)

gr16-R

5-GCCATTTCGAAGATCTAAAC-3

GR17

gr17-F

5-AATAACACTTATAATCCTTGTA-3

(A1s_3471)

gr17-R

5-GCAAATGTGACCTCTAATATA-3

GR18

gr18-F

5 -TCGGGTTATCACAATAACAA-3

(p2ABSDF00025)

gr18-R

5-TAGAACATTGGCAATCCATA-3

GR19

gr19-F

5- ACGAGATACAAACATGCTCA-3

(rep135040)

gr19-R

5- AGCTAGACATTTCAGGCATT-3

233
191
371
852
Bertini i colab.,
165

2010

780
622
876
233
380
676
815

Pentru investigarea profilului plasmidial al tulpinilor de A.baumannii productoare de


blaOXA23, a fost utilizat metoda PBRT (Bertini i colab ., 2010; Towner si colab., 2011), metoda
ce presupune amplificarea prin PCR simplex a celor 27 gene ce codific replicazele plasmidiale.
Metoda PBRT grupeaz cele 27 replicaze n 19 grupe notate de la GR1 la GR19 pe baza
omologiei n secvena nucleotidic. Identitatea ampliconi obinui din izolate reprezentative
pentru diferite replicaze a fost confirmat prin secveniere .
Pentru determinarea contextului genetic al genelor codificatoare de carbapenemaze i
CHLD, necesar n studiile de epidemiologie molecular, a fost utilizat metoda PCR-Mapping
(,,cartare prin metoda PCR) ce presupune amplificarea prin PCR i secvenierea regiunilor
adiacente genelor investigate. Primerii utilizati n aceast metod sunt descrii n Tabelul 20.
129

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Ampliconii au fost secveniai de Macrogen (Corea) i Stab Vida (Portugalia) iar


secvenele au fost analizate utiliznd soft-ul ChromasLite 2.1.1 (www.technelysium.com.au).
Tabelul 20. Secvena primerilor utilizai pentru secvenierea produilor PCR
Primer

Secven a primerului (5'-3')

5'CS

GCCTGTTCCGTTCGTAAGCT

3'CS

CGGATGTTGCGATTACTT

VIM-2 like
Fw
VIM-2 like
Rv

ATGTTCAAACTTTTGAGTAAGTTAT

Referina
Acest studiu

Acest studiu

CTACTCAACGACTGAGCGATT

INT1Fw

GCCACTGCGCCGTTACCACC

INT1Rv

GGCCGACGAGATCCTCAACG

ISAba1A

GTCCTTTGCGCTCATCAT

ISAba1B

CATGTAAACCAATGCTCACC

Acest studiu
Acest studiu

Secvenele de primeri construite au fost verificate cu pro gramul Primer-BLAST


(http://www.ncbi.nlm.nih.gov/tools/primer-blast).
CTACCTCTCACTAGTGAGGGGCGGCAGCGCATCAAGCGGTGAGCGCACTCCGGCACCGCCAACTTTCAGCACATGCG

TGTAAATCATCGTCGTAGAGACGTCGGAATGGCCGAGCAGATCCTGCACGGTTCGAATGTCGTAACCGCTGCGGAGC
AAGGCCGTCGCGAACGAGTGGCGGAGGGTGTGCGGTGTGGCGGGCTTCGTGATGCCTGCTTGTTCTACGGCACGTTT
GAAGGCGCGCTGAAAGGTCTGGTCATACATGTGATGGCGACGCACGACACCGCTCCGTGGATCGGTCGAATGCGTGT

GCTGCGCAAAAACCCAGAACCACGGCCAGGAATGCCCGGCGCGCGGATACTTCCGCTCAAGGGCGTCGGGAAGCGCA
ACGCCGCTGCGGCCCTCGGCCTGGTCCTTCAGCCACCATGCCCGTGCACGCGACAGCTGCTCGCGCAGGCTGGGTGC
CAAGCTCTCGGGTAACATCAAGGCCCGATCCTTGGAGCCCTTGCCCTCCCGCACGATGATCGTGCCGTGATCGAAAT
CCAGATCCTTGACCCGCAGTTGCAAACCCTCACTGATCCGCATGCCCGTTCCATACAGAAGCTGGGCGAACAAACGA

TGCTCGCCTTCCAGAAAACCGAGGATGCGAACCACTTCATCCGGGGTCAGCACCACCGGCAAGCGCCGCGACGGCCG
AGGTCTTCCGATCTCCTGAAGCCAGGGCAGATCCGTGCACAGCACCTTGCCGTAGAAGAACAGCAAGGCCGCCAATG
CCTGACGATGCGTGGAGACCGAAACCTTGCGCTCGTTCGCCAGCCAGGACAGAAATGCCTCGACTTCGCTGCTGCCC

AAGGTTGCCGGGTGACGCACACCGTGGAAACGGATGAAGGCACGAACCCAGTTGACATAAGCCTGTTCGGTTCGTAA
ACTGTAATGCAAGTAGCGTATGCGCTCACGCAACTGGTCCAGAACCTTGACCGAACGCAGCGGTGGTAACGGCGCAG
TGGCGGTTTTCATGGCTTGTTATGACTGTTTTTTTGTACAGTCTATGCCTCGGGCATCCAAGCAGCAAGCGCGTTAC

GCCGTGGGTCGATGTTTGATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGG
CACCAATGGATAGTTCGCCGCTCGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAG
CTGTGGCCAGATGGCACATGTCAAGAGCACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGC
TGCTGTCCTCATTGCTGTAGCACCCGACGGAGAAGCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGG

AGTGCTACTCCGGCAACGTTGCGTTCTTGGAGGGTTGGTACGTTGTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTA
GCTCTGGTAAAAGCCGCCGAGCATTGGGCTCGTGGTCGCGGATGCACCGAATTCGCCTCCGACACTCAACTTACCAA
CAGCGCAAGCACCTCGGCGCACCTGGCGGCTGGATTCACGGAGGTTGCTCAAGTACGCTGCTTCCGGAAACCGTTGT

130

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GAGGGGCGCCGCGTTGGTGCCTAACAATTCGTTCAAGCCGAACTTGCTTCGTTACACCAAAGCCATGGCAGAATGAG
CTTGCCATGGCTTTGGCTCCACTACGCAAGTCGGCTTAACTCAGGCGTTATGCCGCACTCACCCCCATGGAGTTTTG
ATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTTTTTC

CGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATG
GTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGT
GATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAAT
TGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGG

CTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATTCCCACGCACTCT
CTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGCATTC
GACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCA

CGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCG
GAAGCACAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAA
AGCGCACACAAATCGCTCAGTCGTTGAGTAG

Schema 1. Secvena corespunzatoare integronului aacA7 -VIM-2like . Secventa primerului IntR este marcata n
negru, font subliniat,linie simpla. Secventa genei aaA7 este reprezentata cu font rosu iar secvena genei blaVIM-2
este reprezentat cu font negru iar a primerului VIM-2likeR subliniat cu linie dubla.
GCGTGCATGGGTAGGATTGGTATTATCAAAATGACCAAAGTGTTGTAATTGCCAAACATCAGCATTAATAAAATTTA
TATCAAGATTTAAACTATTAAATTTTGGAATTATCACATTGTCTATCAGAGTGGATTTACCAGCTCCATTACCACCA

GCAACTATCACTGCATACTTGGTGTCTAGTTCATTTTTTTGTGTCATTTAACTCTGTACACGACAAATTTCACAGAA
CCCTTATCCTATCAGGATTCTGCCTTCTTAAAATTGCCAAAATTTCCTTAAACTCTTCTTTTTTCCCAAAACCAATT

AAACGCTGAATCGCCATTTGAACATAGTCTAAACCATAGCGAAATAAACTCATTGAGAGTCGTCCATGCTTCTTTAT
TTTTATCGCTTTTTTTTGATCATGTTGCCATTCACCCGTTAAGTAACACCAACAGAAGCTTATAGCTAACACCGCAA
TCAATTTTTTCACTCGTCTAGGGTCTGTCAAGCGCGTATTTCCAAGATTAAACCCGCGTCCTTTGAGACAACTGAAT

AAGGTTTCAATTTCCCAGCGTAATGCATAATCCTGAATAGCATTGGCATTAAACTGAGGAGAAACGACGAGTAAAAG
CTCTCCATTTTCTAACTGTAGTGCACTTATATATAGTTTCACCCGACCAACCAAAATCCGTCGTTTACGACATTCAA
TTTGACCAACTTTAAGATGGCGAAATAAATCACTAATTTTATGATTCTTTCCTAAATGATTGGTGACAATGAAGTTT

TTTTAACACGAATGCAGAAGTTGATGTCTTGTTCAATTAACCATGTAAACCACTGCTCACCGATAAACTCTCTGTCT
GCGAACACATTCACAATACGGTCTTTACCAAAAATGGCTATAAAGCGTTGAATCAAAGCAATGCGCTCTTTCGTATC
TGAATTTCCACGTTTATTAAGCAATGTCCAAAGGATAGGTATCGCTATTCCACGATAAACGATTGCGAGCATCAGGA
TATTAATATTTCGTTTTCCCCATTTCCAATTGGTTCTATCTAAAGTCAGTTGCACTTGGTCGAATGAAAACATATTG

AAAATCAACTGAGAAATTTGACGATAATCAAAATACTGACCTGCAAAGAAGCGCTGCATACGTCGATAAAATGATTG
TGGTAAGCACTTGATGGGCAAGGCTTTAGATGCAGAAGAAAGATTACATGTTTGCTTTAAAATAATCACAAGCATGA
TGAGCGCAAAGCACTTTAAATGTGACTTGTTCCATTTTAGAGATTTGTTTAAGATAAGATATAACTCATTGAGATGT

GTCATAGTATTCGTCGTTAGAAAACAATTATTATGACATTATTTCAATGAGTTATCTATTTTTGTCGTGTACAGAGC

TCTTTTTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTTACTTGCTATGTGGTTGCTTCTCTTTTTCT
TTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCAAGGACATAATCAGGTGATTC

ATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAATCTATATGGTAAT

GCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTGGAGAA
CCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATGA

131

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
CACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATG

CAAAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACC
ATTAAAGGTTACGCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAG
TGCAGGCTAATGTAAAAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCA

ATGGATATAAAACCACAAGTGGGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATT
AAATATGGAAATGCGGTCAGAAATGCCGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATA
TTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAAAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTA

ATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTTTACAGTGCTTTTAGTTGTTGTGATCCAATCCAGTGTTTAGA
GAACTGATAGGCGGCACGTCCTGACCGTTGACCACGTGCCTGACACCAGCGTAGGGCTTCAGCATGGGCTTCGTCAT
TCATTGGCATATCTGTTTTAGCAAGATAGTGTTCTACAATGGTTAAATACAGGTTTTGATCCATTGGATAGAATGAA

AGCCACATTCCAAAACGATCCGAGAGTGAAATTTTTTCCTCAATGGCTTCTTGTGGATGCAACTCGGTATATTGCGG
TACATCTACACGAGTCACTGGCGTGTTCTCATGCATAAATTCTGGTAACAGATGTCGACGGTTGCTGGTTGCATAAA
TAATAAAATTACTTGTACCTGACTGTAATGAGCCATCAAGTACACTTTTTAAGCTGCGATAGTTTTCATCTTCAGCA
TTAAAGGCCAGATCATCGCAGTAGACAATGAACTTTTCCGGACGCTTCTGGATGAGCTTCTGGATTTCAGGAAGATC

GGACAGATCATCACGTTCAATTTCAATTAAACGTAATCCTTGATCTTTATACTCGGTTAAAAGGGCACGGACAATTG
AAGATTTTCCTGTGCCGCGTGAACCAGTAAGGAGAACATCATTGGCTGGCAGATTCTGCAAAAATTGTCGTGTATTT
TGACTAATGTATTATTAAATACATGATCTTCAAGCTCTTCAAAAGCAAATCTTAGTGTGGCATGTGTACATACTAAA

ATTTGATCTGTACCTTCCATAAAGTGTTTAAAGGCTTTTACTTTGCTTTTATCGCCACCAGCAGTACATAAGTTGTT
TTCAGGTTTGATATCCCAATCTGCAAAAAAGCCACTTTCGCTTAGTTTTGTGCTAGCAAATGAACCGCCAATTGAGC
GTTCAGGTACAGCTACAATAACTTTGCTTAACCCTTGGTTGTGTATCTTGTCTAAACCCAAAAACATTAATGCACGA

GATTTACCTGATGCAGGAGGGGCTTTTAAGAGCAAATACTGACTATTACGAGATTCGAAGGCGCGAGCTTGCATAGC
TCGCATCCCCATATTATTAACTGAGGTGCTTTCTCCAGTTTGTTGATAATTTACTTCTACTAAATTTTTCATTTTTA
TCTCAATTTAACATTGTTTCGTAGTAGTGGAATAATCGCTCTAGACGCTCTTCATCTGTCTTAAAATCACTTGATTT
ATATAGTTTTTCCACTAACGAATCATTCTCTTTATGAGCTTGTTTTAAGTCAAAAGGCATTTTTTCAGGATCATAAA

GTTGAGCCAAACTTAAATGTGAATAGGATTCACGTACAGCTAGTATTTTAAAAGCAGATTCATTTAACTTAAATATC
GATGCTTTCATGAGCTTTGGCACAGGAAAAGTGTTATAGCAAATTGCTGAAGTGTAACGAATACGTTCCTCTAACTT

TCCTGCAATAGTTTTAACCCAAACCATGTGCATTTTCGATTGAAGCAATGCAAATACCTCTGTACACGACAAAAATA
GATAACTCATTGAAATAATGTCATAATAATTGTTTTCTAACGACGAATACTATGACACATCTCAATGAGTTATATCT
TATCTTAAACAAATATCTAAAATGGAACAAGTCACATTTAAAGTGCTTTGCGCTCATCATGCTTGTGATTATTTTAA
AGCAAACATGTAATCTTTCTTCTGCATCTAAAGCCTTGCCCATCAAGTGCTTACCACAATCATTTTATCGACGTATG

CAGCGCTTCTTTGCAGGTCAGTATTTTGATTATCGTCAAATTTCTCAGTTGATTTTCAATATGTTTTCATTCGACCA
AGTGCAACTGACTTTAGATAGAACCAATTGGAAATGGGGAAAACGAAATATTAATATCCTGATGCTCGCAATCGTTT
ATCGTGGAATAGCGATACCTATCCTTTGGACATTGCTTAATAAACGTGGAAATTCAGATACGAAAGAGCGTATTGCT

TTGATTCAACGCTTTATAGCCATTTTTGGTAAAGACCGTATTGTGAATGTGTTCGCAGACAGAGAGTTTATCGGTGA
GCAGTGGTTTACATGGTTAATTGAACAAGACATCAACTTCTGCATTCGTGTTAAAAAAACTTCATTGTCACCAATCA
TTTAGGAAAGAATCATAAAATTAGTGATTTATTTCGCCATCTTAAAGTTGGTCAAATTGAATGTCGTAAACGACGGA
TTTTGGTTGGTCGGGTGAAACTATATATAAGTGCACTACAGTTAGAAAATGGAGAGCTTTTACTCGTCGTTTCTCCT

CAGTTTAATGCCAATGCTATTCAGGATTATGCATTACGCTGGGAAATTGAAACCTTATTCAGTTGTCTCAAAGGACG
CGGGTTTAATCTTGGAAATACGCGCTTGACAGACCCTAGACGAGTGAAAAAATTGATTGCGGTGTTAGCTATAAGCT
TCTGTTGGTGTTACTTAACGGGTGAATGGCAACATGATCAAAAAAAAGCGATAAAAATAAAGAAGCATGGACGACTC

TCAATGAGTTTATTTCGCTATGGTTTAGACTATGTTCAAATGGCGATTCAGCGTTTAATTGGTTTTGGGAAAAAAGA

132

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
AGAGTTTAAGGAAATTTTGGCAATTTTAAGAAGGCAGAATCCTGATAGGATAAGGGTTCTGTGAAATTTGTCGTGTA

CAGAGGTCATTTAATTTATATCCAAACTCCTATAACGTTCTTCAGTATTTGCGTTCTCATCTTGAGCATCTAAGGCA
TCTAGAAGTTGACGATCTTTACGTAAACGCTCACGCAACTGATCATAGACAGGATGAGCATCAGGACATTTATTTGC

TTCAAACATTTGATCACCAAGATCTTCAAGCACTGCTTTAAGAGAAATCTTGTTCGATTGATCAACAGAAAATTTGC
TATTCATAAGCACCACCATAAGGACAGGTCTTGCGATAGCTATATTTTACCACTTA

Schema 2. Secvena genei blaOXA-23 i a secvenei de inserie ISAba1. Secvenele nucleotidice care au servit drept
matri pentru designul de primeri sunt marcate cu font subliniat-ISAba1reverse- linie simpl, font rou; OXA-23
forward- linie dubla, font rou; OXA -23reverse-linie dubl, font rou boldat (ngroat); secvena genei blaOXA -23
este reprezentat cu font negru.

5. STRUCTURA POPULAIEI- a fost investigat prin:


5.1. METODA ELECTROFOREZEI PE GEL N CMP PULSATOR (Pulsed-Field Gel
Electrophoresis -PFGE)
PFGE este o tehnic important pentru cartarea fizic. Tehnicile electroforetice
convenionale nu pot asigura separarea unor fragmente de ADN mai mari de 20kb, nsa metoda
PFGE este capabil s separe fragmente de ADN de pana la 10Mb (dimensiunea medie a unei
benzi cromozomale). Separarea unor astfel de fragmente mari este posibil prin folosirea unor
cmpuri electrice alternative care foreaz fragmentele de ADN s se reorienteze n timp ce trec
prin gelul de agaroz (fig. 82). Metoda, combinat cu enzimele de restricie care taie inconstant
ADN, duce la identificarea unui numr relativ mare de fragmente de restric ie de ADN. Deoarece
viteza cu care o molecula se reorienteaz variaz n funcie a greuttii sale moleculare, crete i
limita de rezoluie (Tenover i colab., 1995; Grosso i colab., 2011). PFGE se bazeaz pe
digestia enzimatic a ntregului genom bacterian, cu ajutorul unei endonucleaze, urmat de
electroforeza n gel de agaroz a amestecului de fragmente de ADN rezultat, obinndu-se un
profil de macrorestricie (profil de benzi), utilizat pentru analiza gradului de nrudire genetic a
tulpinilor din aceeai specie (Damian; Negru, 2011).
Parametrii PFGE sunt:

Cmpul pulsator- const n cel puin dou cmpuri ce acioneaz alternativ;

Intervalul de aciune (de pulsare)- este reprezentat de perioada de timp n care acioneaz
fiecare cmp;

Unghiul de reorientare- reprezint unghiul sub care sunt aplicate cmpurile pulsatoare (de
90, perpendiculare sau sub orice alt unghi, n func ie de geometria electrozilor);

133

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Inversiunea cmpului- uneori unghiul de reorientare poate fi de 180, ceea ce presupune o


mi care de ,,recul a moleculelor deja separate ntr-o prim faz.

A-

- -

B-

B+
A+
Fig. 82- PFGE- Schema principiului de func ionare a aparatului de elctroforez (CHEF-DR III-BIO-RAD). A i B
reprezint dou seturi de elctrozi. Cnd electrozii A (- i +) sunt activai ADN migreaz dinspre anod spre catod,
conform indicaiei primei sageti. Apoi aceti electrozi sunt dezactivai i activai electrozii din setul B (- i +). ADN
va migra dinspre anod spre catod, dar pe o direcie perpendicular pe prima (indicat prin a doua sageat). n
continuare, dupa dezactivarea setului de electrozi B, este reactivat setul A de electrozi, ADN va migra dup direcia
initial (adaptat dup Tenover i colab., 1995). Alternarea cu regularitate a cmpurilor A i B are loc pe ntregul
curs al electroforezei, fcnd ca ADN s migreze dup o traiectorie n zig-zag.

Materiale necesare (Grosso i colab., 2011):


soluie tampon de suspensie celular (5ml solutie Tris pH=8; 10ml EDTA; 35ml ap
ultrapur) ;
soluie de proteinaz K (20mg/ml);
agaroza Seakem Gold1% n soluie tampon TE (10mM Tris:1mM EDTA, pH=8) pentru
pregtirea blocurilor de agaroz (plugs);
soluie tampon de liz celular (25 ml solutie Tris 1M, pH=8; 50ml EDTA; 50ml
Sarcosyl 10%; ap ultrapur 375 ml);
tub Falcon cu capac special cu sit pentru splarea blocurilor de agaroz;
enzima de restricie (ICeuI/ApaI/SpeI/S1);
tampon de reacie NEB4;
ap ultrapur (A.D.S.);
BSA (Bovine Seric Albumine);
134

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Mod de lucru (Grosso i colab., 2011):

se preparar suspensii celulare din tulpinile de testat n soluia tampon de suspensie


celular (densitate optic 610nm) n tuburi de hemoliz;

se transfer 200l din suspensia celular n tuburi Eppendorf;

se adaug 10l proteinaz K n fiecare tub Eppendorf, se amestec uor prin pipetare;

se adaug 200l agaroz Seakem Gold1% n fiecare tub Eppendorf pe baia de ap


(55-60C) ;

repartizarea coninutului fiecrui tub Eppendorf n lcaele speciale ,,plug mold


pentru solidificare evitnd formarea bulelor de aer;

liza blocurilor de agaroz n soluia tampon de liz celular (cele 3 plugs -uri
corespunztoare fiecrei tulpini microbiene se plaseaz n tuburi Falcon ce conin 5ml
solutie tampon de liz celular+25l proteinaz K) pe baia de ap (54C) cu agitare
continu pentru 1,5-2 ore;

splarea blocurilor de agaroz de 3 ori cu A.D. (ap distilat) (10-15ml n fiecare tub
Falcon) ncalzit n prealabil pe baia de ap la 50C, fiecare etap de splare fiind
urmat de agitare pe baia de ap (50C), 10-15min.;

splarea blocurilor de agaroz de 3 ori cu solu ie tampon TE (10-15ml n fiecare tub


Falcon) ncalzit n prealabil pe baia de ap la 50C, fiecare etap de splare fiind
urmat de agitare pe baia de ap (50C), 10-15min.;

transferul celor 3 blocuri de agaroz corespunztoare fiecrei tulpini n tuburi


Eppendorf ce conin 750l soluie tampon TE, pstrare la 4C pn la utilizare;

digestia blocurilor de agaroz:


se taie cu ajutorul unei lamele din blocurile corespunztoare fiecrei
tulpini microbiene, se plaseaz n tuburi Eppendorf ce conin soluia de
digestie (87,8 l ap ultrapur; 10 l tampon de reacie NEB4, 1 l BSA,
1 l enzim de restricie - ICeuI/ApaI/SpeI/S1) ;
incubare la 25C, 24h pentru A. baumannii i la 37C, 24h pe baia de ap
pentru P. aeruginosa.

preparare gel agaroz 1,2% pentru PFGE ( 1,8 g agaroz n 150ml soluie TBE 0,5X ) ;

se plaseaz blocurile de agaroz pe piepten cu ajutorul unei spatule, se aaz pieptenul n


poziie corespunztoare, se toarn uor gelul, se scoate cu atenie pieptenul i s e migreaz
135

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

gelul utiliznd aparatul CHEF-DRIII, conform urmtoarelor condiii (Grosso i colab.,


2011):
A. baumannii : Timpul iniial de reorientare: 5 sec;
Timpul final de reorientare: 13 sec;
Voltajul utilizat: 6V;
Unghiul de reorientare: 120;
Timpul de migrare : 25h.
P. aeruginosa : I ciclu: Timpul iniial de reorientare: 4 sec;
Timpul final de reorientare: 12 sec;
*adaugare 760 l

Voltajul utilizat: 6V;

tiouree n tancul

Unghiul de reorientare: 120 ;

de migrare

Timpul de migrare : 12h.

Al II-lea ciclu: Timpul iniial de reorientare: 15 sec;


Timpul final de reorientare: 36 sec;
Voltajul utilizat: 6V;
Unghiul de reorientare:120;
Timpul de migrare: 12h.
5.2. FTIR-ATR (Fourier Transform Infrared Spectroscopy with Attenuated Total
Reflectance).
Obinerea de spectre FTIR-ATR
Tulpinile de A. baumannii inoculate pe mediu Mueller Hinton au fost incubate 18h la
37C i transferate din placa Petri pe cristalul ATR al spectrofotometrului. Spectrele FTIR-ATR
au fost obinute cu ajutorul unui spectrofotometru PerkinElmer Spectrum BX Sistem FTIR cu un
accesoriu PIKE Technologies Gladi ATR de 4000-600 cm-1, cu o rezoluie de 4 cm -1, i 32 de
scanri suplimentare (Sousa i colab., 2014). Pentru fiecare tulpin, au fost efectuate trei repetri
(obinute n aceeai zi din aceeai plac de agar) i trei replici biologice (obinute n tr ei zile
consecutive), obinndu-se i analizndu-se n total de nou spectre pentru fiecare tulpin
136

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

microbian studiat. Consecutiv msurrii fiecarei tulpini background-ul sistemului a fost


realizat. Dat fiind multitudinea datelor generate, o medie a spectrelor (obinut din cele nou
duplicate) a fost considerat n toate analizele ulterioare (Sousa i colab., 2014).
Prelucrarea i modelarea spectrelor
Spectrele FTIR-ATR au fost prelucrate cu o variaie standard normal (SNV) (Naes i
colab., 2002), urmat de aplicarea unui filtru Savitzky-Golay

(Savitzky i colab., 1964).

Principal Component Analysis (PCA) a fost metoda aleas pentru analiza datelor (Hotelling,
1933). PCA este o metod matematic care transform un set de variabile corelate ntr-o unul
mai mic, pstrnd totui o mare parte din informaiile setului iniial de date. Toate modelele
chemometrice au fost efectuate cu ajutorul Matlab versiunea 6.5 publicat 13 (MathWorks,
Natick, MA) i versiunea PLS Toolbox 3.5 pentru Matlab (vector propriu de cercetare, Manson,
WA).
5.3. METODA MLST (Multilocus Sequence Typing) este o metod de studiu epidemiologic
utilizat pentru a determina clona circulant. Ulterior tiprii prin metoda PFGE a tulpinilor de P.
aeruginosa productoare de carbapenemaze i A. baumannii productoare de CHLD, a fost
selectat cte o tulpin din fiecare gen aparinnd fiecrui pulsotip pentru determinarea tulpinii
prin metoda MLST, care presupune secveni erea anumitor gene eseniale, conservate n structura
genomului bacterian (gene house-keeping) implicate n metabolismul celular i caracterizarea
tulpinilor n funcie de profilul alelic obinut. Metoda s-a dezvoltat pornind de la MLEE
(multilocus enzyme electrophoresis) n care detectarea electroforetic a enzimelor produse ca
expresie genic este nlocuit cu secvenierea genelor respective codificatoare. Rezultatele
obinute prin secveniere sunt comparate cu bazele de date, iar identificarea unei mutaii noi,
conduce la nregistrarea unui tip alelic nou (ST= sequence type) (Damian; Negru, 2011).
Metoda

MLST

fost

efectuat

folosind

scheme

standard

pentru

fiecare

specie

(http://pubmlst.org/paeruginosa/, http://pubmlst.org/abaumannii/). La P. aeruginosa cele 7 gene


house-keeping investigate au fost: acetil coenzima A sintetaz (acsA), shikimat dehidrogenaz
(aroE), GMP sintaz (guaA), proteina ,,reparatoare a ADN (mutL), lanurile C, D ale NADH
dehidrogenazei I (nuoD), fosfoenolpiruvat-sintaz [ppsA] i componentul I al antranilat137

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

sintetazei I (trpE); iar la A. baumannii citrat sintaz (glt A), giraz B (gyr B), glucozodehidrogenaz B (gdh B), recombinaz A (rec A), chaperone 60 (cpn 60), glucozo-6-fosfatizomeraz (gpi) i ARN polimeraz (rpoD).
6. TEHNICA HIBRIDIZRII SOUTHERN

BLOT a fost utilizat pentru a determina

localizarea genelor de rezisten, ADN cromosomal/plasmidial separat n urma electroforezei n


cmp pulsator a fost transferat pe o membran de nylon (Amersham Hybond N+) prin metoda
Southern Blot, urmat de hibridizarea cu ajutorul sondelor ADN obinute prin marcarea
chemoluminiscent a produilor PCR de interes (ampliconi ai genelor codificatoare de
carbapenemaze/CHLD i replicazelor plasmidiale) (Rodrigues i colab., 2014).
Mod de lucru:
Transferul ADN din gelul de agaroz pe membrana de nylon:

se plaseaz gelul de agaroz cu ADN-ul orientat la partea superioar ntr-o tvi cu


soluie NaOH 0,4N 1,5h;

construirea sistemului de transfer prin capilaritate (fig. 83) alctuit dintr-o tvi, suportul
pe care se plaseaz gelul de agaroz, hrtie Whatman, membrana de nylon, hrtie
absorbant, greutate);

transferul ADN din gelul de agaroz pe membrana de nylon (Amersham Hybond N+),
36-48h, schimbarea periodic a hrtiei absorbante i completarea soluiei de NaOH 0,4N;

splarea membranei n 100ml soluie Tris 0,5M pH=7, 5min;

splare membranei n solutie SSC 2x, 2min;

uscarea membranei la temperatura camerei, 10min;

fixarea ADN n membrana prin expunere la UV, 1min.

138

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 83. Reprezentarea sistemului de transfer prin capilaritate (https://www.google.ro/ Southern Blot jpg).

Pregatirea sondei:
purificarea ampliconilor genelor codificatoare de carbapenemaze/CHLD i replicaze
plasmidiale utiliznd kit-ul de purificare GRS Pure DNA;
diluarea cu A.D.S. (ap distilat steril) a ampliconului (1 :1);
plasarea ampliconului diluat la 94C, 5min.; pe ghea, 5min .;
prepararea mixului de hibridizare (kit Amersham):
9,38 l ADN diluat;
9,38 l solutie tampon;
1,88 l reactiv de marcare;
9,38 l Cross Linker diluat 1 :5.
incubarea mixului de hibridizare la 37C, 30min. i plasare pe ghea pn la utilizare.
Prepararea soluiei tampon de hibridizare (kit Amersham):

0,87g NaCl

1,2 g blocking reagent ;

30 ml soluie tampon de hibridizare.

dizolvare complet pe agitator magnetic la


55C, 1 -2h.

Prehibridizarea membranei prin introducere n soluia tampon de


hibridizare din tubul Falcon i plasare 15min. n incubatorul la 55C.
Hibridizarea a avut loc la temperatura de 55C, aproximativ 20h (incubare
peste noapte).
Splarea membranei
139

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

tampon de splare I

- 8,7g NaCl;

(30ml/membrana

- 120g uree;

dizolvare pe baia de apa la 100C

-6,9g Na3PO4 0,5M pH=7 +7 pastile NaOH;

15min

-1l ml A.D.S. (ap distilat steril);

de 2 ori n
incubator)

- 1ml MgCl2 1M (5,08g MgCl2 25ml A.D.S);

dizolvare pe agitator

- 2g blocking reagent ;

magnetic la 55C

- 1g SDS (Sodium n-Dodecyl).


tampon de splare II 10 ml soluie T2 (121 g Tris +112g NaCl
dizolvate n 900 ml A.D.S.); ajustarea pH=10 (adugare HCl);
autoclavare ;
- 400l MgCl2 ;
- completare cu A.D.S pn la obinerea unui
volumul final de 200 ml.

submesia membranei n 100 ml tampon de spalare II pe agitatorul


magnetic la55C, 10min. Schimbarea soluiei tampon de spla re II i
repetarea acestei etape nc o dat.

Uscarea membranei la temperatura camerei.


Transferul membranei impregnate cu soluia revelatoare ntr -o caset ce nu
permite ptrunderea luminii i pus n contact cu o pelicul fotografic (Agfa
Medical Film) timp de 20h.
Developare (Rodrigues i colab., 2014) .

REZULTATE I DISCUII
Din totalul de 56 de tulpini luate n studiu 18 au prezentat fenotip MDR conform
criteriilor ECDC (Magiorakos i colab., 2012). Acest studiu a inclus doar izolatele clinice BlueCarba pozitive [13 tulpini de P. aeruginosa i 7 tulpini de A. baumannii (fig. 84; Tabelul 21)].

140

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 84. Rezultatele testului biochimic Blue-Carba la tulpini de P. aeruginosa : rndul I- izolate n solu ia
de albastru brom-timol pH=6, rndul al II-lea- izolate n soluia martor reprezentat de albastru brom-timol pH=7,
penultimul rnd- izolate n soluia de albastru brom-timol pH=6, iar ultimul rnd-izolate n solutia martor
reprezentata de albastru brom-timol pH=7.

Pentru tulpinile Blue-Carba incerte au fost efectuate analize spectrofotometrice


(Bernabeu i colab., 2012) utiliznd extracte brute de -lactamaze tratate cu diferite concentraii
de imipenem ns toate tulpinile au fost negative (nu au fost productoare de -lactamaze)
ntruct nu s-a observat o scdere a absorbanei imipenemului la 390nm care indic hidroliza
inelului -lactamamic.
n urma amplificrii prin PCR i secventierii produilor au fost identificate genele blaVIM2,

blaVEB-1 i blaVEB-3 la P. aeruginosa iar blaOXA-23 la A. baumannii, -lactamaza VIM-2 fiind

descris anterior n Romnia la Iai (Mereu i colab., 2013), OXA-23 la Timioara, Arad,
Reia (Bonin i colab., 2011). n ceea ce privete -lactamazele de spectru extins, studiul
prezent reprezint prima raportare a genelor de tip blaVEB-1 i blaVEB-3 din Romnia. Gena blaVIM2

a fost identificat la 11 tulpini de P. aeruginosa, blaVEB-1 si blaVEB-3 la cte o tulpin de P.

aeruginosa, iar gena blaOXA-23 fiind identificat la toate tulpinile de A. baumannii Blue-Carba
pozitive.
Toate tulpinile luate n studiu au fost MDR prezentnd urmatoarele niveluri de
rezisten : P. aeruginosa aminoglicozide (kanamicin, netilmicin, streptomicin) i
141

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

ceftriaxon (100%), 98% din tulpinile de P. aeruginosa analizate au fost rezistente la


ciprofloxacin; ceftazidim (88%) i tobramicin (81,8%) rezistena la imipenem a fost de 81% iar
tulpinile respective au prezentat rezisten la amikacin, gentamicin i cefepim (73%) (Tabelul
21). Toate tulpinile au fost pozitive pentru integraz (fig. 85), obinndu-se un amplicon de
2,5Kb.
Cu excepia a dou tulpini de P. aeruginosa, toate izolatele studiate au prezentat gena
blaVIM-2 n structura integronilor de clas 1, prima caseta genic coninnd aacA7 [ce codific
pentru acetiltransferaz, aac(6')-II, care determin rezistena la amikacin] (fig. 86, Tabelul 21).

Fig. 85. Electroforegrama ampliconilor obtinui prin PCR pentru gena IntR-VIM-2R: L- Marker de greutate
molecular GeneRuler 2500 bp (Fermentas), 2B, 8A, 9B, 10, 17, 30, 12A, X, 26, 20, 21 - P.aeruginosa; A A.baumannii; Ctrl+ blaVIM-2 i ctrl+ integroni de clas1.

Fig. 86. Electroforegrama ampliconilor obtinui prin PCR pentru integronii de clas 1 (5'CS-3'CS): rndul
de sus: L- Marker de greutate molecular GeneRuler 3000 bp (Fermentas), 2B, 8A, 9B, 10, 17, 30, 12A, X, 26, 20,
21 - P.aeruginosa; rndul de jos: L- Marker de greutate molecular GeneRuler 3000 bp (Fermentas), 19, 27, 39 A.
baumannii; 21, R, miu, 10, 20, 8A P. aeruginosa; ctrl+=control pozitiv 5'CS-3'CS; ctrl- = control negativ.

142

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Integroni de clas 1 coninnd cele dou casete genice aacA7-blaVIM-2 au fost descrii la
izolate clinice de P. aeruginosa productoare de VIM-2 n NE rii in perioada 2007-2010,
sugernd diseminarea acestui integron la tulpini de P. aeruginosa n Romnia (Cernat i colab.,
2007; Stru i colab., 2010). Integroni cu structur similar au fost identificai la izolate clinice
de P. aeruginosa din Palma de Malorca (Spania), Tunisia (Hammami i colab., 2010), Malaezia
(Khosravi i colab., 2011) i Japonia (Zhao i colab., 2009). n cazul a dou tulpini de P.
aeruginosa nu a fost posibil identificarea casetelor genice din structura integronilor de clasa 1
utiliznd diferite combinaii ale primerilor, sugernd astfel structura atipic a acestora. La 72,7%
din tulpinile de P. aeruginosa studiate (n=8/11) a fost identificat un integron suplimentar de
clas 1 (Tabelul

21) ce conine o singur caset genic aadB [ce codific pentru

adenilitransferaza (2)-1a, care confer rezistena la streptomicin], integron semnalat anterior n


Tunisia (Hammami i colab., 2010) i Australia (Nigro si colab., 2011).
Prin tehnica PFGE au fost identificate 4 pulsotipuri (A, n=7, acela i pattern de restricie;
B, n=1; C, n=1; i D, n=2) (Grosso i colab., 2011) (fig. 87).

Fig. 87. Electroforegrama pattern-urilor de restricie cu enzima SpeI pentru tulpinile de P. aeruginosa nr.
2B, 8A, 9B, 10, 17, 30, X, 21, 26, 12A, 20, 38, R, miu, 23 productoare de blaVIM-2, blaVEB-1 i blaVEB-3. CDS Marker de dimensiune.

143

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Tulpinile reprezentative din fiecare pulsotip, dar i cele care nu au putut fi tipate prin
tehnica PFGE au fost analizate ulterior prin tehnica MLST observndu-se c tulpinile de P.
aeruginosa aparinnd pulsotipului A i tulpina X aparin P. aeruginosa ST233, clon
identificat n 2006 n Suedia la un pacient repatriat din Gana (Jeannot i colab., 2013), dar i n
estul Franei, Danemarca (Hansen i colab., 2011) i Croatia (Sardelic i colab., 2012). Clone
sporadice au fost de asemenea identificate, n cazul pulsotipului B i tulpinii de P. aeruginosa nr.
9 a fost identificat P. aeruginosa ST364 [clon iniial semnalat la izolate clinice de P.
aeruginosa productoare de blaSPM-1 din Brazilia (Silva i colab., 2011)] iar pulsotipul C aparine
P. aeruginosa ST1074 (fig. 88, Tabelul 21). Clona ST1074 aparine CC235 i a fost anterior
semnalat la izolate clinice de P. aeruginosa productoare de blaVIM-2 din Croaia i ri vecine
ca Serbia (ST235), Ungaria (ST235 i ST230) i Italia (ST111, ST235, i ST227) (Sardelic i
colab., 2012).

Fig. 88. Electroforegrama ampliconilor obtinui prin PCR pentru tulpinile de P. aeruginosa nr. 26, 21, X,
R: componentul I al antranilat-sintetazei I(trpE); lanurile C, D ale NADH dehidrogenazei I (nuoD); shikimat
dehidrogenaz (aroE); proteina ,,reparatoare a ADN (mutL); GMP sintaz (guaA); acetil coenzima A sintetaz
(acsA); fosfoenolpiruvat-sintaz [ppsA] i L - Marker de greutate molecular GeneRuler 1500 bp (Fermentas).

144

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Prin hibridizare cu sonde specifice (blaVIM-2/16S rADN i blaVEB/16S rADN) genele


blaVIM-2, blaVEB-1 i blaVEB-3 au fost identificate ca avnd localizare cromosomal n cazul tuturor
izolatelor de P. aeruginosa analizate [Rodrigues i colab., 2014 (fig. 89)]. Rezultate similare au
fost semnalate n Croaia (Saderlic i colab., 2012), Republica Ceh (Papagiannitsis i colab.,
2013) i Portugalia (Quinteira i colab., 2011).
ICeuI

S1

blaVEB1,3

blaVIM-2

Fig. 89. Electroforegrama ADN cromosomal la tulpini de P. aeruginosa (8, X, 9, 21, 26, R, miu, 10)
linearizat cu enzima de restricie ICeuI i S1; CDS- Marker de greutate molecular.

Toate tulpinile de

A. baumannii analizate au fost Blue-Carba pozitive i au fost

productoare de OXA-23 i CHLD intrinsec OXA-51 (Turton i colab., 2006) prezentnd


rezisten la imipenem, ceftriaxon, amoxicilin-acid clavulanic, ciprofloxacin i kanamicin
(100%), trimetoprim-sulfametoxazol (88%), meropenem i netilmicin (86%), amikacin (78%),
i tobramicin (71%) (Tabelul 21). Studiul prezent confirm datele raportate din alte regiuni ale
rii (Timioara, Arad i Reita) (Bonin i colab., 2011).
Studiul contextului genetic al genei blaOXA-23 a demonstrat prezena acesteia n structura
transpozonului Tn2008 i nu Tn2006 dat fiind prezena secvenei de insertie ISAba1 n amonte
145

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

i absena acesteia din aval de gena blaOXA-23, iar pe de alt parte diferena cu 7 bp comparativ cu
secvena prototipului Tn2006 (nr. acces din GenBank HG797027.1) (fig. 90).

ISAba1

blaOXA23

Tn2008

ATPase

Fig. 90. Contextul genetic al genei blaOXA-23 la tulpinile de A. baumannii analizate.

Tulpini de A. baumannii productoare de OXA-23 identificat n structura Tn2008 au fost


semnalate anterior doar n Taiwan, Libia, SUA, Norvegia (Karah i colab., 2011 ), Polonia
(Radosaw i colab., 2012 ), China (Xiaohui i colab., 2013) i Romania [Timisoara, Arad i
Reia (Bonin i colab., 2011)].
La 43% din tulpinile de A. baumannii analizate n regiunea aval de Tn2008 a fost
identificat transpozonul incomplet TnaphA6 [compus din gena aphA6 care confer rezisten la
amikacin, kanamicin i neomicin, flancat de cele dou secvene de inserie ISAba125
repetate direct (fig. 91)] descris pn n prezent doar la tulpini de A. baumannii productoare de
OXA-23 n Australia (Hamidian i colab., 2011, Hamidian i colab., 2013 ).

ISAba1

blaOXA23

ATPase

ISAba
125

aphA6

ISAba125

TnaphA6

Tn2008

Fig. 91. Contextul genetic al genei blaOXA-23 la tulpinile de A. baumannii aparinnd ST765 i ST437.

Prin tehnica PFGE utiliznd enzima de restricie ApaI, tulpinile de A. baumannii


productoare de OXA-23 au fost ncadrate n trei pulsotipuri: A- n=4 izolate; B- n=2 izolate; Cn=1 izolat [Grosso i colab., 2011 (fig. 92)].

146

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 92. Electroforegrama pattern-urilor de restricie cu enzima ApaI pentru tulpinile de A. baumannii
productoare de blaOXA-23 (exc.9A). 9A, 19, 27, 35, A, l, n, 34 - tulpini de A. baumannii; CDS-marker de
dimensiune.

Tulpinile reprezentative din fiecare pulsotip au fost analizate ulterior prin tehnica MLST
identificndu-se trei clone ce aparin CC92 circulnd n cele dou uniti spitaliceti: : i) ST437
[4 izolate, PFGE-pulsotipul A, (fig. 93)] tulpini circulante n Institutul de Boli Cardiovasculare
Prof.,,C.C. Iliescu; ii) ST764, clon cu un singur locus genic diferit fa de ST437 (1 izolat,
PFGE-pulsotipul C) i ii) ST765, clon cu doi loci genici diferii fa de ST437 (2 izolate,
PFGE-pulsotipul B), ambele circulante n Spitalul Clinic Fundeni i introduse n baza de date
MLST (tabelul 21).

Fig. 93. Electroforegrama ampliconilor obtinui prin PCR pentru identificarea clonei la A. baumannii: LMarker de greutate molecular GeneRuler 1500 bp (Fermentas); A i 27- tulpini de A. baumannii; cele 7 gene
housekeeping [citrat sintaza (glt A), giraza B (gyr B), dehidrogenat glucoza B (gdh B), recombinaza A (rec A),
chaperone 60 (cpn 60), glucozo-6-fosfat- izomeraza (gpi) i ARN polimeraza (rpoD)].

147

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Toate cele trei clone aparin CC92, care conform unor studii recente ( Xiaohui i colab.,
2013) include: ST4 (semnalat n Italia); ST5 (semnalat n Spania); ST6 (semnalat n Olanda i
Spania); ST10 (semnalat n Spania); ST19 (semnalat n Germania); ST21 (semnalat n
Germania); ST69 (semnalat n Australia); ST70,71 (semnalate n Corea); ST74 (semnalat n
Japonia); ST75 (semnalat n China i Japonia); ST76 (semnalat n Japonia); ST88 (semnalat n
China si Tailanda); ST90 (semnalat n China); ST92 (ubiquitar); ST98 (semnalat n Germania i
Portugalia); ST118 (semnalat n China, Italia, Norvegia i Singapore); ST130 (semnalat n
Australia); ST136 (semnalat n China); ST137 (semnalat n China i Norvegia); ST138 (semnalat
n China); ST193 (semnalat n Norvegia i S.U.A.); ST195 (semnalat n China, Malaezia,
Norvegia i Tailanda); ST2 06 (semnalat n S.U.A.); ST208 (semnalat n China, Egipt, S.U.A.);
ST218 (semnalat n China i Japonia); ST219 (semnalat n Japonia); ST220 (semnalat n Corea);
ST223 (semnalat n China); ST238 (semnalat n Brazilia); ST239 (semnalat n Germania);
ST255, 257 (semnalate n Japonia); ST265 (semnalat n S.U.A.); ST281 (semnalat n S.U.A.);
ST346 (semnalat n China si

Japan); ST350 (semnalat n China i S.U.A.); ST357, 358

(semnalat n Corea); ST365 (semnalat n Tailanda); ST368, 369, 371,375, 381 (semnalate n
China); ST437 (semnalat n China i Italia); ST448, 452, 492, 493, 494 (semnalate n Vietnam).
Rezultatele FTIR-ATR la tulpinile de A. baumannii analizate au confirmat rezultatele
PFGE i MLST, identificndu-se trei pulsotipuri (fig. 94 i 95): A (2 izolate); B (6 izolate); C (1
izolat). Datorit numrului de izolate la tehnicile PFGE i MLST ordinea pulsotipurilor A i B a
fost inversat iar 2 tulpini au fost excluse din analiz ntruct nu au fost productoare de CHLD.

148

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 94. Spectrele medii FTIR-ATR pentru izolatele de A. baumannii prelucrate cu SNV i Savitzky-Golay.
Legenda: PFGE pulsotipul A; PFGE pulsotipul B; PFGE pulsotipul C.

Fig. 95. Rezultatele FTIR-ATR pentru izolatele de A. baumannii prelucrate cu SNV i Savitzky -Golay.
Legenda: PFGE pulsotipul A; PFGE pulsotipulB;PFGE pulsotipulC.

149

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Toate tulpinile de A. baumannii analizate au prezentat replicaze din urmtoarele grupe:


GR6 (Aci6-pACICU2), GR19 (rep135040) i GR15 (p3S18) (Bertini i colab., 2010) ( fig. 96,
97 i 98; Tabelul 21).

662bp

Fig. 96. Electroforegrama ampliconilor obtinui prin PCR pentru identificarea GR.6 de replicaze la A.
baumannii: L- Marker de greutate molecular GeneRuler 1500 bp (Fermentas); 9A-6, 19-6, 27-6, 35-6, A-6, l-6, n-6,
39-6, 6b-6, I-6, 50-6, 34-6, 5 6 - tulpini de A. baumannii analizate.

876bp

Fig. 97. Electroforegrama ampliconilor obtinui prin PCR pentru identificarea GR.15 de replicaze la A.
baumannii: L- Marker de greutate molecular GeneRuler 1500 bp (Fermentas); 9A-15, 19-15, 27-15, 35-15, A-15, l15, n-15, 39-15, 6b-15, I-15, 50-15, 34-15-tulpini de A. baumannii analizate.

815bp

Fig. 98. Electroforegrama ampliconilor obtinui prin PCR pentru identificarea GR.19 de replicaze la A.
baumannii: L- Marker de greutate molecular GeneRuler 1500 bp (Fermentas); 9A-19, 19-19, 27-19, 35-19, A-19, l19, n-19, 39-19, 6b-19, I-19, 50-19, 34-19, 51-19 - tulpini de A. baumannii analizate.

150

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Prin hibridizare cu sonde specifice blaOXA-23 i16S rADN a fost determinat localizarea
genei blaOXA-23 att la nivel cromosomal (~40Kb) sau la nivel plasmidial n cadrul aceleai sau
chiar n clone diferite [-pACICU2-60Kb (fig. 99; Tabelul 21)], studiul de fa reprezentnd
prima descriere a localizrii duble a genei blaOXA-23 la tulpinile de A. baumannii analizate cu
importan n rspandirea epidemiologic.

CR

GR.6 pACICU2

OXA-23

Fig. 99. Electroforegrama ADN cromosomal/plasmidial la tulpini de A. baumannii (9A, 19, 27, 35, A, l, nB,
34) linearizat cu enzima de restrictie ICeuI.

Investigarea clasei 1 de integroni la tulpinile de A. baumannii analizate a evideniat trei


integroni diferii de clas 1: i) aacA4-orfF-blaOXA-20 (n=3 izolate, ce determin rezisten la
amikacin i CHLD); ii) aacC1-orfP-orfQ-aadA1 (n=1 izolat, determin rezisten la
streptomicin i amikacin); i iii) aacC1-orfA-aadA1 (rezisten la amikacin i streptomicin)
(Tabelul 21). Integronul aacC1-orfP-orfQ-aadA1 a fost semnalat doar la tulpini de A. baumannii
151

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

ce aparin clonei europene I (EUI), izolate ce aparin clonei ST109 (Sung i colab., 2012).
Integroni cu structur similar integronului aacC1-orfP-orfQ-aadA1 au fost semnalai n Roma,
Londra, Soa, Dublin (Krizova i colab., 2011 ).

Tabelul 21. Date clinice, MBL/CHLD identificat, PFGE-pulsotipul, i rezultatele MLST, casetele genice
identificate, la izolatele clinice de A. baumannii i P. aeruginosa analizate. Spitalul Clinic Fundeni = spital A,
Institutul de Boli Cardiovasculare Prof.,,C.C. Iliescu= spital B; localizarea carbapenemazelor CR= cromosomal,
PL= plasmidial, ND = Nedeterminat. Abrevieri: Profil de rezistententa la diferite antibiotice -lactamice
(AMC=amoxicillin acid clavulanic, ATM=aztreonam, FEP=cefepim, CAZ=ceftazidim, CTX=ceftriaxon,
IMP=imipenem, MEM=meropenem) i non --lactamice (AMK=amikacin, CIP=ciprofloxacin, GEN=gentamicin,
NET=netilmicin, TET=tetraciclin, TOB=tobramicin, CLO= cloranfenicol, TGC= tigeciclin, SXT=trimetoprimsulfametoxazol).
Izolat
codificare
A

Specie
A.
baumanii

Spital
A

Sursa
izolare
urocultur

Data
izolrii

PFGE

MLST

Carbape
nemaz

29.11.2012

ST764

OXA-23CR

Casete
genice
aacA4orfFblaOXA20

Repli
caze

Profil de rezisten
la antibiotice

GR6,
GR10
,

MEM, IMP, CTX, CAZ,


FEP, AMC, AMK, NET,
TOB, TGC,
CLO, CIP, SXT

GR15
,
GR19

A.
baumanii

necunoscut

19.11.2012

ST765

OXA-23PL

aacC1orfAaadA1

GR6,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP, AMC, AMK, TET,
LO, SXT

A.
baumanii

necunoscut

18.11.2012

ST765

OXA-23PL

GR6,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP, AMC, AMK, TET,
CLO, SXT

35

A.
baumanii

Secreie
traheal

27.02.2012

ST437

OXA-23CR

GR6,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP, AMC, AMK, NET,
TOB, TET,
TGC, CLO, CIP, SXT

34

A.
baumanii

Secreie
traheal

22.02.2012

ST437

OXA-23CR

GR6,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP, AMC, AMK, NET,
TOB, TET,
CLO, CIP, SXT

19

A.
baumanii

Secreie
traheal

12.01.2012

ST437

OXA-23CR

GR6,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP,AMC, AMK, NET,
TOB, TET,
TGC, CLO, CIP, SXT

27

A.
baumanii

Exsudat
traheal

15.03.2012

ST437

OXA-23PL

GR6,
GR10
,
GR15
,
GR19

MEM, IMP, CTX, CAZ,


FEP,AMC, AMK, NET,
GEN, TOB,TET, TGC,
CLO, CIP, SXT

aacC1orfP
-orfQaadA1
aacA4orfOblaOXA20

152

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
2

P.
aeruginosa

Secreie
plag

26.01.2012

ST233

VIM-2CR

P.
aeruginosa

Secreie
traheal

2.02.2012

ST233

VIM-2CR

10

P.
aeruginosa

Secreie
traheal

10.02.2012

ST233

VIM-2CR

Spital

Data
izolrii

PFGE

MLST

codificare
17
P.
aeruginosa

Sursa
Izolare

Carbapene
maz

Urocultur

17.02.2012

ST233

VIM-2CR

30

P.
aeruginosa

Hemocultur

10.02.2012

ST233

VIM-2CR

12

P.
aeruginosa

Secreie
plag

8.02.2012

ST233

VIM-2CR

20

P.
aeruginosa

Hemocultur

13.02.2012

ST233

VIM-2CR

P.
aeruginosa

Secreie
traheal

16.01.2012

ND

ST233

VIMCR

P.
aeruginosa

Secreie
traheal

16.01.2012

ND

ST364

VIM-2CR

21

P.
aeruginosa

Cateter

14.02.2012

ST364

Spital

Sursa
Izolare

Data
izolrii

PFGE

Coprocul
tur

15.03.2012

Izolat

Izolat

Specia

Specie

codificare
26
P.
aeruginosa

aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
Casete
genice

aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
aacA7blaVIM-2
aadB
aacA7blaVIM-2

VIM-2CR

ND

MEM, IMP, CAZ,


FEP, ATM, AMK,
GEN, NET, TOB, CIP
MEM, IMP, CAZ, FEP,
AMK, GEN, NET,
TOB, CIP
MEM, IMP, CAZ, FEP,
AMK, GEN, NET,
TOB, CIP
MEM, IMP, CAZ, FEP,
AMK, GEN, NET,
TOB, CIP
MEM, IMP, CAZ, FEP,
ATM, AMK, GEN,
NET, TOB, CIP
MEM, IMP, CAZ, FEP,
ATM, AMK, NET,
TOB, CIP
MEM, ATM, NET

MLST

Carbapene
maz

Casete
genice

Repli
caze

Profil de rezisten
la antibiotice

ST107
4

VIM-2CR

ND

MEM, IMP

Repli
caze

MEM, IMP, CAZ, FEP,


ATM,AMK, GEN, NET,
TOB, CIP
MEM, IMP, CAZ, FEP,
AMK,GEN, NET, TOB
, CIP
MEM, IMP, CAZ, FEP
, ATM, AMK, GEN,
NET, TOB, CIP
Profil de rezisten la
antibiotice

Studiul -lactamazelor de spectru extins la cele 56 de tulpini de P. aeruginosa i


A.baumannii luate n studiu a evideniat c genele de tip blaTEMlike au fost identificate la un
procent semnificativ de tulpini de A. baumannii (26,78% din tulpini), urmate de izolate de P.
aeruginosa (10,7% din tulpini); genele de tip blaCTX-Mlike fiind de asemenea identificate la ambele
genuri analizate (7,14% din tulpinile de A.baumannii i 5, 35% din tulpinile de P. aeruginosa), n
timp ce genele blaVEB-1 i blaVEB-3 au fost identificate numai la P. aeruginosa (fig. 100).

153

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Fig. 100 . Reprezentarea grafic a distribuiei pe specii a genelor de rezisten la BLSE. Pe axa X este reprezentat
numrul tulpinilor analizate iar pe axa Y sunt reprezentate genele de rezisten la ESBL identificat e la tulpinile
analizate. Interpretarea statistic a fost realizat cu testul one way Anova, *P < 0.05.

CONCLUZII
1.

2.

3.

4.

Toate izolatele de P. aeruginosa Blue-Carba pozitive au fost productoare de VIM-2 i


au prezentat fenotipuri de multirezisten (MDR). Gena blaVIM-2 a fost identificat
(n=8/11) n structura integronilor de clas 1 (aacA7-blaVIM-2), fiind detectat de
asemenea un integron suplimentar ce conine o singur caset genic reprezentat de
aadB (n=8/11).
Majoritatea tulpinilor (n=8/11) au fost ncadrate n primul pulsotip din cele trei
identificate prin PFGE i corespund clonei ST233. Dou clone sporadic e ce aparin de
asemenea CC235 au fost identificate n rndul izolatelor de P. aeruginosa
productoare de VIM-2, respectiv ST364 (n=2/11) i ST1074 (n=1/11). Gena blaVIM-2
a fost identificat la nivel cromosomal la toate izolatele de P. aeruginosa analizate n
urma hibridizrii cu sonde specifice.
La tulpinile de P. aeruginosa productoare de -lactamaze de spectru extins au fost
identificate n urma secvenierii urmtoarele gene: blaVEB-1 (n=1/13) i blaVEB-3
(n=1/13). Studiul integronilor de clas 1 a permis numai identificarea genei aacA7 ce
determin rezisten la amikacin, fr a fi localizate i -lactamazele de spectru extins
de tipul VEB-1/VEB-3 la nivelul casetelor genice din structura acestora. Genele
blaVEB-1 i blaVEB-3 au fost identificate la nivel cromosomal la izolatele de P.
aeruginosa analizate n urma hibridizrii cu sonde specifice.
Toate tulpinile de A. baumannii analizate au fost productoare de OXA-23 i au
prezentat CHLD intrinsec OXA-51 prezentnd fenotip MDR. Gena pentru OXA-23 a
fost identificat n structura Tn2008 urmat de transpozonul incomplet TnaphA6
identificat la 43% dintre tulpini, i localizat la nivel plasmidial (GR6-pACICU260kb) sau cromosomal n cadrul aceleiai clone sau la clone diferite. Toate tulpinile de
154

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

5.

A. baumannii analizate au prezentat replicaze din urmtoarele grupe: GR6 (Aci6pACICU2), GR19 (rep135040) i GR15 (p3S18). Izolatele aparinnd la trei
pulsotipuri (A, B, C), au fost asociate clonelor epidemice ST437 (n=4), ST765 (n=2)
i ST764 (n=1) ale CC92. Trei structuri diferite ale integronilor de clas 1 au fost
identificate la tulpinile de A. baumannii analizate: aacA4-orfF-blaOXA-20 (n=3/7);
aacC1-orfP-orfQ-aadA1 (n=1/7); i aacC1-orfA-aadA1 (n=1/7), casetele genice din
structura acestora conin gene ce determin rezisten la aminoglicozide.
Studiul BLSE la cele 56 de tulpini de P. aeruginosa i A.baumannii luate n studiu a
evideniat c genele de tip blaTEM like au fost identificate la un procent semnificativ de
tulpini de A. baumannii (26,78%), urmate de izolate de P. aeruginosa (10,7%); genele
de tip blaCTX-M like fiind de asemenea identificate la ambele genuri analizate (7,14% din
tulpinile de A.baumannii i 5, 35% din tulpinile de P. aeruginosa) i prima descriere a
genelor blaVEB la tulpini de P. aeruginosa din Romnia.

155

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Capitolul 4
CONCLUZII GENERALE

Studiul realizat pe un numr semnificativ de tulpini de BGNNF a condus la formularea


urmtoarelor concluzii generale:
1. Tulpinile de BGNNF pn nu demult ignorate n clinic prezint niveluri nalte de rezisten la
antibioticele -lactamice, mediate enzimatic de -lactamaze de spectru larg, dar i prin
mecanisme ne-enzimatice, care prin acumulare, conduc la apariia fenotipurilor de rezisten
extins i pan -rezisten, care sunt responsabile de producerea unor infeci i severe, ce evolueaz
cu complicaii, datorit dificultilor de eradicare a infeciei i persistenei tulpinilor productoare
de -lactamaze n mediul spitalicesc.
2. Acest studiu a permis stabilirea suportului genetic al mecanismelor de rezisten la tulpini de
BGNNF izolate de la pacieni din spitale din Roma nia, mediate enzimatic la carbapeneme prin lactamaze din clasele A, B si D, iar la aminoglicozide prin modificarea intei i prin pompe de
eflux.
3. Studiul prezent reprezint prima descriere a genelor blaVIM-4, blaVEB-1 i blaVEB-3 la izolate
clinice de P. aeruginosa din Romnia, pe de o parte i pe de alt parte prima caracterizare a
contextului genetic i relaiilor de clonalitate a unor tulpini de P. aeruginosa productoare de
VIM-2 i A. baumannii productoare de OXA-23 izolate n Romania, din dou mari clinici din
Bucureti cu acoperire teritorial reprezentativ pentru dou regiuni ale rii, rezultatele obinute
fiind astfel semnificative i din punct de vedere epidemiologic.
4. Prezentul studiu reprezint prima descriere, la nivel european a localizrii att la nivel
cromosomal, ct i la nivel plasmidial ( pACICU2) a genei blaOXA23 la tulpinile de A. baumannii
analizate.
5. Studiul demonstreaz necesitatea monitorizrii fenomenului antibiorezistentei, fenomen
comparabil cu procesul de microspeciaie cu influen asupra propriet ii de fitness a agenilor
infecioi oportuniti, capabili ns s determine infecii severe la pacienii imunocompromii.

156

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

LUCRRI PUBLICATE PE PARCURSUL ELABORRII TEZEI

Articole
1. Otilia Banu, Irina Gheorghe, Ilda Czobor, Rela Stefania Brojban, Nina Nadia
Serbnescu, Margareta Cainaru, Mariana Carmen Chifiriuc, Coralia Bleotu, Veronica
Lazr. 2012. Infective endocarditis: aetiology, clinical features, principles of treatment
and prevention. 1(1): 018-025. Letters in Applied NanoBioScience. BDI.
2.

Irina Gheorghe, Ilda Czobor, Mariana Carmen Chifiriuc, Elvira Borcan, Camelia
Ghi, Otilia Banu, Veronica Lazr,Grigore Mihescu, Dan Florin Mihilescu, Zong
Zhiyong. 2014a. Molecular screening of carbapenemase - producing Gram negative
strains in Roumanian intensive care units during one year survey. J Med Microbiol. 63:
1303-1310. IF 2,297.

3. Irina Gheorghe, Mariana Carmen Chifiriuc, Ani Ioana Cotar, Veronica Lazar. 2014b.
Extended-spectrum Beta-lactamase Production in Pseudomonas aeruginosa and
Acinetobacter baumanii Strains: Epidemiology, Molecular Characterization and Novel
Proteomics-based Diagnostic Tools. Current Proteomics. 11 (2): IF 0,44.
4. Ilda CZOBOR#, Irina GHEORGHE#, Otilia BANU, Alexandra VELICAN, Veronica
LAZR, Grigore MIHESCU, Mariana-Carmen CHIFIRIUC. 2014. ESBL genes in
Multi Drug Resistant Gram negative strains isolated in a one year survey from an
Intensive Care Unit in Bucharest, Romania. Roumanian Biotechnological Letters. 19(4).
IF 0,363.

Alte lucrri
1. Mariana Viorica Bubulica, Ion Anghel, Alexandru Mihai Grumezescu, Crina Saviuc,
Georgiana Alina Anghel, Mariana Carmen Chifiriuc, Irina Gheorghe, Veronica Lazar,
Alexandru Popescu. 2012. In vitro evaluation of bactericidal and antibiofilm activity of
Lonicera tatarica and Viburnum opulus plant extracts on Staphylococcus strains.
Farmacia. 60( 1). IF 0,669.
2.

Dan Eduard Mihaiescu, Mariana Horja, Irina Gheorghe, Anton Ficai, Alexandru Mihai
Grumezescu, Coralia Bleotu, Carmen Mariana Chifiriuc. 2012. Water soluble magnetite
nanoparticles for antimicrobial drugs delivery. Letters in applied NanoBioScience. 1 (2):
45-49.

3.

Andronescu E, Grumezescu AM, Ficai A, Gheorghe I, Chifiriuc M, Mihaiescu D E,


Lazar V. 2012. In vitro of antibiotic magnetic dextran microspheres complexes against

157

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Staphylococcus aureus and Pseudomonas aeruginosa strains. Biointerface Res. Appl.


Chem. 2(2):332-338. BDI.
4.

Georgeta Voicu, Valentina Grumezescu, Ecaterina Andronescu, Alexandru Mihai


Grumezescu, Anton Ficai, DenisaFicai, Cristina Daniela Ghitulica, Irina Gheorghe,
Mariana Carmen Chifiriuc. 2013. Caprolactam-silica network, a strong potentiator of
the antimicrobial activity of kanamycin against Gram-positive and Gram-negative
bacterial strains. International Journal of Pharmaceutics. IJP-D-12-01775R1. IF 3.45.

5.

Irina Gheorghe, Mariana Carmen Chifiriuc, Paulina Anastasiu, Luminita Marutescu,


Eliza Oprea, Veronica Lazar. 2013. Study of the antagonist interactions between invasive
plants from Danube Delta and the associated microbiota. Biointerface Res. Appl. Chem.
3(1):520-522. BDI.

6.

Ion Anghel, Alexandru Mihai Grumezescu, Alina Maria Holban, Irina Gheorghe,
MihaelaVlad, Georgiana Alina Anghel, Paul Catalin Balaure, Carmen Mariana Chifiriuc,
Ioana Mihaela Ciuca. 2014. Improved activity of aminoglycosides entrapped in silica
networks against microbial strains isolated from otolaryngological infections. Farmacia.
62(1). IF 0,669.

Rezumate n volume ale manifestrilor tiinifice


n strintate
1. Irina Gheorghe, Mariana Carmen Chiriuc, Luminita Marutescu, Veronica Lazar. Phenotypic
and molecular analasys of beta-lactam resistance markers in opportunistic, non-fermenting
Gram negative rods. Poster No.005. 2nd European Conference on Antimicrobial Resistance and
Infections Prevention- Vilnius, Lituania octombrie 2012. Pag.25. Autor principal, conferin
internaional.
2. Irina Gheorghe, Ilda Czobor*, Elvira Borcan, Veronica Lazr, Grigore Mihescu, Mariana
Carmen Chifiriuc. Molecular screening of carbapenemase genes in multidrug-resistant Gramnegative bacteria isolated from Romanian hospitals. Abstract Nr. 2717 i Poster P1249. The
23rd European Congress of Clinical Microbiology and Infectious Diseases, Berlin, Germania,
aprilie 2013. Autor principal, conferin internaional cu cotaie ISI.
3. I. Gheorghe, . Novais*, F. Grosso, C. Rodrigues, C. Chifiriuc, V. Lazr, L. Peixe.
Identification of particular clonal complexes and mobile elements associated with the
dissemination of blaOXA-23-carrying Acinetobacter baumannii and bla VIM-2-carrying
Pseudomonas aeruginosa in Romania. Poster P0994. The 24rd European Congress of Clinical
Microbiology and Infectious Diseases, Barcelona, Spania, mai 2014. Autor principal, conferin
internaional cu cotaie ISI.
158

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

4. J. Pires, . Novais, L. Silva, J. Campos, J. Bothelho, I. Czobor, I. Gheorghe, L. Peixe.


Further validation of Blue-Carba, a recently described quick and reliable method for
carbapenemase detection. Poster eP327. The 24rd European Congress of Clinical Microbiology
and Infectious Diseases, Barcelona, Spania, mai 2014. Co-autor, conferin internaional cu
cotaie ISI.
Rezumate n volume ale manifestrilor tiinifice n ar
1. Irina Gheorghe, Carmen Chifiriuc, Luminia Mruescu, Otilia Banu, Veronica Lazr. Studiul
fenotipic al spectrului de sensibilitate la antibioticele betalactamice la tulpini de bacili Gram
negativi non-fermentativi oportuniti . Volum de rezumate - Sesiunea de Comunicri tiinifice a
Studenilor Facultii de Biologie Universitatea din Bucureti , Ediia 2012.
2. Irina Gheorghe . Studiul fenotipic si molecular al spectrului de sensibilitate la antibioticele
betalactamice la tulpini de bacili Gram negativi non-fermentativi oportuniti. Volum de
rezumate Diaspora n Cercetarea Romneasc. 2012. Prezentare Oral. Conferin
internaional.
3. Gheorghe Irina, Anastasiu Paulina, Chifiriuc Carmen, Lazr Veronica. Studiul unor
interaciuni de tip antagonist ntre plante invazive din Delta Dunrii i microbiota asociat.
Poster. Sesiunea de comunicri tiinifice ,,D. Brndz,, Ediia a XVIII-a. 2012. Autor
principal.Conferin naional.
4. Gheorghe Irina, Chifiriuc Carmen, Mruescu Luminia, Banu Otilia, Lazr Veronica.
Studiul fenotipic i molecular al spectrului de sensibilitate la antibioticele betalactamice la
tulpini de bacili Gram negativi non-fermentativi oportuniti. Poster. Sesiunea de comunicri
tiinifice ,,D. Brndz,, Ediia a XVIII-a. 2012. Autor principal.Conferin naional.
5. Irina Gheorghe, Ilda Czobor, Carmen Chifiriuc, Luminia Mruescu, Otilia B anu, Elvira
Borcan, Veronica Lazr. Markeri fenotipici i moleculari de rezisten la antibioticele
betalactamice la tulpini de bacili Gram negativi non-fermentativi oportuniti. Volum de
rezumate - Sesiunea de Comunicri tiinifice a Studenilor Facultii de Biologie. Ediia 2013.
6. Irina Gheorghe, ngela Novais, Filipa Grosso, Carla Rodrigues, Carmen Chifiriuc, Veronica
Lazr, Luisa Peixe. Caracterizarea genetic a tulpinilor de Pseudomonas aeruginosa bla VIM-2 i
Acinetobacter baumannii blaOXA-23 rezistente la carbapeneme circulante n Romnia. Volum de
rezumate - Sesiunea de Comunicri tiinifice a Studenilor Facultii de Biologie. Ediie
Aniversar ,,150 de ani de tradiie, educaie i cercetare. Bucureti 2014.

159

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

BIBLIOGRAFIE
1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.
14.
15.
16.
17.
18.
19.
20.

Adams- Haduch J.M., Paterson D.L., Sidjabat H.E., Pasculle A.W., Potoski B.A., Muto C.A., Harisson
L.H., Doi Y. 2008. Genetic basis of multidrug resistance in Acinetobacter baumannii clinical isolates at a
tertiary medical center in Pensylvania. Antimicrob Agents Chemother. 52: 3837-3843.
Adley C.C., Saieb F.M. 2005. Biofilm formation in high purity water: Ralstonia pickettii a special case for
analysis. Ultrapure Wate. 22:14-17.
Afzal-Shah M., Woodford N., Livermore D.M. 2001. Characterization of OXA-25, OXA-26, OXA-27,
Molecular class D beta-lactamases with carbapenem resistance in clinical isolates of Acinetobacter
baumannii. 45(2):583-589.
Ambler R.P., Coulson A.F., Frere J.M., Joris B., Forsman M., Levesque R.C., Tiraby G., Waley S.G. 1991.
A standard numbering scheme for the class A beta-lactamases. Biochem. J. 276: 269-270.
Anderson R.L., Holland B.W., Carr J.K., Bond W.W., Favero MS..1990. Effect of disinfectants on
pseudomonads colonized on the interior surface of PVC pipes. Am.J. Public Health .80(1):17-21.
Aoun, M., P. Van der Auwera, Devleeshouwer C., Daneau D., Seraj N., Meunier F., Gerain J. 1992.
Bacteraemia caused by non-aeruginosa. Pseudomonas species in a cancer centre. J. Hosp. Infect. 22:307
316.
Arella, M., Sylvestre M. 1979. Production of an extracellular ribonuclease by Pseudomonas maltophilia.
Can. J. Microbiol. 25:321328.
Aronson, N. E., Sanders J. W., Moran K. A. 2006. In harms way: infections in deployed American military
forces. Clin. Infect. Dis. 43:10451051.
Arpi M., Victor M. A., Moller J. K., Jonsson V., Hansen M. M., Peterslund N. A., Bruun B. 1994.
Changing etiology of bacteremia in patients with hematological malignancies in Denmark. Scand. J. Infect.
Dis. 26:157162.
Baddour, L. M., Meyer J., Henry B. 1991. Polymicrobial infective endocarditis in the 1980s. Rev. Infect.
Dis. 13:963970.8.
Barbolla R. E., Centron D., Di Martino A., et al. 2003. Identification of an epidemic carbapenemresistant Acinetobacter baumannii strain at hospitals in Buenos Aires City. Diagn. Microbiol. Infect.
Dis.45:261-264.
Bauernfeind A., Grimm H., Schweighart S. 1990. A new plasmidic cefotaximase in a clinical isolate of
Escherichia coli. Infection. 18: 294-298.
Beare P.A., For R.J., Martin L.W., Lamont I.L. 2003. Siderophore-mediated cell signalling in
Pseudomonas aeruginosa: divergent pathways regulate virulence factor production and siderophore
receptor synthesis. Mol. Microbiol. 47(1):195-207.
Bennet P.M. 1999. Integrons and genes cassettes. A genetic construction kit for bacteria. Antimicrob.
Agents. Chemother. 43:1-4.
Berg G., Marten P., Balling G. 1996. Stenotrophomonas maltophilia in the rhizosphere of oil-seed rape
occurrence, characterisation, and interaction with phytopathogenic fungi. Microbiol. Res. 151:1927.
Bernabeu S., Poirel L., Nordmann P. 2012. Spectrophotometry-based detection of carbapenemase
producers among Enterobacteriaceae. Diagnostic and Infections Disease. 74(1):88-90.
Bertini A., Poirel L., Mugnier P.D., Villa L., Nordmann P., Carattoli A. 2010. Characterization and PCRBased Replicon Typing of Resistance Plasmids in Acinetobacter baumannii. Antimicrobial Agents and
Chemotherapy. 54(10): 4168-4177.
Bogaerts P., Rezende de Castro, R de Mendonca, Huang T-H., Denis Q., Glupczynski Y. 2013. Validation
of carbapenemase and Extended-Spectrum Beta-Lactamase Multiplex Endpoint PCR Assays according to
ISO15189. Journal of Antimicrobial Chemotherapy 68:1576-1582.
Bonin R.A., Poirel L., Licker M., Nordmann P. 2011. Genetic diversity of carbapenem hydrolysing lactamases in Acinetobacter baumannii from Romanian hospitals. ClinMicrobiol Infect. 17(10): 15241527.
Bonnet R. 2004. Growing group of extended-spectrum -lactamases: the CTX-M enzymes. Antimicrob.
Agents Chemother. 48:1-14.

160

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
21. Bonnet R., Sampaio J.L., Chanal C., Sirot D., De Champs C., Viallard J.L., Labia R., Sirot J. 2000. A novel
class A extended-spectrum -lactamase (BES-1) in Serratia marcescens isoloated in Brazil. Antimicrob
Agents Chemother. 44: 3061-3068.
22. Bonnin R.A., Nordmann P., Potron A., Lecuyer H., Zahar J.R., Poirel L. 2011. Carbapenem-hydrolyzing
GES-type extended-spectrum -lactamases in Acinetobacter baumannii. Antimicrob. Agents Chemother.
55: 349-354.
23. Bonnin R.A., Poirel L., Nordmann P., Eikmeyer F.G., Wibberg D., Puhler A., Schluter A. 2013. Complete
sequence of broad-host-range plasmid pNOR-2000 harbouring the metallo--lactamase gene blaVIM-2 from
Pseudomonas aeruginosa. J. Antimicrob. Chemother. 68: 1060-1065.
24. Borcan E. 2012. Profiluri de rezisten i virulen la bacili Gram negativi izolai din infecii respiratorii
severe la pacientul ventilat mechanic din secia de terapie intensiv. 228p.
25. Bou G., Oliver A., Martinez-Beltran J. 2000. OXA-24, a novel class D -lactamase with carbapenemase
activity in an Acinetobacter baumannii clinical strain. Antimicrob Agents Chemother. 44:15561561.
26. Bryan L.E., Seneka M.H., Van Den Elzen J et al. 1973. Characteristics of R931 and other Pseudomonas
aeruginosa R factors. Antimicrob Agents Chemother. 3: 625-637.
27. Brooke J. 2012. Stenotrophomonas maltophilia: an Emerging Global Opportunistic Pathogen. Clin
Microbiol Rev. 25(1): 2-41.
28. Buiuc D. 1992. Microbiologie medical, Editura Didactic i Pedagogic, Bucureti. pp. 234-236.
29. Bush K. 1998. Metallo-beta-lactamase. Clin. Infect. Dis. 27: 548-53.
30. Bush K. 2008. Extended - spectrum -lactamases in North America. 1987-2006. Clin. Microbiol. Infect.
14: (Suppl1), 134-143.
31. Bush K., Jacoby G.A., Medeiros A.A. 1995. A functional classification scheme for -lactamases and its
correlation with molecular structure. Antimicrob Agents Chemother. 39:12111233.
32. Calegari L., Gezuele E.G., Torres E., Carmona C. 1996. Botryomycosis caused by Pseudomonas
vesicularis. Int. J. Dermatol . 35:817-818.
33. Carr, Susan, Unwin N., Pless-Mulleoli, Tanja. 2007. An introduction to public health and epidemiology.
Ed. Open University Press. Uk.
34. Castanheira M., Toleman M.A., Jones R.N. et al. 2004. Molecular characterization of beta-lactamase gene
blaGIM-1, encoding a new subclass of metallo- -lactamase. Antimicrob Agents Chemother. 48(12):4654
61.
35. Castanheira M, Deshpande LM, Costello A et al. 2014. Epidemiology and carbapenem resistance
mechanisms of carbapenem-non-susceptible Pseudomonas aeruginosa collected during 2009-11 in 14
European and Mediterranean countries. J Antimicrob Chemother. 69(7):1804-1814.
36. Celenza G., Pellegrini C., Caccamo M., Segatore B., Amicosante G., Perilli M. 2006. Spread of CTX-Mtype and blaPER-2 -lactamase gene in clinical isolates from Bolivian hospitals. J. Antimicrob Chemother.
57: 975-978.
37. Cernat R., C. Balotescu, Lazr V et al. 2007. Genetic characterisation of highly prevalent MBLs and OXA
carbapenemases in multidrug-resistant Acinetobacter baumannii strains in a Romanian hospital. Clin
Microbiol.Infect.13(s1): O436.
38. Chi C.Y., Fung C.P., Wong W.W., Liu C.Y.2004. Brevundimonas bacteremia: two case reports and
literature review. Scand. J. Infect. Dis. 36:59-61.
39. Chifiriuc M.C., Mihescu G., Lazr V. 2011. Microbiologie i virologie medical. Editura Universitii din
Bucureti. pp. 747.
40. Choi W., Lee C., Kim A., Choi J.W., Seo S., Lee J., Pyo H., Kwon Y.J. 2006. CAPD peritonitis due to
Brevundimonas vesicularis. Perit. Dial. Int. 26:510-512.
41. Clinical and Laboratory Standards Institute. 2012. Performance standards for antimicrobial susceptibility
testing. 22th informational supplement..CLSI M100-S22, Wayne, PA.
42. Coelho J., Woodford N., Afzal-Shah M., Livermore D. 2006. Occurrence of OXA-58-like carbapenemases
in Acinetobacter spp. collected over 10 years in three continents. Antimicrob Agents Chemother. 50:756
758.
43. Cornaglia G., Giamarellou H., Rossolini G.M. 2011. Metallo--lactamases: a last frontier for -lactams?
Lancet Infect Dis. 11:381-93.
44. Corvec S., Caroff N., Espaze E., Giraudeau C., Drugeon H., Reynaud A. 2003. AmpC cephalosporinase
hyperproduction in Acinetobacter baumannii clinical strains. J Antimicrob Chemoth 52: 629635.

161

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
45. Csilla R. 2011. Characterization of medically important Pseudomonas aeruginosa isolates. Ins. Of
Clinical Microbiology. Faculty of Medicine. Univ. Szegeg. Szeged. pp. 95.
46. Currie B.J., Ward,L., Cheng, A. C. 2010. The epidemiology and clinical spectrum of melioidosis: 540
cases from the 20 year Darwin prospective study. PLoS Negl. Trop. Dis. 4(11): 1-11.
47. Czobor I.,# Gheorghe I.,# Banu O., Velican A., Lazr V., Mihescu G., Chifiriuc M.C. 2014. ESBL genes in
Multi Drug Resistant Gram negative strains isolated in a one year survey from an Intensive Care Unit in
Bucharest, Romania. Roumanian Biotechnological Letters. 19(4):
48. Damian A., Negru M. 2011. Diagnosticul de laoborator n toxiinfeciile alimentare produse de bacilli
Gram negativi. Edit. Ceres. pp. 304.
49. Da Silva G. J., S. Quinteira E., Bertolo J., Sousa C., Gallego L., Duarte A., Peixe L. 2004. Long-term
dissemination of an OXA-40 carbapenemase-producing Acinetobacter baumannii clone in the Iberian
Peninsula. J. Antimicrob Chemother. 54:255258.
50. Da Silva G., Dijkshoorn L., van der Reijden T., et al. 2007. Identification of widespread, closely
related Acinetobacter baumannii isolates in Portugal as a subgroup of European clone II. Clin. Microbiol.
Infect. 13:190-195.
51. Danel F., Hall L. M., Gur D., Livermore D. M. 1995. OXA-14, another extended-spectrum variant of OXA10 (PSE-2) beta-lactamase from Pseudomonas aeruginosa. Antimicrob Agents Chemother. 39:18811884.
52. Danel F., Hall L. M., Gur D., Livermore D. M. 1997. OXA-15, an extended-spectrum variant of OXA-2
beta-lactamase, isolated from a Pseudomonas aeruginosa strain. Antimicrob Agents Chemother. 41:785
790.
53. Danel F., Hall L. M., Gur D., Livermore D. M. 1998. OXA-16, a further extended-spectrum variant of
OXA-10 beta-lactamase, from two Pseudomonas aeruginosa isolates. Antimicrob Agents Chemother.
42:31173122.
54. Danel, F., Hall L. M., Duke B., Gur D., Livermore D. M.. 1999. OXA-17, a further extended-spectrum
variant of OXA-10 beta-lactamase, isolated from Pseudomonas aeruginosa. Antimicrob Agents
Chemother. 43:13621366.
55. De Champs C., Poirel L., Bonnet R., Sirot D., Chanal C., Sirot J., et al. 2002. Prospective survey of betalactamases produced by ceftazidime- resistant Pseudomonas aeruginosa isolated in a French hospital in
2000. Antimicrob. Agents Chemother. 46(9): 3031-4.
56. De Chial M., Ghysels B., Beatson S., Geoffroy V., Meyer J. M., Pattery T., Baysse C., Chablain P.,
Parsons Y.N., Winstanley C., Cordwell S., Cornelis P. 2003. Identification of type II and type III
pyoverdine receptors from Pseudomonas aeruginosa. Microbiology 149: 821-831.
57. De Oliveira-Garcia D. et al. 2003. Fimbriae and adherence of Stenotrophomonas maltophilia to epithelial
cells and to abiotic surfaces. Cell. Microbiol. 5:625 636.
58. Denton M. et al. 2003. Stenotrophomonas maltophilia contamination of nebulizers used to deliver
aerosolized therapy to inpatients with cystic brosis . J. Hosp. Infect. 55:180 183.
59. Denton M., Todd N. J., Littlewood J. M. 1996. Role of anti-pseudomonal antibiotics in the emergence of
Stenotrophomonas maltophilia in cystic brosis patients . Eur. J. Clin. Microbiol. Infect. Dis. 15:402405.
60. Deplano A., Rodriguez-Villalobos H., Glupczynsky Y., et al. 2007. Emergence and dissemination of
multidrug-resistant clone of Pseudomonas aeruginosa producing VIM-2 metallo--lactamase in Belgium.
Euro Surveill. 12 (3): E070118.2.
61. Devaud M., Kayser F. H., Bachi B. 1982. Transposon-mediated multiple antibiotic resistance in
Acinetobacter strains. Antimicrob Agents Chemother 22: 323329.
62. Dinesh S.D., Grundmann H., Pitt T.L., Rmling U. 2003. Europen-wide distribution of Pseudomonas
aeruginosa clone C. Clin Microbiol Infect. 12:1228-1233.
63. Docquier J.D., Lamotte-Brasseur J., Galleni M., Amicosante G., Frere J.M., Rossolini G.M. 2003. On
functional and structural heterogeneity of VIM -type metallo--lactamases. J. Antimicrob. Chemother. 51:
257- 66.
64. Docquier J.D., Riccio M.L., Mugnaioli C., et al. 2003. IMP-12 a new plasmid-encoded metallo-lactamase from a Pseudomonas putida clinical isolate. Antimicrob. Agents Chemother. 47: 1522-28.
65. Doi Y., Wachino J., Yamane K., Shibata N., Yagi T., Shibayama K.,Kato H., Arakawa Y. 2004. Spread of
novel aminoglycoside resistance gene aac(6')-Iad among Acinetobacter clinical isolates in Japan.
Antimicrob Agents Chemother. 48:20752080.

162

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
66. Donald H. M., Scaife W., Amyes S. G., Young H. K. 2000. Sequence analysis of ARI-1, a novel OXA lactamase, responsible for imipenem resistance in Acinetobacter baumannii 6B92. Antimicrob Agents
Chemother. 44:196199.
67. Drancourt M., Bollet C., Raoult D. 1997. Stenotrophomonas africana sp. nov., an opportunistic human
pathogen in Africa. Int. J. Syst. Bacteriol. 47:160163.
68. Dubois V., Arpin C., Noury P., Quentin C. 2002a. Clinical strain of Pseudomonas aeruginosa carrying a
blaTEM-21 gene located on a chromosomal interrupted TnA type transposon. Antimicrob Agents
Chemother. 46: 3624-3626.
69. Dubois V., Poirel L., Marie C., Arpin C., Nordmann P., Quetin C. 2002b. Molecular characterization of a
novel class 1 integron containing bla GES-1 and a fused product of aac3Ib/aac6'-Ib' genes cassettes in
Pseudomonas aeruginosa. Antimicrob Agents Chemother. 46: 638-645.
70. Duggan J.M., Goldstein S.J., Chenoweth C.E., Kauffman C.A., Bradley S.F. 1996. Achromobacter
xyloosidans bacteremia: reportof four cases and review of the literature. Clin Infect Dis. 23:56976.
71. Duljasz W., Gniadkowski M., Sitter S., Wojna A., Jebelean C. 2009. First organism with acquired
metallo--lactamases (IMP-13, IMP-22 and VIM-2) reported in Austria. Antimicrob. Agents Chemother.
53:2221-22.
72. Dworkin R.J. 2009. Aminoglycosides for the treatment of gram-negative infections: therapeutic use,
resistance and future outlook. Drug Resist Updates. 2:173179.
73. Efrekar R.F., Hosseini-Mazinani S.M., Ghandili S., Hamraz M., Zamani S. 2005. PCR detection of
plasmid mediated TEM, SHV and AmpC -lactamases in community and nosocomial urinary isolates of
Escherichia coli. Iranian J Biotech. 3(1): 48-54.
74. Elting L. S., Khardori N., Bodey G. P., Fainstein V. 1990. Nosocomial infection caused by Xanthomonas
maltophilia: a case-control study of predisposing factors. Infect. Control Hosp. Epidemiol. 11:134138.22.
75. Engel J., McMorran B., Town L., Costelloe E., Palmer J., Hume D., Wainwright B. 2003. Effector ExoU
from the type III secretion system is an important modulator of gene expression in lung epithelial cells in
response to Pseudomonas aeruginosa infection. Infect Immun .71(10): 6035-44.
76. Falagas M.E., Kastoris A.C., Karageorgopoulos D.E., Rafallidis P.I. 2009. Fosfomycin for the treatment of
infections caused by multidrug resistantant Gram negative non fermenting bacilli: a systematic review of
microbiological, animal and clinical studies. International Journal of Antimicrobial Agents. 32(2): 111120.
77. Fournier P. E., Richet H. 2006. The epidemiology and control of Acinetobacter baumannii in health care
facilities. Clin. Infect. Dis. 42: 692699.
78. Frederiksen B., Hoiby N., Koch C. 1995. Stenotrophomonas (Xanthomonas) maltophilia at the Danish
Cystic Fibrosis Centre 19741993. Pediatr. Pulmon. Suppl. 12: 287.
79. Garcia A., Sierra M. F., Friberg J. 1981. Survival of bacteria after freezing of human semen in liquid
nitrogen. Fertil. Steril. 35: 549551.
80. Garcia-Garmendia J. L., Ortiz-Leyba C., Garnacho-Montero J., Jimenez-Jimenez F. J., Perez-Paredes C.,
Barrero-Almodovar A. E., Gili-Miner M. 2001. Risk factors for Acinetobacter baumannii nosocomial
bacteremia in critically ill patients: a cohort study. Clin. Infect. Dis. 33: 939946.
81. Gardner P., Grifn W. B., Swartz M. N., Kunz L. J. 1970. Non-fermentative gram-negative bacilli of
nosocomial interest. Am. J. Med. 48: 735749.
82. Gerner-Smidt P., Bruun B., Arpi M., Schmidt J. 1995. Diversity of nosocomial Xanthomonas maltophilia
(Stenotrophomonas maltophilia) as determined by ribotyping. Eur. J. Clin. Microbiol. Infect. Dis. 14: 137
140.
83. Gheorghe I., Czobor I., Chifiriuc M.C., Borcan E., Ghi C., Banu O., Veronica Lazr V., Mihescu G.,
Mihilescu D.F., Zhiyong Z. 2014a . Molecular screening of carbapenemase - producing Gram negative
strains in Roumanian intensive care units during one year survey. J Med Microbiol. Published online ahead
of print July 24, 2014.
84. Gheorghe I., Chifiriuc M.C., Cotar A.I., Lazr V. 2014b. Extended-spectrum Beta-lactamase Production in
Pseudomonas aeruginosa and Acinetobacter baumannii Strains: Epidemiology, Molecular
Characterization and Novel Proteomics-based Diagnostic Tools. Current Proteomics. 11 (2).
85. Giakkoupi P., Tzouvelekis L.S., Tsakris A., Loukova V., Sofianou D., Tzelepi E. 2000. IBC-1, a novel
integron-associated class A -lactamase with extended-spectrum properties produced by an Enterobacter
cloacae clinical strain. Antimicrob Agents Chemother. 44: 2247-2253.
86. Gilardi G. L. 1969. Pseudomonas maltophilia infections in man. Am. J. Clin. Pathol. 51: 5861.

163

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
87. Gilardi, G. L. 1971. Characterization of nonfermentative nonfastidious gram-negative bacteria
encountered in medical bacteriology. J. Appl. Bac-teriol. 34: 623644.
88. Gilligan P.H., Lum G., Vandamme P.A.R., Whittier S. 2003. Burkholderia, Stenotrophomonas, Ralstonia,
Brevundimonas, Comamonas, Delftia, Pandoraea and Acidovorax. In Manual of Clinical Microbiology 8th
edition. Edited by: Murray P.R.,Baron E.J., Jorgensen J.H., Pfaller M.A., Yolken R.H. Washington:
American Society of Microbiologie. 32: 729-748.
89. Girlich D., Naas T., Leelaporn A., Poirel L., Fennewald M., Nordmann P. 2002. Nosocomial spread of the
integron-located VEB-1like cassette encoding an extended-spectrum -lactamases in Pseudomonas
aeruginosa in Thailand. Clin. Infect. Dis. 34: 603-611.
90. Girlich D., Naas T., Nordmann P. 2004. OXA-60, a chromosomal, inducible, and imipenem-hydrolyzing
class D -lactamase from Ralstonia pickettii. Antimicrob Agents Chemother. 48: 42174225.
91. Gladman G., Connor P. J., Williams R. F., David T. J. 1992. Controlled study of Pseudomonas cepacia
and Pseudomonas maltophilia in cystic brosis. Arch. Dis. Child. 67: 192195.
92. Goldstein F. W., Labigne-Roussel A., Gerbaud G. et al. 1983. Transferable plasmid-mediated antibiotic
resistance in Acinetobacter. Plasmid 10:138-147.
93. Gordon G., Indeck M., Bross J., Kapoor D. A., Brotman S. 1988. Injury from silage wagon accident
complicated by mucormycosis. J. Trauma 28: 866867.
94. Greenwood D. 1998. Resistance to antimicrobial agents: a personal view. J. Med. Microbiol. 47: 751-755.
95. Grosso F., Quinteira S., Peixe L. 2011. Understanding the dynamics of imipenem-resistant Acinetobacter
baumannii lineages in Portugal. Clin Microbiol Infect. 17(8): 1275-9.
96. Gu B., Tong M., Zhao W., et al. 2007. Prevalence and characterization of class 1 integrons among
Pseudomonas aeruginosa and Acinetobacter baumannii isolates from patients in Nanjing, China. J. Clin.
Microbiol. 45: 241-3.
97. Gundi A., Dijkshoorn L., Burignat S et al. 2009. Validation of partial rpoB gene sequence analysis for the
identification of clinically important and emerging Acinetobacter species. Microbiology. 155(Pt 7): 233341.
98. Hall B.G., Barlow M. 2005. Revised Ambler classification of -lactamases. Journal of Antimicrobial
Chemotherapy. 55(6): 1050-1051.
99. Hall J., Schmidt G., Wood L. 2005. Principles of crotical care, 3 rd. Ed. Th. McGraw-Hill Company, USA.
100. Hall R.M., Collis C.M. 1995. Mobile genes cassettes and integrons: capture and spread of genes by sitespecific recombination. Mol. Microbiol. 15: 593-600.
101. Hall R.M., Collis C.M. 1998. Antibiotic resistance in gram-negative bacteria: the role of gene cassettes
and integrons. Drug Resist Updates 1:109119.
102. Hamidian M, Hall RM. 2011. AbaR4 replaces AbaR3 in a carbapenem-resistant Acinetobacter baumannii
isolate belonging to global clone 1 from an Australian hospital. J Antimicrob Chemother. 66: 248491.
103. Hamidian M., Holt K. E., Pickard D., Dougan G., Hall R. M. 2013. A GC1 Acinetobacter baumannii
isolate carrying AbaR3 and the aminoglycoside resistance transposon TnaphA6 in a conjugative plasmid. J
Antimicrob Chemother.13: 1-4.
104. Hammami S., Gautier V., Ghozzi R., Da Costa A. ,Ben-Redjeb S., Arle G. 2010. Diversity in VIM-2encoding class 1 integrons and occasional bla SHV2a carriage in isolates of a persistent, multidrugresistant
Pseudomonas aeruginosa clone from Tunis. Clinical Microbiology and Infection. 16(2): 189-192.
105. Hancock R.E. 1998. Resistance mechanisms in Pseudomonas aeruginosa and other nonfermentative gramnegative bacteria. Clin Infect Dis. 27(Suppl. 1): S939.
106. Hansen F., Justesen U.S., stergaard C., Johansen H. K., Arpi M., Hansen D. S., Littauer P., Holm A.,
Heltberg O., Schumacher H., Fuursted K., Lykke M.-A. D., Tnning B., Hammerum A. M. 2011.
Characterisation of carbapenem non-susceptible Pseudomonas aeruginosa isolates in Danish hospitals; a
nationwide study. P1697.
107. Herlea V. 1998. Microbiologie general. Editura Universitii. Bucureti. 271p.
108. Heritier C., Dubouix A., Poirel L., Marty N., Nordmann P. 2005. A nosocomial outbreak of Acinetobacter
baumannii isolates expressing the carbapenem-hydrolysing oxacillinase OXA-58. J. Antimicrob
Chemother. 55: 115118.
109. Heritier C., Poirel L., Fournier P.-E., Claverie J.-M., Raoult D., Nordmann P. 2005. Characterization of
the naturally occurring oxacillinase of Acinetobacter baumannii. Antimicrob Agents Chemother. 49:
41744179.

164

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
110. Higgins P.G., Dammhayn C., Hacke M., Seifert H. 2010. Global spread of carbapenem- resistant
Acinetobacter baumannii. J. Antimicrob. Chemother. 65: 233-238.
111. Hilf M., Yu V.L., Sharp J., Zuraleff J.J., Korvick J.A. 1989. Antibiotic therapy for Pseudomonas
aeruginosa bacteriemia: outcome correlations in a prospective study of 200 pacients. Am J Med. 87: 5406.
112. Hooper D.C.1999. Mechanisms of fluoroquinolone resistance. Drug Resist Updates. 2: 3855.
113. Hotelling H. 1933. Analysis of a complex of statistical variables into principal components. J. Educ.
Psychol. 25: 417441.
114.Houang E. T., Chu Y. W., Leung C. M., et al. 2001. Epidemiology and infection control implications
of Acinetobacter spp. in Hong Kong. J. Clin. Microbiol. 39:228-234.
115. Huang T.-P., Somers E.B., Wong A.C.L. 2006. Differential biolm formation and motility associated with
lipopolysaccharide/exopolysaccharidecoupled biosynthetic genes in Stenotrophomonas maltophilia. J.
Bacteriol. 188: 3116 3120.
116. Hugh R., Gilardi G. L. 1980. Pseudomonas. In E. H. Lennette, A. Balows, W. Hausler, Jr., and J. P. Truant
(ed.), Manual of clinical microbiology, 3rd ed. American Society for Microbiology, Washington, D.C. 288
317.
117. Hugh R., Leifson E. 1963. A description of the type strain of Pseudomonas maltophilia. Int. Bull.
Bacteriol. Nomencl. Taxon. 13:133138.
118. Hugh R., Ryschenkow E. 1960. An Alcaligenes-like Pseudomonas species. Bacteriol. Proc. pp. 78.
119. Hugh R., Ryschenkow E. 1961. Pseudomonas maltophilia, an Alcaligenes-like species. J. Gen. Microbiol.
26: 123132.
120. Idomir M., Nemet C., Pascu A., Ardeleanu M. 2009. Acinetobacter spp.- pathogenic role and resistance to
antibiotics. Bulletin of Transilvania. University of Brasov. 2(51): 55-58.
121. Iizuka H., Komagata K.. 1964. Microbiological studies on petroleum and natural gas. I. Determination of
hydrocarbon-utilizing bacteria. J. Gen. Appl. Microbiol.10:20722151.
122. Israil A., Chifiriuc C., Palade G., Cotar A. 2013. Clinical and bacteriological aspects of bacterial
infections associated to abdominal surgical emergencies. Ars Docenti Publ. House. pp. 150.
123. Jacoby G.A., Munoz-Price L.S. 2005. The new -lactamases. N Engl J Med. 352: 380-91.
124. Jang, T.-N., Wang F.-D., Wang L.-H., Liu C.-Y., Liu I.-M. 1992. Xanthomonas maltophilia bacteremia:
an analysis of 32 cases. J. Formosan Med. Assoc. 91: 11701176.
125. Jalal S., Wretllind B. 1998. Mechanism of quinolone resistance in clinical strains of Pseudomonas
aeruginosa. Microb Drug Resist. 4(4): 257-61
126. Jeannot K., Guessennd N., Fournier D., Muller E., Gbonon V., Plesiat P. 2013. Outbreak of metallo-lactamase VIM-2-positive strains of Pseudomonas aeruginosa in the Ivory Coast. J. Antimicrob. Chemoter.
68(12): 2952-2954.
127. Jehl F., Chomarat M., Weber M., Gerard A. 2010. De la antibiogram la prescripie, Editura tiinelor
Medicale, ed. a 3a, Bucureti. pp. 139.
128. Jiang X., Ni Y., Jiang Y., Yuan F., Han L., Li M., et al. 2005.Outbreak of infection caused by
Enterobacter cloacae producing the novel VEB-3 beta-lactamase in China. J Clin Microbiol. 43: 826-831.
129. John E., Mc Gowan Jr. 2006. Resistance in non fermenting Gram negative bacteria: Multidrug resistance
to the maximum. The American Journal of Medicine. 119: 29-36.
130. Johnson J. K., Arduino S. M., Stine O. C., Johnson J. A., Harris A. D. 2007. Multilocus sequence typing
compared to pulsed-field gel electrophoresis for molecular typing of Pseudomonas aeruginosa. J Clin
Microbiol. 45: 3707-3712.
131. Joly-Guillo M. L. 2005. Clinical impact and pathogenicity of Acinetobacter. Clin. Microbiol. Infect. 11:
868873.
132. Jovcic B., Vasiljevcic Z., Djukic S et al. 2011. Emergence of VIM-2 metallo beta- lactamase producing
Pseudomonas aeruginosa isolates in a paediatric hospital in Serbia. J Med Microbiol. 60(6): 868-869.
133. Juan C., Beceiro A., Gutierrez O et al. 2008. Characterization of new metallo--lactamase VIM-13 and its
integron-borne gene from a Pseudomonas aeruginosa clinical isolate in Spain. Antimicrob. Agents
Chemother. 52: 3589-96.
134. Jucker B.A., Harms H., Zehnder A.J.B. 1996. Adhesion of the positively charged bacterium
Stenotrophomonas (Xanthomonas) maltophilia 70401 to glass and Teon. J. Bacteriol. 178: 54725479.

165

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
135. Jury K.L., Vancov T., Stuetz R.M., Khan S.J. 2010. Antibiotic resistance dissemination and sewage
treatment plants. Current Research, Technology and Education Topics in Applied Microbiology and
Microbial Biotechnology. 509-519.
136. Karah N., Haldorsen B., Hermansen N.O., Tveten Y et al. 2011. Emergence of OXA-carbapenemase- and
16S rRNA methylase-producing international clones of Acinetobacter baumannii in Norway. Journal of
Medical Microbiology 60: 515521.
137. Karthika U.R., Srinivasa Rao R., Sahoo S., Shashikala P., Kanungo R., Jayachandran S., Prashanth K.
2009. Phenotypic and Genotypic assays for detecting the prevalence of Metallo--lactamases in clinical
isolates of Acinetobacter baumannii from a South Indian tertiary care hospital. Journal of Medical
Microbiology. 58(4): 430-435.
138. Khardori N., Elting L., Wong E., Schable B., Bodey G. P. 1991. Nosocomial infections due to
Xanthomonas maltophilia (Pseudomonas maltophilia) in patients with cancer. Rev. Infect. Dis. 12: 997
1003.
139. Khosravi Y., Tay T.S., Vadivelu J. 2011. Analysis of integrons and associated gene cassettes of metallo-lactamase-positive Pseudomonas aeruginosa in Malaysia. Journal of Medical Microbiology. 60: 988994.
140. Kiska D.L., Gilligan P.H. 2003. Pseudomonas. In: Manual of Clinical Microbiology, 8th ed. Murray PR et
al (editors). ASM Press.
141. Kolayli F., Gacar G., Karadenizli A., Sanic A., Vahaboglu H. 2005. PER-1 is still widespread in Turkish
hospitals among Pseudomonas aeruginosa and Acinetobacter spp. FEMS Microbiol. Lett. 249: 241-245.
142. Komagata K., Yabuuchi Y., Tamagawa V., Ohyama A. 1974. Pseudomonas melanogena Iizuka and
Komagata 1963, a later subjective synonym of Pseudomonas maltophilia Hugh and Ryschenkow 1960. Int.
J. Syst. Bacteriol. 24: 242247.
143. Kotra L.P., Haddad J., Mobashery S. 2000. Aminoglycosides: perspectives on mechanisms of action and
resistance and strategies to counter resistance. Antimicrob Agents Chemother. 44: 32493256.
144. Krizova L., Dijkshoorn L., Nemec A. 2011. Diversity and Evolution of AbaR Genomic Resistance Islands
in Acinetobacter baumannii Strains of European Clone. Antimicrob Agents and Chemotheraphy. 55(7):
32013206.
145. Kulakov L.A., McAlister M.B., Ogden K.L., Larkin M.J., OHanlon J.F. 2002. Analysis of bacteria
contaminating ultrapure water in industrial systems. Appl. Environ. Microbiol . 68(4): 1548-1555.
146. Lacey S., Want S.V. 1991. Pseudomonas pickettii infections in a paediatric oncology unit. J. Hosp. Infect.
17(1): 45-51.
147. Lai C.-H et al. 2006. Central venous catheter-related Stenotrophomonas maltophilia bacteraemia and
associated relapsing bacteraemia in haematology and oncology patients. Clin. Microbiol. Infect. 12: 986
991.
148. Laing, F. P. Y., Ramotar K., Read R. R., Aleri N., Kureishi A., Henderson E. A., Louie T. J. 1995.
Molecular epidemiology of Xanthomonas maltophilia colonization and infection in the hospital
environment. J. Clin. Microbiol. 33: 513518.
149. Lam J.S., Taylor V.L., Islam S.T et al. 2011. Genetic and functional diversity of Pseudomonas aeruginosa
lipopolysaccharide. Frontiers in Microbiology. 2(118): 1-25.
150. Larson E.L. 1981. Persistent carriage of gram-negative bacteria on hands. Am J Infect Control. 9: 112-9.
151. Lazr V. 2003. Aderena Microbian. Editura Academiei Romne.
152. Lazr V. 2001. Microbiologie medical. Note de curs i principii de diagnostic microbiologic . Edit.
Universittii din Bucureti. Bucureti. pp. 205-214; 247-249.
153. Lazr V., Cernat R., Balotescu M.C., Herlea V., Bulai D., Moraru A. 2004. Microbiologie General.
Manual de lucrri practice. Editura Universitii din Bucureti. Bucuresti.
154. Lee J.C., Koerten H., van den Broek P et al. 2006. Adherence of Acinetobacter baumannii strains to
human bronchial epithelial cells. Research Microbiology.157(4): 360366.
155. Libisch B., Gacs M., Csiszar K., Muzslay M., Rokusz L., Fuzi M. 2005. Isolation of a integron-borne
blaVIM-4 type metallo--lactamase gene from a carbapenem-resistant Pseudomonas aeruginosa clinical
isolate in Hungary. Antimicrob. Agents Chemother. 48: 3576-78.
156. Liebert C.A., Hall R.M., Summers A.O. 2009. Transposon Tn21, flagship of the floating genome.
Microbiol Mol Biol Rev. 63: 507522.
157. Levin A. S., Mendes C. M., Sinto S. I., et al. 1996. An outbreak of multiresistant Acinetobacter
baumanii in a university hospital in Sao Paulo, Brazil. Infect. Control Hosp. Epidemiol. 17:366-368.

166

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
158. Lin S., Thomas M., Shlaes D.M., Rudin S.D., Knox J.R., Anderson V., Bonomo R.A. 1998. Kinetic
analysis of an inhibitor-resistant variant of the OHIO-1 -lactamase, an SHV-family class A enzyme.
Biochem J . 333: 395400.
159. Lipuma J., Spilker Th., Gill L., Preston W., Campbell I., Lui L., Mahenthiralingam E. 2001.
Disproportionate distribution of B. cepacia complex species and trepartansmissibility markers in cystic
fibrosis. Departam. of Pediatrics and Communicable Disease, University of Michigan Medical School. 9296.
160. Livermore D.M. 2001. Of Pseudomonas, porins, pumps and carbapenems. J Antimicrob Chemother.
47(3): 247-250.
161. Livermore D.M., Canton R., Gnidkowski M., Nordmann P., Rossolini G.M., Arlet G., Ayla J., Coque
T.M., Kern-Zdanowicz I., Luzzaro F., Poirel L., Woodford N. 2007. CTX-M: changing the face of ESBLs in
Europe. J. Antimicrob Chemother. 59: 165-174.
162. Livermore D.M., Paterson D. 2006. Extended-spectrum--lactamase in resistance. Current Medicine
Group. Ltd. 3.
163. Lockhart S.R., Abramson M.A., Beekmann S.E et al. 2007. Antimicrobial resistance among gramnegative bacilli causing infections in intensive care unit patients in the United States between 1993 and
2004. J Clin Microbiol 45: 3352-3359.
164. Lopez-Otsoa F., Gallego L., Towner K. J., Tysall L., Woodford N., Livermore D. M. 2002. Endemic
carbapenem resistance associated with OXA-40 carbapenemase among Acinetobacter baumannii isolates
from a hospital in northern Spain. J. Clin. Microbiol. 40: 47414743.
165. Loveleena, Chaudhry R., Dhawan B. 2004. Melioidosis; the remarkable imitator: recent perspectives. J.
Assoc. Physicians India 52: 417420.
166. Looveren V.M., Goossens H. 2004. Antimicrobial resistance of Acinetobacter spp. in Europe. Clin.
Microbiol. Infect. 10:684-704.
167. Magiorakos A.P., Srinivasan A., Carey R.B., Carmeli Y., Falagas M.E., Giske C.G., Harbarth S., Hindler
J.F., Kahlmeter G., Olsson-Lilijequist B., Paterson D.L., Rice L.B., Stelling J., Struelens M.J., Vatopolus
A., Weber J.T., Monnet D.L. 2012. Multidrug-resistant, extensively drug-resistant and pandrug-resistant
bacteria: an international expert proposal for iterim standard definitions for acquired resistance. Clin.
Microbiol. Infect. 18: 268-281.
168. Magret M., Lisboa T., Martin-Loeches I et al. 2011. Bacteremia is an independent risk factor for mortality
in nosocomial pneumonia: A prospective and observational multicenter study. Crit Care 15:R62.
169. Mahenthiralingam E., Teresa A., Goldberg J. 2005. The multifactorious, multireplicon Burkholderia
cepacia complex. Nature Rewieus Microbiology. 3:144-156.
170. Mammina C., Palma D.M., Bonura C et al 2012. Epidemiology and clonality of carbapenem-resistant
Acinetobacter baumannii from an intensive care unit in Palermo, Italy. BMC Research Notes. 5: 365-373.
171. Manfredi R., Nanetti A., Ferri M., Chiodo F. 2000. Pseudomonas spp. complications in patients with HIV
disease: an eight-year clinical and microbiological survey. Eur J Epidemiol. 16: 111118.
172. Marque S., Poirel L., Heritier C., Brisse S., Blasco M. D., Filip R., Coman G., Naas T., Nordmann P.
2005. Regional occurrence of plasmid mediated carbapenem-hydrolyzing oxacillinase OXA-58 in spp. in
Europe. J. Clin. Microbiol. 43: 48854888.
173. Mazel D. 2006. Integrons : agents of bacterial evolution. Nature Reviews Microbiology. 4: 608-620.
174. Mazzariol A., Mammina C., Koncan R et al. 2010. A novel VIM-type metallo--lactamase (VIM-14) in a
Pseudomonas aeruginosa clinical isolate from a neonatal intensive care unit. Clin. Microbiol. Infect. 16:
112-22.
175. McKay G.A., Woods D.E., MacDonald K.L., Poole K. 2003. Role of phosphoglucomutase of
Stenotrophomonas maltophilia in lipopolysaccharide biosynthesis, virulence, and antibiotic resistance.
Infect. Immun. 71: 30683075.
176. Mendes R.E., Castanheira M., Pignatari A.C.C., Gales A.C. 2006. Metalo--lactamases. J Bras Patol Med
Lab. 42:103-13.
177. Mereu A.I., Bdescu A.C., Dorneanu O.S., Iancu L.S., Tuchilu C.G. 2013. Spread of VIM-2 metallobeta-lactamase in Pseudomonas aeruginosa and Acinetobacter baumannii clinical isolates from Iai,
Romnia. Revista Romn de Medicin de Laborator. 21(4): 389-396.
178. Michalopoulos A., Falagas M.E. 2010. Treatment of Acinetobacter infections. Expert Opin Pharmacother.
11(5): 779-88.

167

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
179. Midilli K., Aygun G., Kuskucu M et al. 2003. A new variant of metallo--lactamase detected in a
Klebsiella pneumoniae strain: VIM-5. KLIMIK Congress; Istambul, Turkey. S-21.
180. Mihescu G., Chifiriuc M.C., Diu L.M. 2007. Antibiotice i substante chimioterapeutice antimicrobiene.
Edit. Academiei Romne. Bucureti. pp. 365.
181. Mishra K.S., Rijal B.P., Pokhrel B.M. 2013. Emerging threat of multidrug resistant bugs Acinetobacter
calcoaceticus baumannii complex and Methicillin resistant Staphylococcus aureus. BMC Research Notes.
6: 98.
182. Morrison A. J., Hoffmann Jr. K. K., Wenzel R. P. 1986. Associated mortality and clinical characteristics
of nosocomial Pseudomonas maltophilia in a university hospital. J. Clin. Microbiol. 24: 5255.
183. Mugnier P.D., Poirel L., Naas T., Nordmann P. 2010. Worldwide dissemination of the bla OXA-23
carbapenemase gene of Acinetobacter baumannii. Emerging Infectious Diseases. 16(1): 35-40.
184. Munoz-Price L.S., Weinstein R.A. 2008. Acinetobacter infection. N. Engl .J. Med 358: 1271-1281.
185. Naas T., Coignard B., Carbonne A., Blankaert K., Bajolet O., Bernet C., Verdeil X., et al. 2006b. VEB-1
extended-spectrum -lactamase-producing Acinetobacter baumannii, France. Emerg. Infect. Dis. 12: 12141222.
186. Naas T., Benaoudia F., Massaurd S., Nordmann P. 2001. Integron-located VEB-1 extended spectrum lactamase gene in a Proteus mirabilis clinical isolate from Vietnam. J Antimicrob Chemother. 46 : 703711.
187. Naas T., Mikami Y., Imai T., Poirel L., Nordmann P. 2001. Characterization of In53, a class 1 plasmidand composite transposon- located integron of Escherichia coli which carries un unusual array of genes
cassettes. J. Bacteriol. 183: 235-249.
188. Naas T., Philippon L., Poirel L., Ronco E., Nordmann P. 1999. An SHV-derived extended spectrum lactamase in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 43: 1281-4.
189. Naas T., Poirel ., Nordmann P. 2008. Minor extended-spectrum -lactamases. Clin. Microbiol. Infect.
14(Suppl. 1): 42-52.
190. Naeem T., Absar M., Somily A.M. 2012. Antibiotic resistance among clinical isolates of
Stenotrophomonas maltophilia at a teaching hospital in Riyadh, Saudi Arabia. J. Ayub. Med. Coll.
Abbottabad. 24(2): 30-33.
191. Nagano N., Nagano Y., Cordevant C., Shibata N., Arakawa Y. 2004. Nosocomial transmission of CTX-M2 -lactamase-producing Acinetobacter baumannii in a neurosurgery ward. J. Clin. Microbiol. 42: 39783984
192. Neal D.J., Wilkinson S.G. 1982. Lipopolysaccharides from Pseudomonas maltophilia. Structural studies of
the side-chain, core, and lipid-A regions of the lipopolysaccharide from strain NCTC 10257. Eur.
J.Biochem. 128: 143149.
193. Nerad J.L., Seville M.T., Snydman D.R. 1998. Miscellaneousgram-negative bacilli: Acinetobacter,
Cardiobacterium, Actinobacillus, Chromobacterium, Capnocytophaga, and others. In: Gorbach SL,
Bartlett JG, Bladlow NR, eds.Infectious Diseases, 2nd edn, W.B. Saunders, Philadelphia. 187187.
194. Nesme X., Vaneechoutte M., Orso S., Hoste B., Swings J. 1995. Diversity and genetic relatedness within
genera Xanthomonas and Stenotrophomonas using restriction endonuclease site differences of PCRamplied 16S rRNA gene . Syst. Appl. Microbiol. 18: 127135.
195. Nevers P., Saedler H. 1977. Transposable genetic elements as agents of gene instability and chromosomal
rearrangements. Nature. 14: 109-115.
196. Nigro S.J., Post V., Hall R.M. 2011. Aminoglicoside resistance in multiply antibiotic-resistant
Acinetobacter baumannii belonging to global clone 2 from Australian hospitals. J Antimicrob Chemother.
66: 1504-1509.
197. Nord C.-E., Sjoberg L., Wadstrom T., Wretlind B. 1975. Characterization of three Aeromonas and nine
Pseudomonas species by extracellular enzymes and haemolysins. Med. Microbiol. Immunol. 161: 7987.
198. Nordmann P., Dortet L., Poirel L. 2011. Carbapenem resistance in Enterobacteriaceae: here is the storm!
Trends. Mol. Med. 18: 263-72.
199. Nordmann P., Ronco E., Naas T., Duport C., Michel-Briand Y., Labia R. 1993. Characterization of a
novel extended-spectrum -lactamases in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 37:
962-969.
200. Nordmann, P. 2004. Acinetobacter baumannii, the nosocomial pathogen par excellence. Pathol. Biol.
(Paris) 52: 301303.

168

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
201. Otto L.A., Deboo B.S., Capers E.L., Pickett M.J. 1987. Pseudomonas vesicularis from cervical specimens.
J. Clin. Microbiol. 7: 341-345.
202. Palleroni, N. J., Bradbury J. F. 1993. Stenotrophomonas, a new bacterial genus for Xanthomonas
maltophilia (Hugh 1980) Swings et al. 1983. Int. J. Syst. Bacteriol. 43: 606609.
203. Palmen R., Hellingwerf K. J. 1997. Uptake and processing of DNA by Acinetobacter calcoaceticusa
review. Gene 192:179-190.
204. Papagiannitsis C.C., Studentova V., Ruzicka F., Tejkalova R., Hrabak J. 2013. Molecular
characterization of metallo--lactamase producing Pseudomonas aeruginosa in a Czech hospital (20092011). J Med Microbiol. 62(Pt 6): 945-7.
205. Partidge S.R., Tsafnat G., Coiera E., Iredell R. 2009. Gene cassettes and cassette arrays in mobile
resistance integrons. FEMS Microbiol Rev. 33: 757-784.
206. Partridge S.R. 2011. Analysis of antibiotic resistance regions in Gram negative bacteria. FEMS Microbiol
Rev. 35: 820-855.
207. Partridge S.R., Zong Z., Iredell J.R. 2011. Recombination in IS26 and Tn2 in the evolution of
multiresistance regions carrying blaCTX-M-15 on conjugative IncF plasmids from Escherichia coli.
Antimicrob Agents Chemother. 55(11): 4971-8.
208. Pasteran F., Faccone D., Petroni A et al. 2005. Novel variant blaVIM-11 of the metallo--lactamase blaVIM
family in a GES-1 extended-spectrum- -lactamase-producing Pseudomonas aeruginosa clinical isolate in
Argentina. Antimicrob. Agents Chemother. 49: 474-75.
209. Paterson D.L., Bonomo R.A. 2005. Extended-spectrum -lactamases: a clinical update. Clinical
Microbiology Reviews. 18(4): 657-686.
210. Paton R., Miles R. S., Hood J., Amyes S. G. B. 1993. ARI 1: -lactamase-mediated imipenem resistance in
Acinetobacter baumannii. Int. J.Antimicrob. Agents 2: 8187.
211. Peleg A.Y., Seifert H., Paterson D. 2008. Acinetobacter baumannii: Emergence of a successful pathogen.
Clinical Microbiology Reviews. 21(3): 538-582.
212. Pena C., Suarez C., Tabau F et al. 2007. Nosocomial spread of Pseudomonas aeruginosa producing the
metallo--lactamase VIM-2 in a Spanish hospital: clinical and epidemiological implications. Clin.
Microbiol. Infect. 13: 1026-29.
213. Penland R.L., Wilhemus K.R. 1996. Stenotrophomonas maltophilia ocular infections. Arch. Ophthalmol.
114: 433436.
214. Philippon A., Arlet G., Jacoby G.A. 2002. Plasmid-determined AmpC-type -lactamases. Antimicrob
Agents Chemother. 46: 1-11.
215. Pires J., Novais A., Peixe L. 2013. Blue-carba, an easy biochemical test for detection of diverse
carbapenemase producers directly from bacterial cultures. J. Clin. Microbiol. 51(12): 4281-3.
216. Planes A.M., Ramirez A., Fernandez F., Capdevila J.A., Tolosa C. 1992. Pseudomonas vesicularis
bacteraemia. Infection. 20: 367-368.
217. Poirel L., Bonnin R., Nordmann P. 2012. Genetic support and diversity of acquired extended-spectrum lactamases in Gram negative rods. Infection, Genetics and Evolution. 12: 883-893.
218. Poirel L., Brinas L., Verlinde A., Ide L., Nordmann P. 2005. BEL-1, a novel clavulanic acid-inhibited
extended-spectrum -lactamase, and the class 1 integron In120 in Pseudomonas aeruginosa. Antimicrob
Agents Chemother. 49: 3743-3748.
219. Poirel L., Marque S., Heritier C., Segonds C., Chabanon G., Nordmann P. 2005. OXA-58, a novel class D
-lactamase involved in resistance to carbapenems in Acinetobacter baumannii. Antimicrob Agents
Chemother. 49: 202208.
220. Poirel L., Cabanne L., Vahaboglu H., Nordmann P. 2005. Genetic environment and expression of the
extended-spectrum -lactamase blaPER-1 gene in gram-negative bacteria. Antimicrob. Agents Chemother.
49:1708-1713.
221. Poirel L., Naas T., Guilbert M., Chaibi E.B., Labia R., Nordmann P. 1999. Molecular and biochemical
characterization of VEB-1, a novel class A extended-spectrum -lactamase encoded by an Escherichia coli
integron gene. Antimicrob Agents Chemother. 43: 573-581.
222. Poirel L., Naas T., Nicolas D et al. 2000. Characterization of VIM-2, a carbapenem- hydrolyzing metallo-lactamase and its plasmid and integron-borne gene from a Pseudomonas aeruginosa clinical isolate in
France. Antimicrob. Agents Chemother. 44: 891-97.

169

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
223. Poirel L., Thomas I., Naas T., Karim A., Nordmann P. 2000. Biochemical sequence analyses of GES-1, a
novel class A extended-spectrum -lactamase, and the class 1 integron In52 from Klebsiella pneumoniae.
Antimicrob Agents Chemother. 44: 622-632.
224. Poirel L., Weldhagen F., Naas T., De Champs C., Dove M.G., Nordmann P. 2001. GES-2, a class A lactamase from Pseudomonas aeruginosa with increased hydrolysis of imipenem. Antimicrob Agents
Chemother. 45: 2598-2603.
225. Poirel L., Walsh T.R., Cuvillier V., Nordmann P. 2011. Multiplex PCR for detection of acquired
carbapenemase genes. 70(1): 119-123.
226. Poirel, L., D. Girlich, Naas T., Nordmann P. 2001. OXA-28, an extended-spectrum variant of OXA-10
beta-lactamase from Pseudomonas aeruginosa and its plasmid- and integron-located gene. Antimicrob
Agents Chemother. 45: 447453.
227. Post V., White A.P., Hall1 M.R. 2010. Evolution of AbaR-type genomic resistance islands in multiply
antibiotic-resistant Acinetobacter baumannii Journal of Antimicrobial Chemotherapy. 65(6): 1162-1170.
228. Potera C. 1999. Forging a link between biolms and disease . Science. 283: 18371838.
229. Pournaras S., Tsakris A., Maniati M., Tzouvelekis L.S., Maniatis A. N. 2002. Novel Variant (blaVIM-4) of
the Metallo-beta-Lactamase Gene blaVIM-1 in a Clinical Strain of Pseudomonas aeruginosa. Antimicrobial
Agents and Chemotherapy. 46(12): 40264028.
230. Povilonis J., Seputiene V., Krasauskas R., Juskaite R., Miskinyte M., Suziedelis K., Suziedeliene E. 2013.
Spread of carbapenem-resistant Acinetobacter baumannii carrying a plasmid with two genes encoging
OXA-72 carbapenemase in Lithuanian hospitals. J. Antimicrob. Chemother. 68: 1000-1006.
231. Queenan A.M., Bush K. 2007. Carbapenemases: the versatile -lactamases. Clinical Microbiology
Reviews. 20(3): 440-458.
232. Quinn J.P.1998. Clinical problems posed by multiresistant nonfermenting gram-negative pathogens. Clin
Infect Dis. 27(Suppl. 1): S11724.
233. Quinteira S., Grosso F., Peixe L. 2011. Molecular characterisation of blaVIM-2-producing Pseudomonas
aeruginosa clinical isolates from Portugal. 21 st European Congress of Clinical Microbiology and
Infections Disease. (ECCMID) 27th International Congress of Chemotherapy (ICC).
234. Quinteira S., Peixe L. 2006. Multiniche screening reveals the clinically relevant metallo-beta-lactamase
VIM-2 in Pseudomonas aeruginosa far from the hospital setting: an ongoing dispersion process? Appl
Environ Microbiol. 72(5): 3743-5.
235. Radosaw Izdebski, Janusz Fiett, Waleria Hryniewicz ,Marek Gniadkowski. 2012. Molecular Analysis
of Acinetobacter baumannii Isolates from Invasive Infections in 2009 in Poland. J. Clin.
Microbiol. 50(11): 3813-3815 .
236. Rahmati-Bahram A., Magee J.T., Jackson S.K. 1997. Effect of temperature on aminoglycoside binding
sites in Stenotrophomonas maltophilia. J. Antimicrob.Chemother. 39: 1924.
237. Rello J., Rue M., Jubert P et al. 1997. Survival in patients with nosocomial pneumonia: impact of the
severity of illness and the etiologic agent. Crit Care Med. 25: 18621867.
238. Ribera A., Vila J., Fernandez-Cuenca F., et al. 2004. Type 1 integrons in epidemiologically unrelated
Acinetobacter baumannii isolates collected at Spanish hospitals. Antimicrob Agents Chemother. 48: 364
365.
239. Robin F., Delmas J., Brebion A., Dubois D., Constantin J.M., Bonnet R. 2007. TEM-158 (CMT-9), a new
member of the CMT-type extended-spectrum -lactamase. Antimicrob. Agents Chemother. 51: 4181-4183.
240. Rodrigues C., Novais A., Machado E et al. 2014. Detection of VIM-34, a novel VIM-1 variant identified in
the intercontinental ST15 Klebsiella pneumoniae clone. 69(1): 274-275.
241. Rossolini G.M., D'Andrea M.M., Mugnaioli C. 2008. The spread of CTX-M-type extended-spectrum lactamases. Clin. Microbiol. Infect. 14 (1): 33-41.
242. Rossolini G.M., Mantengoli E. 2005. Treatment and control of severe infections caused by multiresistant
Pseudomonas aeruginosa. Clin. Microbiol. Infect. 11:17-32.
243. Rubinstein E., Levy I. 1999. Acinetobacter spp. and othernon-fermentative pathogens causing nosocomial
infection. Clin Microb Infect. 5: 2S2932.
244. Ryan M.P., Pembroke J.T., Adley C.C. 2006. Ralstonia pickettii: a persistent gram negative nosocomial
infectious organism. J. Hosp. Infect . 62(3): 278-284.
245. Ryan M.P., Pembroke J.T., Adley C.C. 2007. Ralstonia pickettii in environmental biotechnology: potential
and applications. J .Appl. Microbiol. 103(4): 754-764.

170

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
246. Salabi A.E., Toleman M.A., Weeks J., Bruderer T., Frei R., Walsh T.R. 2010. First report of metallo- lactamase SPM-1 in Europe. Antimicrob. Agents Chem other. 54: 582.
247. Salverda M.L., De Visser J.A., Barlow M. 2010. Natural evolution of TEM-1 -lactamase: experimental
reconstruction and clinical relevance. FEMS. Microbiol. Rev. 34: 1015-1036.
248. Sagai H., Hasuda K., Iyose S., Bryan E. 1976. Classification of R plasmids by incompatibility in
Pseudomonas aeruginosa. Antimicrob Agents Chemother. 10(4): 573-578.
249. Samuelson O., Toleman M.A., Sundsfjord A., Rydberg J., Leegaard T.M., Walder M., Lia A., Ranheim
T.E., Rajendra Y., Hermansen N.O., Walsh T.R., Giske C.G. 2010. Molecular epidemiology of metallo-lactamase producing Pseudomonas aeruginosa isolates from Norway and Sweden shows import of
international clones and local clonal expansion. Antimicrobial Agents and Chemotherapy. 54(1): 346-352.
250. Sardelic S., Bedenic B., Colinon-Dupuich C., Orhanovic S., Bosnjak Z., Plecko V., Cournoyer
B.,Rossolini M.G. 2012. Infrequent Finding of Metallo--Lactamase VIM-2 in Carbapenem-2 Resistant
Pseudomonas aeruginosa Strains from Croatia. Antimicrob. Agents Chemother. 56(5): 2746-9.
251. Savitzky, A., Golay, M.J.E. 1964. Smoothing and differentiation of data by simplified least squares
procedures. Anal. Chem. 36: 1627-1639.
252. Schneider I., Keuleyan E., Rasshofer R., Markovska R., Queenan A.M., Bauernfeid A. 2008. VIM-15 and
VIM-16, two new VIM-2-like metallo--lactamases in Pseudomonas aeruginosa isolates from Bulgaria and
Germany. Antimicrob. Agents Chemother. 52: 2977-79.
253. Schneider I., Queenan A. M., Bauernfeind A. 2006. Novel carbapenem-hydrolyzing oxacillinase OXA-62
from Pandoraea pnomenusa. Antimicrob Agents Chemother. 50: 13301335.
254. Schulte B., Goerke C., Weyrich P., et al. 2005. Clonal spread of meropenem-resistant Acinetobacter
baumannii strains in hospitals in the Mediterranean region and transmission to south-west Germany. J.
Hosp. Infect. 61:356-357
255. Seward R. J., Towner K. J. 1999. Detection of integrons in worldwide nosocomial isolates of
Acinetobacter spp. Clin Microbiol Infect. 5: 308318.
256. Seward R.J., Towner K. J. 1998. Molecular epidemiology of quinolone resistance in Acinetobacter spp.
Clin. Microbiol. Infect. 4:248254.
257. Shahcheraghi F., Abbasalipour M., Feizabadi M., Ebrahimipour G., Akbari N. 2011. Isolation and genetic
characterization of metallo--lactamase and carbapenamase producing strains of Acinetobacter baumannii
from patients at Tehran hospitals. Iran J Microbiol. 3(2): 68-74.
258. Shelburme S.A. 3rd, Singh K.V., White A.C. Jr et al. 2008. Sequential outbreaks of infections by distinct
Acinetobacter baumannii strains in a public teaching hospital in Houston, Texas. J Clin Microbiol 46: 198205.
259. Siguier P., Filee J et al. 2006. Insertion sequences in prokaryotic genome. Curr Opin Microbiol. 9(5):526531.
260. Silva F.M., Cormo M.S., Silbert S., Gales A.C. 2011. SPM-1 producing Pseudomonas aeruginosa:
analysis of the ancestor relationship using Multilocus Sequence Typing, Pulsed-Field Gel Electrophoresis
and Automated Ribotyping. Microbiol.Drug.Resistance. 17(2): 215-220.
261. Skold O. 2000. Sulfonamide resistance: mechanisms and trends. Drug Resist Updates. 3: 155160.
262. Smillie C., Garcillan-Barcia M.P., Francia M.V., Rocha E.P.C. 2010. Mobility of plasmids. Microbiol.
Mol. Biol. Rev. 74(3): 434-452.
263. Sousa C., Silva L., Grosso F et al. 2014. Development of a FTIR-ATR based model for typing clinically
relevant Acinetobacter baumannii clones belonging to ST98, ST103, ST208 and ST218. J Photochem
Photobiol B. 133: 108-14.
264. Southern P. M., Schneider M. L. 1974. Pseudomonas maltophilia in clinical bacteriologic specimens.
Texas Rep. Biol. Med. 32: 880.
265. Speert D.P. 2010. Understanding Burkholderia cepacia: Epidemiology, Genomovars, and Virulence.
Medscape CME, September 1, medscape.com.
266. Stefaniuk E., Baraniak A., Gniadkowski M., Hryniewicz W. 2003. Evaluation of the BD Phoenix
automated identification and susceptibility testing system in clinical microbiology laboratory practice. Eur
J Clin Microbiol Infect Dis. 22(8):479-85.
267. Steinberg J.P., Del Rio C. 2000. Other gram-negative bacilli. In:Mandell GL, Bennet JE, Dolin R, eds.
Mandells Principlesand Practice of Infectious Diseases, 5th edn. 245974.
268. Strateva T, Yordanov D. 2009. Pseudomonas aeruginosa a phenomenon of bacterial resistance. J. Med.
Microbiol. 58(9): 1133-1148.

171

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
269. Stru M., Dinu S., Creoiu S., Lixandru B., Surdeanu M. 2010. Molecular characterization of genetic
structures surrounding blaVIM-2 gene identified in Pseudomonas aeruginosa clinical isolates from Romania.
Clin. Microbiol. Infect. 16(S2):197.
270. Sung J.Y., Koo S.H., Cho H.H., M.S. , Kwon K.C. 2012. AbaR7, a Genomic Resistance Island Found in
Multidrug-resistant Acinetobacter baumannii Isolates. in Daejeon, Korea. Ann Lab Med. 32: 324-330.
271. Swings J., De Vos P., Van den Mooter M., De Ley J. 1983. Transfer of Pseudomonas maltophilia Hugh
1981 to the genus Xanthomonas as Xanthomonas maltophilia (Hugh 1981) comb. nov. Int. J. Syst.
Bacteriol. 33: 409413.
272. Tenover F. C., Arbeit R. D., Goering R. V., Mickelsen P. A., Murray B. E., Persing D. H., Swaminathan B.
1995. Interpreting chromosomal DNA restriction patterns produced by pulsed-eld gel electrophoresis:
criteria for bacterial strain typing. J. Clin. Microbiol. 33: 22332239.
273. Toleman M. A., Bennett P. M., Bennett D.M.C., Jones R. N., Walsh T. R. 2007. Global emergence of
Trimethoprim/Sulfametoxazole Resistance in Stenotrophomonas maltophilia Mediated by Acquisition of sul
genes. Emerg. Infect. Dis. 13(4): 559-565.
274. Toleman M.A., Rolston K., Jones R.N., Walsh T.R. 2004. BlaVIM-7 an evolutionarily distinct metallo-lactamase gene in a Pseudomonas aeruginosa isolate from the United States. Antimicrob Agents
Chemother. 48: 329-32.
275. Toleman M.A., Simm A.M., Murphy T.A et al. 2002. Molecular characterization of SPM-1, a novel
metallo--lactamase isolated in Latin America: report from the SENTRY antimicrobial surveillance
programme. J. Antimicrob. Chemother. 50: 673-79.
276. Toleman M.A., Vinodh H., Sekar U., Kamat V., Walsh T.R. 2007. BlaVIM-2 harbouring integrons isolated
in India, Russia and United States arise feom an ancestral class 1 integron predating the formation of the
3' conserved sequence. Antimicrob. Agents Chemother. 51: 2636-38.
277. Tomaras A.P., Dorsey C.W., Edelmann R.E., Actis L.A. 2003. Attachment to and biofilm formation on
abiotic surfaces by Acinetobacter baumannii: involvement of a novel chaperone-usher pili assembly
system. Microbiology. 149: 34733484.
278. Towner K.J., Evans B., Villa L., Levi K., Hamouda A., Amyes S.G.B., Carattoli A. 2011. Distribution of
intrinsic plasmid replicase genes and their association with carbapenem-hydrolyzing class D -lactamase
genes in European clinical isolates of Acinetobacter baumannii. Antimicrobial Agents and Chemotherapy.
55(5): 2154-2159.
279. Turner PJ, Greenhalgh JM. MYSTIC Study Group (Europe). 2003. The activity of meropenem and
comparators against Acinetobacter strains isolated from European hospitals, 1997-2000. Clin Microbiol
Infect. 9:5637
280. Turton, J. F., Woodford N., Glover J., Yarde S., Kaufmann M. E., Pitt T. L. 2006. Identication of
Acinetobacter baumannii by detection of the bla OXA-51-like carbapenemase gene intrinsic to this species. J.
Clin. Microbiol. 44: 29742976.
281.Vahaboglu, H., Budak F., Kasap M., Gacar G., Torol S., Karadenizli A., Kolayli F., Eroglu C. 2006. High
prevalence of OXA-51-type class D -lactamases among ceftazidime-resistant clinical isolates of
Acinetobacter spp.: co-existence with OXA-58 in multiple centres. J. Antimicrob Chemother. 58: 537542.
282.Van Delden C, Iglewski BH. 1998. Cell-to-cell signaling and Pseudomonas aeruginosa infections. Emerg
Infect Dis 4(4):551-60.
283. Van Zyl E., Steyn P. L. 1992. Reinterpretation of the taxonomic position of Xanthomonas maltophilia and
taxonomic criteria in this genus. Request for an opinion. Int. J. Syst. Bacteriol. 42: 193198.
284. Vartivarian S. E., Papadakis K. A., Palacios J. A., Manning J. T., Anaissie E. J. 1994. Mucocutaneous and
soft tissue infections caused by Xanthomonas maltophilia: a new spectrum. Arch. Intern. Med. 121: 969
973.
285. Vassu T., Csutak O., Stoica I., Muat F. 2001. Genetica microorganismelor i inginerie genetic
microbian. Editura Petrion. Bucureti.
286. Vedel G. 2005. Simple method to determine beta-lactam resistance in Pseudomonas aeruginosa using the
disc agar diffusion test. Journal of Antimicrobial Chemotherapy. 56: 657-664.
287. Vidal F., Mensa J., Almela M,. Olona M,. Martinez J.A ,. Marco F,.Lopez M.J.O., Soriano A., Horcajada
J.P., Gatell J.M., Richart C. 2002. Bacteraemia in adults due to glucose non-fermentativ Gram-negative
bacilli other than P. aeruginosa. QJ Med 96: 227234.
288. Vietri N. J., Deshazer D. 2007. Melioidosis, in Medical Aspects of Biological Warfare,ed Z.F. Dembek
(Washington, DC: Borden Institute). 147166.

172

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
289. Vila J., Ruiz J., Goni P., Jimenez T. de Anta. 1997. Quinolone resistance mutations in the topoisomerase
IV parC gene of Acinetobacter baumannii. J. Antimicrob Chemother. 39: 757762.
290. Villaln P., Valdezate S., Medina-Pascual M.J., Carrasco G., Vindel A., Saez-Nieto J.A. 2013.
Epidemiology of the Acinetobacter-derived cephalosporinase, carbapenem-hydrolysing oxacillinase and
metallo--lactamase genes, and of common insertion sequences, in epidemic clones of Acinetobacter
baumannii from Spain. J Antimicrob Chemother. 68(3): 550-3.
291. Villegas M. V., Hartstein A. I. 2003. Acinetobacter outbreaks, 19772000. Infect. Control Hosp.
Epidemiol. 24: 284295.
292. Walsh T.R., Toleman M.A., Poirel L., Nordmann P. 2005. Metallo--lactamases: the quiet before the
storm? Clin. Microbiol. Rev. 18: 306-25.
293. Walther-Rasmussen, J., Hoiby N. 2006. OXA-type carbapenemases. J. Antimicrob Chemother. 57: 373
383.
294. Watanabe T., Fukasawa T. 1961. Episome-mediated transfer of drug resistance in Enterobacteriaceae:
transfer of resistance factors by conjugation. J. Bacteriol. 81(5): 669-678.
295. Weldhagen G. F., Poirel L., Nordmann P. 2003. Ambler class A extended-spectrum beta-lactamases in
Pseudomonas aeruginosa: novel developments and clinical impact. Antimicrob Agents Chemother. 47:
23852392.
296. Wellinghausen N., Kothe J., Wirths B., Sigge A., Poppert S. 2005. Superiority of molecular techniques for
identification of gram-negative, oxidase-positive rods, including morphologically nontypical Pseudomonas
aeruginosa, from patients with cystic fibrosis. J.Clin. Microbiol. 43: 4070-4075.
297. Wisplinghoff H., Edmond M.B., Pfaller M.A., Jones R.N.,Wenzel R.P., Seifert H. 2000. Nosocomial
bloodstream infectionscaused by Acinetobacter species in United States hospitals:clinical features,
molecular epidemiology and antimicrobialsusceptibility. Clin Infect Dis. 31: 6907.
298. Woodford N., Ellington M.J., Coelho J.M., Turton J.F., Ward M.E., Brown S et al. 2006. Multiplex PCR
for genes encoding prevalent OXA carbapenemases in Acinetobacter spp. Int J Antimicrob Agents. 27(4):
351-353.
299.Woodford N., Turton J. F., Livermore D. M. 2011. Multiresistant Gram-negative bacteria: the role of
high-risk clones in the dissemination of antibiotic resistance. FEMS Microbiol Rev. 35: 736755.
300. Xiaohui W., Fu Q., Rujia Y., Yanyu G., Zhiyong Z. 2013. Clonal diversity of Acinetobacter baumannii
clinical isolates revealed by a snapshot study. BMC Microbiology. 13: 234.
301. Yakupogullari Y., Poirel L., Bernabeu S., Kizirgil A., Nordmann P. 2008. Multidrug-resistant
Pseudomonas aeruginosa isolate co-expressing extended-spectrum- -lactamase PER-1 and metallo-lactamase VIM-2 from Turkey. J. Antimicrob. Chemother. 61: 221-2.
302. Yan J.J., Hsueh P.R., Ko W.C et al. 2001. Metallo--lactamases in a clinical Pseudomonas aeruginosa
isolate in Taiwan and identification of VIM-3, a novel variant of the VIM-2 enzyme. Antimicrob. Agents
Chemother. 46: 2224-28.
303. Zavascki A.P., Barth A.L., Gonalves A.L.S et al. 2006. The influence of metallo-lactamase production
on mortality in nosocomial Pseudomonas aeruginosa infections. J Antimicrob Chemother. 58(2): 387-392.
304. Zellweger C., Bodmer T., Tauber M.G., Muhlemann K. 2004. Failure of ceftriaxone in an intravenous
drug user with invasive infection due to Ralstonia pickettii. Infection. 32(4): 246-248.
305. Zhao W.H., Chen G., Ito R., Hu Z.Q. 2009. Relevance of resistance levels to carbapenems and integronborne blaIMP-1, blaIMP-7, blaIMP-10 and blaVIM-2 in clinical isolates of Pseudomonas aeruginosa. Journal of
Medical Microbiology. 58: 10801085.
306. Zuravleff J.J., Yu V.L. 1982. Infections caused by Pseudomonas maltophilia with emphasis on
bacteremia: case reports and review of the literature. Rev. Infect. Dis. 4: 12361246.
307. http://faculty.irsc.edu/FACULTY/TFischer/micro%20resources.htm.
308. http://www.lahey.org./studies.
309. http://pubmlst.org/abaumannii/.
310. http://pubmlst.org/paeruginosa/.
311. http://www.bd.com.
312. http://medscape.com
313. http://www.ncbi.nlm.nih.gov/tools/primer-blast
314. www.ecdc.europa.eu/en/activities/surveillance/EARS-Net/database.
315. www.mystic-data.org.
316. www.pda.org.bookstore.

173

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
317. www.rvm.earss.nl.
318. www.technelysium.com.au
319. https://www.google.ro/ Southern Blot jpg.
320. http://www.ebi.ac.uk/pdbe/entry-images/1bsg_cbc600.png.
321. http://www.mednet.gr./whonet.

174

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Anexe
Anexa 1. Mediile de cultur i soluiile utilizate pentru testarea tulpinilor de bacili Gram
negativi non fermentativi oportuniti

Mediu Geloz Nutritiv


Pepton
10.0g
Extract de carne
10.0g
NaCl
5.0g
Agar
20.0g
ap distilat (A.D.)
1000.0ml
pH final = 7,2 7,4
Sterilizare prin autoclavare la 121C, 20 min.
Se toarn n plci Petri sterile, se las la uscat i se verific sterilitatea prin incubare n termostat la 37 0C, 18-24h.
Este folosit pentru cultivarea unui numr mare de bacterii.
Mediu Mueller Hinton solid
Extract de carne
2.0g
Amidon
1.5g
Hidrolizat de cazein
17.5g
Agar
17.0g
A.D.
1000.0ml
pH final = 7,2 - 7,4
Sterilizare prin autoclavare la 121C, 20 min
Se toarn n plci Petri sterile, se las la uscat i se verific sterilitatea prin incubare la 37 oC, 18-24h.
Este mediu standard recomandat pentru testarea rezistenei la antibiotice a bacteriilor aerobe i facultativ anaerobe
(prin metoda difuzimetric Kirby-Bauer).
Mediu Agar Cetrimid
Pepton
20.0g
Sulfat de potasiu
10.0g
Glicerol
10.0g
Clorura de magneziu
1.4g
Fosfat monopotasic
1.0g
Cetrimid
0.3g
Agar
13.0g
A.D.
1000.0ml
pH final = 7.2 +/- 0.2
Sterilizare prin autoclavare la 1.0 atm. (121C), 20 min.
Este recomandat pentru procedeele calitative de izolare selectiv i identificare prezumtiv a speciei Pseudomonas
aeruginosa (stimuleaz pigmentogeneza, iar cetrimidul inhib dezvoltarea altor bacterii).
Tampon fosfat salin (TFS) 10X
NaCl
80g
KCl
2g
Na2HPO4
11.5g
KH2PO4
2g
A.D.
1000ml
pH=7.4 - 7.6
Mediul CLED (Cistein-Lactoz-Electrolit Deficient) este un mediu diferenial indicat pentru uroculturi i
repicri de purificare a izolatelor semnificative de pe mediile selective pentru reprezentantii familiei
Pseudomonadaceae i Enterobacteriaceae . Deficitul de electrolii previne invazia prin Proteus sp., iar adiia de
cistein amelioreaz calitile nutritive ale mediului.

175

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

Anexa 2. Secvenele ampliconilor obinui n urma experimentelor de PCR i secveniere

A. bumannii - tulpina nr. 4 (OXA-23)


CTGATTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTTACTT
GCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCAAGG
ACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAATCT
ATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTGGA
GAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATGACA
CTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAAAGA
AGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTTACGC
CTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAATA
TGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCTGG
TTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGCATC
TATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAAAGC
CCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTTACATGAGT

A. bumannii - tulpina nr. 19 (OXA-23)


CATGATTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTTA
CTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCAA
GGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAAT
CTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTG
GAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATGA
CACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAAA
GAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTTAC
GCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAA
TATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCT
GGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGC
ATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAA
AGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTTCTAGTTTAAAATTTTACATG

A. bumannii - tulpina nr. 35 (OXA-23)


GGGGACTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTTA
CTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCAA
GGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAAT
CTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTG
GAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATGA
CACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAAA
GAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTTAC
GCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAA
TATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCT
GGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGC
ATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAA
AGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTTCTAGTTTAAAATTTTACAGTGCA
GT

176

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

A. bumannii - tulpina nr. 38 (OXA-23)


GTGCTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTTACTT
GCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCAAGG
ACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAATCT
ATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATTGGA
GAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATGACA
CTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAAAGA
AGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTTACGC
CTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAATA
TGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCTGG
TTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGCATC
TATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAAAGC
CCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTTCTAGTTTAAAATTTTACATGAGT

A. bumannii - tulpina nr. 39 (OXA-23)


CATATGGTGACTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATA
TTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTG
TTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAA
TTAATCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCG
GATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGA
CATGACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCA
AAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGG
TTACGCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAA
AAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTG
GGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTATTGCATTAAATATGGAAATGCGGTCAGAAATGC
CGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTAT
AAAAAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTTTACATG
TGT

A. bumannii - tulpina nr. A (OXA-23)


GGCAAATAATTGTGGCTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAAT
AAATATTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCA
GATTGTTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAA
AAAAATTAATCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCT
GATCGGATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAA
AAAGACATGACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCT
CATGCAAAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCAT
TAAAGGTTACGCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTA
ATGTAAAAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCA
CAAGTGGGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAG
AAATGCCGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTA
ATTTTATAAAAAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTT
ACATGAGT

A. bumannii - tulpina nr. b (OXA-23)


CTTGGTGGCTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATT
TTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTT
CAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATT

177

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
AATCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGA
TTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACA
TGACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAA
AAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTT
ACGCCTATTCAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAA
ATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGC
TGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGG
CATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAA
AAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTTTACAGTGCA

A. bumannii - tulpina nr. A- clasa 1 integroni


ATCTAGCAGCAGCACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGCATCACAAAGTACAGCATCGTGACCA
ACAGCAACGATTCCGTCACACTGCGCCTCATGACTGAGCATGACCTTGCGATGCTCTATGAGTGGCTAAATCGATCTCATATCG
TCGAGTGGTGGGGCGGAGAAGAAGCACGCCCGACACTTGCTGACGTACAGGAACAGTACTTGCCAAGCGTTTTAGCGCAAGA
GTCCGTCACTCCATACATTGCAATGCTGAATGGAGAGCCGATTGGGTATGCCCAGTCGTACGTTGCTCTTGGAAGCGGGGACG
GATGGTGGGAAGAAGAAACCGATCCAGGAGTACGCGGAATAGACCAGTTACTGGCGAATGCATCACAACTGGGCAAAGGCT
TGGGAACCAAGCTGGTTCGAGCTCTGGTTGAGTTGCTGTTCAATGATCCCGAGGTCACCAAGATCCAAACGGACCCGTCGCCG
AGCAACTTGCGAGCGATCCGATGCTACGAGAAAGCGGGGTTTGAGAGGCAAGGTACCGTAACCACCCCAGATGGTCCAGCCG
TGTACATGGTTCAAACACGCCAGGCATTCGAGCGAACACGCAGTGATGCCTAACCCTTCCTGAAGCGGGAAGTCCCCAAGGGC
TGGCGCCCTTGGCCGCCACTCATGTCAAACGTTAGGCATTTGTATGAGCATCTTCGATACTCCACGCTACAAAGAAAACCCAAG
CGACATTTTCTTCGACCACTTCGTGATGGATGTTATTGGACTTTTGCCTCCCGGCATGTCGGAAAATCTGGATGCCGCTATATCA
ACGAGCGGCGGCGCCTGGAGGCAAAAGACCAAACAGCTGATCAATCTCTCAGACACTATCGAGATTGCAATACTTGATCTGTG
GTACAGAAATTCTGCAATTTTAGAGTCACGCGGAGAACTTTATGATCCGTATCACTTTGCAGTAATTTCGTAGATGCTTATTTTT
GCGGAAAATAGCCAAGTAGATCAGTG

A. bumannii - tulpina nr. 34 (OXA-23)


CCGTTTGGTGATTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATA
TTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTG
TTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAA
TTAATCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCG
GATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGA
CATGACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCA
AAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGG
TTACGCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAA
AAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTG
GGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGC
CGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTAT
AAAAAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTAAATTTAATAT

A. baumannii - tulpina nr. 27 (OXA-23)


GACGTGATTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATAAATATTTT
ACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAGATTGTTCA
AGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAAAAAATTAA
TCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTGATCGGATT
GGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAAAAGACATG
ACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTCATGCAAAA
GAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATTAAAGGTTAC
GCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAATGTAAAAAA
TATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCACAAGTGGGCT

178

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGAAATGCCGGC
ATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAATTTTATAAAA
AGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTTCTAGTTTAAAATTTACATG

A. baumannii - tulpina nr. n (OXA-23)


GGGCCTTATTGTGACTTATTTCATGAGTTATCTATTTTTGTCGTGTACAGAGTTATTTTCTATTGATCTGGTGTTTAAAATGAATA
AATATTTTACTTGCTATGTGGTTGCTTCTCTTTTTCTTTCTGGTTGTACGGTTCAGCATAATTTAATAAATGAAACCCCGAGTCAG
ATTGTTCAAGGACATAATCAGGTGATTCATCAATACTTTGATGAAAAAAACACCTCAGGTGTGCTGGTTATTCAAACAGATAAA
AAAATTAATCTATATGGTAATGCTCTAAGCCGCGCAAATACAGAATATGTGCCAGCCTCTACATTTAAAATGTTGAATGCCCTG
ATCGGATTGGAGAACCAGAAAACGGATATTAATGAAATATTTAAATGGAAGGGCGAGAAAAGGTCATTTACCGCTTGGGAAA
AAGACATGACACTAGGAGAAGCCATGAAGCTTTCTGCAGTCCCAGTCTATCAGGAACTTGCGCGACGTATCGGTCTTGATCTC
ATGCAAAAAGAAGTAAAACGTATTGGTTTCGGTAATGCTGAAATTGGACAGCAGGTTGATAATTTCTGGTTGGTAGGACCATT
AAAGGTTACGCCTATTCAAGAGGTAGAGTTTGTTTCCCAATTAGCACATACACAGCTTCCATTTAGTGAAAAAGTGCAGGCTAA
TGTAAAAAATATGCTTCTTTTAGAAGAGAGTAATGGCTACAAAATTTTTGGAAAGACTGGTTGGGCAATGGATATAAAACCAC
AAGTGGGCTGGTTGACCGGCTGGGTTGAGCAGCCAGATGGAAAAATTGTCGCTTTTGCATTAAATATGGAAATGCGGTCAGA
AATGCCGGCATCTATACGTAATGAATTATTGATGAAATCATTAAAACAGCTGAATATTATTTAAGAGCTTGACAGAAACTCTAA
TTTTATAAAAAGCCCATTTGAGATAAATGGGCCTTTTATAATCTGACTAATAATGAAACCTGTTAATTTTTCTAGTTTAAAATTTA
CAGG

P. aeruginosa tulpina nr. 10 - clasa 1 integroni


GTTTTTTAAGGTTCGCAGCAGGCAGTCGCCCTAAGACAAAGTTGGGCGAACCCGGAGCCTCATTAATTGTTAGCCGTGAAAAT
TAAGCCCTTTACCAAACCAATACTTATTATGAAAAACACAATACATATCAACTTCGCTATTTTTTTAATAATTGCAAATATTATCT
ACAGCAGCGCCAGTGCATCAACAGATATCTCTACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGA
TGTATCCACAAACGCTGAAATTGCTCAATTCAATAAAGCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGC
ATTATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAAACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGA
TCTGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTTTGGGTTTCGCAAGAAATAACCCAAAAAATTGGAT
TAAATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCTGGAGATAAAGAAAGAAACAACGGATTA
ACAGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGTAAAATTATTAATCACAATCTC
CCAGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGAGAATAGTACAAAACTGTATGGGAA
AACTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGACATAAAT
ATGTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAAGCAAGAAAAATGCGATCACCATTC
TAAACACACTAAATTTATAAAAAATCTAATGGCAAAATCGCCCAACCCTTCAATCAAGTCGGGACGGCCAAAAGCAAGCTTTTG
GCTCCCCTCGCTGGCGCTCGGCGCCCCTTATTTCAAACGTTAGACATCATGAGGGTAGCGGTGACCATCGAAATTTCGAACCAA
CTATCAGAGTGCTAAGCGTCATGAGCGCATCTGGATCACGTGCTGGGCCGTGCATTTGTACGGCTCCGCAGTGAT

P. aeruginosa tulpina nr. 12 - clasa 1 integroni


GATTTTAAGTTCGCAGCAGGCAGTCGCCCTAAGACAAAGTTGGGCGAACCCGGAGCCTCATTAATTGTTAGCCGTGAAAATTA
AGCCCTTTACCAAACCAATACTTATTATGAAAAACACAATACATATCAACTTCGCTATTTTTTTAATAATTGCAAATATTATCTAC
AGCAGCGCCAGTGCATCAACAGATATCTCTACTGTTGCATCTCCATTATTTGAAGGAACTGAAGGTTGTTTTTTACTTTACGATG
TATCCACAAACGCTGAAATTGCTCAATTCAATAAAGCAAAGTGTGCAACGCAAATGGCACCAGATTCAACTTTCAAGATCGCAT
TATCACTTATGGCATTTGATGCGGAAATAATAGATCAGAAAACCATATTCAAATGGGATAAAACCCCCAAAGGAATGGAGATC
TGGAACAGCAATCATACACCAAAGACGTGGATGCAATTTTCTGTTGTTTGGGTTTCGCAAGAAATAACCCAAAAAATTGGATTA
AATAAAATCAAGAATTATCTCAAAGATTTTGATTATGGAAATCAAGACTTCTCTGGAGATAAAGAAAGAAACAACGGATTAAC
AGAAGCATGGCTCGAAAGTAGCTTAAAAATTTCACCAGAAGAACAAATTCAATTCCTGCGTAAAATTATTAATCACAATCTCCC
AGTTAAAAACTCAGCCATAGAAAACACCATAGAGAACATGTATCTACAAGATCTGGAGAATAGTACAAAACTGTATGGGAAAA
CTGGTGCAGGATTCACAGCAAATAGAACCTTACAAAACGGATGGTTTGAAGGGTTTATTATAAGCAAATCAGGACATAAATAT
GTTTTTGTGTCCGCACTTACAGGAAACTTGGGGTCGAATTTAACATCAAGCATAAAAGCCAAGAAAAATGCGATCACCATTCTA
AACACACTAAATTTATAAAAAATCTAATGGCAAAATCGCCCAACCCTTCAATCAAGTCGGGACGGCCAAAAGCAAGCTTTTGGC

179

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
TCCCCTCGCTGGCGCTCGGCGCCCCTTTATTTCAAACGTTAGACATCATGAGGGTAGCGGTGACCATCGAAATTTCGAACCAAC
TATCAGAGGTGCTAAGCGTCATTGAGCGCCATCTGGAAATCAACGTTGCTGGGCCGGTGCATTTTGTACGG

P. aeruginosa tulpina nr. 15 - clasa 1 integroni


GGTTAGAGTAGCAGCAGGCAGTCGCCCTAAACAAAGTTATGCCGCACCCACCCCTATGGAGTCTTGATGTTAAAAGTTATTAG
TAGTTTATTGGTCTACATGACCGCGTCTGTCATGGCTGTCGCAAGTCCGTTAGCCCATTCCGGGGAGCCGAGTGGTGAGTATCC
GACAGTCAACGAAATTCCGGTCGGAGAGGTCCGACTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGT
TTGATGGCGCGGTCTACCCGTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCG
AAAAACACAGCGGCACTTCTCGCGGAGATTGAAAAGCAAATTGGACTTCCCGTAACGCGTGCAGTCTCCACGCACTTTCATGA
CGACCGCGTCGGCGGCGTTGATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAG
GCAGAGGGGAACGAGATTCCCACGCATTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAGC
TCTTCTATCCTGGTGCTGCGCATTCGACCGACAATCTGGTTGTATACGTCCCGTCAGCGAACGTGCTATACGGTGGTTGTGCCG
TTCATGAGTTGTCACGCACGTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCGTTGAGCGGATTCAA
AAACACTACCCGGAAGCAGAGGTCGTCATTCCCGGGCACGGTCTACCGGGCGGTCTAGACTTGCTCCAGCACACAGCGAACG
TTGTCAAAGCACACAAAAATCGCTCAGTCGCCGAGTAGCAGATGCGGCATAACTGGCTGAATGGCCCACCTCCGTTGAGCGGA
TTCAAAAACACTACCCGGAAGCAGAGGTCGTCATTCCCGGGCACGGTCTACCGGGCGGTCTAGACTTGCTCCAGCACACAGCG
AACGTTGTCAAAGCACACAAAAATCGCTCAGTCGCCGAGTAGCAGATGCGGCATAACAAATCGTTGGAGCGGGACTTTTGCTA
CGCAGGCTGCGTCTACTCGCAAAAGCCCCTCACTCAGCGTAGGCCGCATGGACACACGCAGGTCACATTGATACACAAAATTC
TAGCTGGCGGC

P. aeruginosa tulpina nr. 10 VIM CDS


AAAAGCCCTGAGCTAGCCGACCGAACCGCGTAGCGGTTTTGGGTCGGCTGCAGCGATTTGTTGGGCGATAGCTTGCCACATTT
CTCAACGATTGGGATTTGATGTACTTTCCGCACTTTGTAGCGCGACCACATCATGCTCCCCCTGGCCGCGAGAGCCCTTCACTC
GGGAAACACAAGACAGACCGAGCACGACTGTTGCAAGGGTCAAACAGTACACGACAACCGGCCAAGCCGTGTTGCGCGGCA
ACAGCGAAATGATCAACGTTCCGATGCTTCCTAGCAGTACACCGCCCAAGCAGAAGTAGACTGCCGTGACCGTTCCAGCAACA
TGGTCGAATCCTCGAAGAGCGCCATTGGGCGCCACAGATACCGCTGTGGCGACACCAATACCCACTAGCCACATTGGAGCAAT
AAAGCCTAACACGGACTGCAAAGCCCATATTTCGGTGATGGCAAGCAATACTGCTCCAGCTATCAGGCATCCCATTCCCATTCG
CAAGACACTTGGGCTGCCCCACTTGGGTATCACACGCCCCATAAAACGAGCCGTAAACACCATGGCAATTGCCACTGTGGCGA
ACAGCAGGCTGAAGCCAAGCTGAGACACACCTTGCCTGCCCATCATTAGTCCGGGCGCAATGGAGAAAAAGACGAAGAAGCT
ACCCATTCCAGCGGCGTAACACAACGTGTACAACCAGAAGTTCAGGCACTTAACGGGGAGTAGCAGCTGCGACCATTGCAAG
CCCGCAACTCGTTGCACCCGGGTTTCAGGCCAGAATCGCCACGCTGCTGCAGATGCAGCGATCATGCCCAAACCTAGAAACGC
AAAGATAGCCCGCCACCCAAGCCACATGTCGACGAGCGCTCCGAGCAATGGGCCTACCGCCGGGACTATGGCCAGCATGGAT
CCGAGTATGCCGTAAATGACATTACTTTCCTCGCGACCTGCGTAAATGTCACGTACTGTTGCAAATGTGGAAACAAGGCACGCC
GAGGCACCACAAGCCTGAAGAATCCGAAGCCCCAGAAAGACTTCAGCCGATGACGTAAGAGCGAGGCCCATTGACGCCACAA
CGTACGCGAGGCCACCTCCCAGTAGAACGGGGCCGGCG

P. aeruginosa tulpina nr. 12 VIM CDS


ATAAAGCCTCGCTAGCCGACCGAACCGCGTAGCGGTTTTGGGTCGGCTGCAGCGATTTGTTGGGCGATAGCTTGCCACATTCT
CTCAACGATTGGGATTTGATGTACTTTCCGCACTTTGTAGCGCGACCACATCATGCTCCCCCTGGCCGCGAGAGCCCTTCACTC
GGGAAACACAAGACAGACCGAGCACGACTGTTGCAAGGGTCAAACAGTACACGACAACCGGCCAAGCCGTGTTGCGCGGCA
ACAGCGAAATGATCAACGTTCCGATGCTTCCTAGCAGTACACCGCCCAAGCAGAAGTAGACTGCCGTGACCGTTCCAGCAACA
TGGTCGAATCCTCGAAGAGCGCCATTGGGCGCCACAGATACCGCTGTGGCGACACCAATACCCACTAGCCACATTGGAGCAAT
AAAGCCTAACACGGACTGCAAAGCCCATATTTCGGTGATGGCAAGCAATACTGCTCCAGCTATCAGGCATCCCATTCCCATTCG
CAAGACACTTGGGCTGCCCCACTTGGGTATCACACGCCCCATAAAACGAGCCGTAAACACCATGGCAATTGCCACTGTGGCGA
ACAGCAGGCTGAAGCCAAGCTGAGACACACCTTGCCTGCCCATCATTAGTCCGGGCGCAATGGAGAAAAAGACGAAGAAGCT
ACCCATTCCAGCGGCGTAACACAACGTGTACAACCAGAAGTTCAGGCACTTAACGGGAGTAGCAGCTGCGACCATTGCAAGCC
CGCAACTCGTTGCACCCGGGTTTCAGGCCAGAATCGCCACGCTGCTGCAGATGCAGCGATCATGCCCAAACCTAGAAACGCAA
AGATAGCCCGCCACCCAAGCCACATGTCGACGAGCGCTCCGAGCAATGGGCCTACCGCCGGGACTATGGCCAGCATGGATCC
GAGTATGCCGTAAATGACATTACTTTCCTCGCGACCTGCGTAAATGTCACGTACTGTTGCAAATGTGGAAACAAGGCACGCCG

180

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
AGGCACCACAAGCCTGAAGAATCCGAAGCCCCAGAAAGACTTCAGCCGATGACGTAGAGCGAGGCCCATTGACGCCACACGT
ACGCGAGCACTCCCAGTAGAACGGGGCGGCGCCCCAGTCGGTCCGATAGCGGTCCAAACAAGAGCTGACG

P. aeruginosa tulpina nr. 15 VIM CDS


AATTACCCCGCTACGGCAATTAGGAGCGCAGCGAGTAATTTGTCCGTGTGTAGCGTATTGTTAGGCGCTTGTGCCTTGCCAGC
GACGATACAGGCTGGCAATGCCAGACGAACAAAGAAAAGGCATTGCTTCCTTGATTTGTTCCAGCGGCCAATCCCACCAAGCC
ATATCTAAAAGCATAGAAATTTCTTCTTCAGAAAAGCGCTTCCTAATCGACTTTGCAGGGTTTCCCCCCACTATGGTGTAGGGTT
CCACGTCTTTGGCAACCAAAGCGCGGCTACCTATCACCGCTCCATGCCGATCTTGATCCCGGGCATGATCATGGCCTCCGAACC
GATCCACACATCACTTCCTATAACTGTGTCGCCAGCCCGCTGGAATGCATCGACTGATTTTGCAAACGCGGGCTCCTCGTTCAT
GTAGAAGAAAGGGAAAGAAGAGACCCAATCATATCGGTGGCCTTGATTCCCAGCCATAATAAAAGCTGCGCCTGATCCGATG
GAGCAGAAGCTGCCGATAATCAGCTGATCAACGTCATCACGGTCTGGTAGAAGGTAGCGAGCACAATCATCAAACGAGTGCC
CATGGTAATAGCCGGAATAGTAGCTATACCGCCCTACCTTGATGTTCGGATTCTTCACCTGCTCAGTCAGAAGCTTCCCTTTGAA
GGGACTCTCAAAATAATTCGTCATAAAATTTGTACCCGAAAATTCTAGAGCGACTCCACGCGTCGCCTAACACCTGAGTTAAGC
CGCGCCGCGAAGCGGCGTCGGCTTGGACGAATTGTTAGGCCGCATATCGCGACCTGAAAGCGGCACGCAAGACCTCAACCTT
TTCCGCCCCGAGTGAGGTGCATGCGAGCCTGTAGGACTCTATGTGCTTTGTAGGCCAGTCCACTGGTGGTACTTCATCGGCAT
AGTAAAAGTAATCCCAGATGATCGCCTCCCAGCTGTTACAACGGACTGGCCGCCCGGCGATGACGCCCTCAGCCGCCTCTGGG
CACGAGCCCTGCGGAGCCTCCGCGATTTCATACGCTTCGTCTGCCCACCAGCAGTTCGCAGTCAAGTAACTCATCCCCGATCTC
GCTAAGAATCCATAGTCCAACTCCTCCATGACGCCGCCCCGCCGAGCATTTCACTATTG

P. aeruginosa tulpina nr.8A clasa 1 integroni (5'CS)

aacA7-VIM-2

ATGTTTGATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGCACCAATGGATAGTTCG
CCGCTCGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAGCTGTGGCCAGATGGCACATGTCA
AGAGCACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGCTGCTGTCCTCATTGCTGTAGCACCCGACG
GAGAAGCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGGAGTGCTACTCCGGCAACGTTGCGTTCTTGGAGGG
TTGGTACGTTGTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTAGCTCTGGTAAAAGCCGCCGAGCATTGGGCTCGTGGTCGC
GGATGCACCGAATTCGCCTCCGACACTCAACTTACCAACAGCGCAAGCACCTCGGCGCACCTGGCGGCTGGATTCACGGAGGT
TGCTCAAGTACGCTGCTTCCGGAAACCGTTGTGAGGGGCGCCGCGTTGGTGCCTAACAATTCGTTCAAGCCGAACTTGCTTCG
TTACACCAAAGCCATGGCAGAATGAGCTTGCCATGGCTTTGGCTCCACTACGCAAGTCGGCTTAACTCAGGCGTTATGCCGCAC
TCACCCCCATGGAGTTTTGATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCG
CTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCC
GATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGGCCCCGGAAGGGG
GAATAAATTGCTTTTGATTGATACAGCGTGGGGGTGCGAAAAACCCAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGG
ACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCCGCCGGCGTTGATGTCCTTCGGGCCGCTGGGGGT
GGCAACGTACGCATCACCGTCGAAACGCCGGCTAACCCAAGGTAAAAGGGGAACCAAAATTCCCACGCCATTTCTTAGAAGG
ACCTCCTCCGAGCGGGGGACGCAGTTGGCCTTCCGGGCCAGTAAAAACCTTTTTTACCCGGGGGTGGGCGATTTCAACCGGAA
AACTTAATTTTGGGGACTTCCCCCACTCGCAAATGGGCCCCCAAAAGGGGGTGTGGGCGATTTTTGAATTTGTTCTCCCCCCCT
CCCCGGGGGGAAGGGGCCCCATACCCAAATTTGGGTTTAATGGGACCCCACCCCTTTTGGGGGGTTGGGACCCCCCCCCCCCG
GGAAAGGCAATTATTTTTTTCCCGGGAAGGGGACCTTCGGGGGGGGCGGAATTGGTTGATACAACCCAAAAGGTTGGAAACC
GAAAAAAAACCCCCCCCCCCGCTGGGGTGTGCTGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAAAGGGGA
AAAAAAAAAAAAGGAAAAAACCAAAAACCCCCAAAAAAAGAGCGAGGGGGGGAGGGGAGTTGGGGGGGGTTTGGCGGAA
ATTGTGGGGGCCTCTG

P. aeruginosa tulpina nr. 9B clasa 1 integroni (5'CS)

aacA7-VIM-2

GCCCTGTGGACAAGTTTGATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGCACCA
ATGGATAGTTCGCCGCTCGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAGCTGTGGCCAGA
TGGCACATGTCAAGAGCACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGCTGCTGTCCTCATTGCTG
TAGCACCCGACGGAGAAGCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGGAGTGCTACTCCGGCAACGTTGC
GTTCTTGGAGGGTTGGTACGTTGTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTAGCTCTGGTAAAAGCCGCCGAGCATTGG
GCTCGTGGTCGCGGATGCACCGAATTCGCCTCCGACACTCAACTTACCAACAGCGCAAGCACCTCGGCGCACCTGGCGGCTGG

181

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
ATTCACGGAGGTTGCTCAAGTACGCTGCTTCCGGAAACCGTTGTGAGGGGCGCCGCGTTGGTGCCTAACAATTCGTTCAAGCC
GAACTTGCTTCGTTACACCAAAGCCATGGCAGAATGAGCTTGCCATGGCTTTGGCTCCACTACGCAAGTCGGCTTAACTCAGGC
GTTATGCCGCACTCACCCCCATGGAGTTTTGATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCT
ATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCT
TTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGT
CCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAA
GCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGGGGTTGATGTCCTTCGGGCG
GCTGGGGGTGGAAACGTACGCATCACCGTCGAACCGCCGGCTAGCCGAAGTTAAAGGGGAACGAAATTCCCACGCCCTCCCT
TAAAAGGACTCCCAACCAACCGGGGAACCCAAGGGCCTTCGGTCCAATAAGAACTCTATCATTCCCTAGGGGCTTTC

P. aeruginosa tulpina nr. 21 VIM2 like Fw

100% omologie cu VIM-2/VIM-17

GACGCGTCtATCATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCG
GTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCC
GTCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTC
TCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTT
GATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATT
CCCACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGC
GCATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCAC
GTCTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCA
CAGTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAAA
TCG

P. aeruginosa tulpina nr. 26 VIM2 like Fw

100% omologie cu VIM-2/VIM-17

ACGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTTTTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGG
TCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGTGTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCG
TCCAATGGTCTCATTGTCCGTGATGGTGATGAGTTGCTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCT
CGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAACGCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCGGCGGCGTTG
ATGTCCTTCGGGCGGCTGGGGTGGCAACGTACGCATCACCGTCGACACGCCGGCTAGCCGAGGTAGAGGGGAACGAGATTCC
CACGCACTCTCTAGAAGGACTCTCATCGAGCGGGGACGCAGTGCGCTTCGGTCCAGTAGAACTCTTCTATCCTGGTGCTGCGC
ATTCGACCGACAACTTAGTTGTGTACGTCCCGTCTGCGAGTGTGCTCTATGGTGGTTGTGCGATTTATGAGTTGTCACGCACGT
CTGCGGGGAACGTGGCCGATGCCGATCTGGCTGAATGGCCCACCTCCATTGAGCGGATTCAACAACACTACCCGGAAGCACA
GTTCGTCATTCCGGGGCACGGCCTGCCGGGCGGTCTAGACTTGCTCAAGCACACAACGAATGTTGTAAAAGCGCACACAATGG
GGCCCCC

n urma comparrii secvenelor utiliznd soft-ul Clustal W a fost identificat gena bla VIM-2
>VIM-2
1 mfkllskllv yltasimaia splafsvdss geyptvseip vgevrlyqia dgvwshiatq
61 sfdgavypsn glivrdgdel llidtawgak ntaallaeie kqiglpvtra vsthfhddrv
121 ggvdvlraag vatyaspstr rlaevegnei pthsleglss sgdavrfgpv elfypgaahs
181 tdnlvvyvps asvlyggcai yelsrtsagn vadadlaewp tsieriqqhy peaqfvipgh
241 glpggldllk httnvvkaht nrsvve
>VIM-17
1 mfkllskllv yltasmmaia splafsvdss geyptvseip vgevrlyqia dgvwshiatq
61 sfdgavypsn glivrdgdel llidtawgak ntaallaeie kqiglpvtra vsthfhddrv
121 ggvdvlraag vatyaspstr rlaevegnei pthsleglss sgdavrfgpv elfypgaahs
181 tdnlvvyvps asvlyggcai yelsrtsagn vadadlaewp tsieriqqhy peaqfvipgh
241 glpggldllk httnvvkaht nrsvve

182

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

CLUSTAL 2.1 multiple sequence alignment


VIM-2
VIM-17

MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ 60
MFKLLSKLLVYLTASMMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ 60
***************:********************************************

VIM-2
VIM-17

SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV 120
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV 120
************************************************************

VIM-2
VIM-17

GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS 180
GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS 180
************************************************************

VIM-2
VIM-17

TDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH 240
TDNLVVYVPSASVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH 240
************************************************************

VIM-2
VIM-17

GLPGGLDLLKHTTNVVKAHTNRSVVE 266
GLPGGLDLLKHTTNVVKAHTNRSVVE 266
**************************

P. aeruginosa tulpina nr.12A clasa 1 integroni (5'CS)

aacA7-VIM-2

GATGTTATGGAGCAGCAACGATGTTACGCAGCAGGGCAGTCGCCCTAAAACAAAGTTAGGCACCAATGGATAGTTCGCCGCT
CGTCAGGCCTGTTGAAACTACCGATTCGGCCAGTTGGCTAAGCATGCGCTGTGAGCTGTGGCCAGATGGCACATGTCAAGAGC
ACCAGTCAGAGATCGCAGAATTTCTGTCCGGAAAAGTCGCCCGGCCTGCTGCTGTCCTCATTGCTGTAGCACCCGACGGAGAA
GCACTAGGGTTTGCCGAGCTTTCGATCCGCCCGTATGCGGAGGAGTGCTACTCCGGCAACGTTGCGTTCTTGGAGGGTTGGTA
CGTTGTGCCAAGTGCGCGGCGTCAGGGCGTAGGTGTAGCTCTGGTAAAAGCCGCCGAGCATTGGGCTCGTGGTCGCGGATGC
ACCGAATTCGCCTCCGACACTCAACTTACCAACAGCGCAAGCACCTCGGCGCACCTGGCGGCTGGATTCACGGAGGTTGCTCA
AGTACGCTGCTTCCGGAAACCGTTGTGAGGGGCGCCGCGTTGGTGCCTAACAATTCGTTCAAGCCGAACTTGCTTCGTTACACC
AAAGCCATGGCAGAATGAGCTTGCCATGGCTTTGGCTCCACTACGCAAGTCGGCTTAACTCAGGCGTTATGCCGCACTCACCCC
CATGGAGTTTTGATGTTCAAACTTTTGAGTAAGTTATTGGTCTATTTGACCGCGTCTATCATGGCTATTGCGAGTCCGCTCGCTT
TTTCCGTAGATTCTAGCGGTGAGTATCCGACAGTCAGCGAAATTCCGGTCGGGGAGGTCCGGCTTTACCAGATTGCCGATGGT
GTTTGGTCGCATATCGCAACGCAGTCGTTTGATGGCGCAGTCTACCCGTCCAATGGTCTCATTGTCCGTGAtGGtGATGAGTTG
CTTTTGATTGATACAGCGTGGGGTGCGAAAAACACAGCGGCACTTCTCGCGGAGATTGAGAAGCAAATTGGACTTCCTGTAAC
GCGTGCAGTCTCCACGCACTTTCATGACGACCGCGTCgGCGGCGTTGATGTCCTTCCGGCGGGCTGGGGGTGGCAACGTACGC
ATCACCGTCGAAACGCCGGCTAGCCCAAGGT

MLST la P. aeruginosa
P. aeruginosa tulpina nr. 8A (acsA R)
GGCCCGTTGGCCAACGGCGCCACCACCATTCTGTTCGAGGGCGTGCCGAACTACCCCGACGTGACCCGCGTGGCGAAAATCAT
CGACAAGCACAAGGTCAACATCCTCTACACCGCGCCGACCGCGATCCGCGCGATGATGGCCGAAGGCAAGGCGGCGGTGGCC
GGTGCCGACGGTTCCAGCCTGCGTCTGCTCGGTTCGGTGGGCGAGCCGATCAACCCGGAAGCCTGGCAGTGGTACTACGAGA
CCGTCGGCCAGTCGCGCTGCCCGATCGTCGACACCTGGTGGCAGACCGAGACCGGCGCCTGCCTGATGACCCCGCTGCCGGG
CGCCCACGCGATGAAGCCGGGCTCCGCGGCCAAGCCGTTCTTCGGCGTGGTCCCGGCGCTG

P. aeruginosa tulpina nr. 8A (aroE R)


183

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
ATGTCACCGTGCCGTTCAAGGAAGAGGCCTATCGTCTGGTGGACGAGTTGAGCGAGCGGGCCACCCGGGCCGGGGCGGTGA
ACACCCTGATCCGCCTCGCCGACGGTCGCCTGCGCGGCGACAACACCGACGGCGCCGGCCTGCTGCGGGACCTGACGGCGAA
CGCCGGGGTCGAGCTGCGCGGCAAGCGGGTTCTCCTGCTCGGCGCCGGCGGTGCGGTGCGTGGGGTGCTCGAACCCTTCCTC
GGCGAGTGCCCGGCGGAGTTGCTGATCGCCAACCGCACGGCGCGGAAGGCCGTGGACCTGGCCGAGCGGTTCGCCGACCTC
GGCGCGGTGCACGGCTGCGGTTTCGCCGAGGTCGAAGGGCCTTTCGACCTGATCGTCAACGGCACCTCGGCCAGTCTTGCCG
GCGACGTGCCGCCGCTGGCGCAGAGCGTGATCGAGCCCGGCCGTACCGTCTGCTACGACATGATGTATGCCAAGGAACCGAC
TGCCTTCA

P. aeruginosa tulpina nr. 8A (guaA R)


CTGCTAGGCCTCTCCGGCGGCGTGGACTCCTCGGTGGTCGCCGCGCTGTTGCACAAGGCCATCGGCGACCAACTGACCTGCGT
GTTCGTCGACAACGGTCTGCTGCGCCTGCACGAAGGCGACCAGGTGATGGCCATGTTCGCCGAGAACATGGGCGTGAAGGTG
ATCCGCGCCAACGCCGAGGACAAGTTCCTCGGCCGCCTGGCCGGCGTCGCCGACCCGGAAGAGAAGCGCAAGATCATCGGCC
GCACCTTCATCGAAGTCTTCGACGAAGAAGCCACCAAGCTGCAGGACGTGAAGTTCCTCGCCCAGGGCACCATCTACCCCGAC
GTGATCGAGTCGGCCGGCGCCAAGACCGGCAAGGCCCACGTGA

P. aeruginosa tulpina nr. 8A (mutL R)


CTGCAGGAAGTCATCAAGCGCCTGGCGCTGGCCCGTTTCGACGTGGCTTTCCACCTGCGCCACAACGGCAAGACCATCTTCGC
CCTGCACGAGGCGCGAGACGAGCTGGCCCGCGCGCGCCGGGTCGGCGCGGTGTGCGGCCAGGCATTCCTCGAGCAGGCGCT
GCCGATCGAGGTCGAGCGCAACGGCCTGCACCTGTGGGGTTGGGTCGGCTTGCCGACCTTCTCCCGCAGCCAGCCGGACCTG
CAGTACTTCTATGTGAACGGGCGCATGGTGCGCGACAAGCTGGTCGCCCACGCGGTGCGCCAGGCTTATCGCGACGTGCTGT
ACAACGGCCGGCATCCGACCTTCGTGCTGTTCTTCGAAGTCGATCCGGCGGTCGTGGACGTCAACGTGCGACCGGATCAAGCA
CGAAGTTCGCTAACGTACCGGCCGGATGC

P. aeruginosa tulpina nr. 8A (nuoD R)


ATGTTCCTCAACCTCGGCCCGAACCACCCGTCCGCCCACGGCGCGTTCCGCATCATCCTGCAACTGGACGGCGAGGAGATCAT
CGACTGCGTCCCGGAGATCGGCTACCACCACCGCGGCGCCGAGAAGATGGCCGAGCGCCAGTCCTGGCACAGTTTCATCCCCT
ACACCGACCGCATCGACTACCTCGGCGGGGTGATGAACAACCTGCCCTACGTACTCTCGGTGGAGAAGCTCGCCGGGATCAA
GGTGCCCCAGCGGGTCGACGTGATCCGGATCATGATGGCGGAGTTCTTCCGTATCCTGAACCACCTGCTGTACCTGGGCACCT
ATATCCAGGACGTCGGCGCCATGACCCCGGTGTTC

P. aeruginosa tulpina nr. 8A (ppsA R)


CATCGTCCAGGCACGCCCGGAAACCGTGAAGAGCCGCGCCAGCGCCACGGTCATGGAGCGCTACCTGCTGAAAGAGAAGGG
GACCGTCCTGGTGGAAGGGCGTGCCATCGGCCAGCGCATCGGTGCCGGTCCGGTCAAAGTGATCAACGACGTGTCGGAAATG
GACAAGGTCCAACCGGGTGACGTCCTGGTCTCCGACATGACCGACCCGGACTGGGAGCCAGTGATGAAGCGCGCCAGCGCCA
TCGTCACCAACCGCGGCGGGCGTACCTGCCACGCGGCGATCATCGCTCGCGAACTAGGCATCCCGGCGGTGGTCGGTTGCGC
AACGCCACCCAGATCCTGCAGGATGGCCAGGGGGTGACCGTT

P. aeruginosa tulpina nr. 8A (trpE R)


TGTCGTGGGCAGCTCGCCGGAGGTGCTGGTACGGGTCGAGGATGGCCTGGTGACGGTGCGCCCGATCGCCGGTACCCGTCC
GCGCGGGATCAACGAAGAGGCCGACCTGGCACTGGAGCAGGATCTGCTGTCGGACGCCAAGGAGATCGCCGAGCACCTGAT
GCTGATCGACCTGGGGCGCAACGACGTGGGGCGGGTGTCTGATATCGGCGCGGTGAAGGTCACCGAAAAAATGGTGATCGA
ACGTTACTCCAACGTCATGCACATCGTGTCCAACGTCACCGGGCAATTGCGCGAGGGGCTCAGCGCGATGGACGCGCTGCGG
GCGATTCTGCCGGCGGGCACTCTATCCGGCGCGCCGAAGATCCGCGCCATGGAGATCATCGACGAGCTGGAGCCGGTCAAGC
GTGGAGTCTACGGCGGCGCGGTCGGCTACCTGGCAT

184

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

P. aeruginosa tulpina nr. 21 (acsA R)


GGGCTGCGTATGCGACACCGCCGCCTCGGCGACCTTCGGGTGGGCGACCATCGCGCTTTCCACCTCGGCGGTGCCCATGCGGT
GGCCGGAGACGTTGAGCACGTCGTCGACCCGCCCGGTGATCCAGTAGTAGCCGTCCTCGTCGCGGCGCGCGCCGTCGCCGGT
GAAGTACATGCCCTTGAAGGTCTTGAAGTAGGTGTCGACGAAGCGGTCATGGTCGCCGAACAGGGTCCGCGCCTGGCCCGGC
CAGGAGTCGAGGATCACCAGGTTGCCCTCGGCGGCGCCCTCGATCAGGTTGCCGAGGTTGTCCACCAGTGCCGGTACCACGC
CGAAGAACGGCTTGGCTGCAGAGCCCGGCTTCATCGCGTGGGCGCCCGGCAGCGGGGTCATCAGGCAGGCGCCGGTCTCGG
TCTGCCACCAGGTGTCGACGATCGGGCAGCGCGACTGGCCGACGGTCTCGTAGTACCACTGCCAGGCTTCCGGGTTGATCGG
CTCGCCCACCGAACCGAGCAGACGCAGGCTGGAACCGTCGGCACCGGCCACCGCCGCCTTGCCTTCGGCCATCATCGCGCGG
ATCGCGGTCGGCGCGGTGTAGAGGATGTTGACCTTGTGCTTGTCGATGATCTTCGCCACGCGGGTCACGTCGGGGTAGTTCG
GCACGCCCTCGAACAGAATGGTGGTGGCGCCGTTGGCCAGCGGGCCATAGACGATGTAGGTGTGGCCGGTGACCCAGCCGA
TGTCGGCGGTGCACCAGTAGACTTCGCCCGGACGGTAGTCGAAGACCCGTCGTGTACGGGGGGTCTCCCCGGAGATATATAA
ACCCCCCCGGGGGGCTCCCTGGGTG

P. aeruginosa tulpina nr. 21 (aroE R)


GAGGTGAGTGAAGCATTTGAGACGTACGTCTCAATGCCGCCTGACAACTCAGACAGTTGCCAACTGTCGGCGCAGCGTCTCCA
ACACTGGCGCCGAGGCAGGACGCACGCCGCGCCAGAGGAAGAATGCCTCGGCGGCCTGCTCCACCAGCATGCCCAGGCCATC
CAGGGTACGCGCCGCACCGCGTTCGGCGGCCCAGCGGTTGAAGGCAGTCGGTTCCTTGGCATACATCATGTCGTAGCAGACG
GTACGGCCGGGCTCGATCACGCTCTGCGCCAGCGGCGGCACGTCGCCGGCAAGACTGGCCGAGGTGCCGTTGACGATCAGGT
CGAAAGGCCCTTCGACCTCGGCGAAACCGCAGCCGTGCACCGCGCCGAGGTCGGCGAACCGCTCGGCCAGGTCCACGGCCTT
CCGCGCCGTGCGGTTGGCGATCAGCAACTCCGCCGGGCACTCGCCGAGGAAGGGTTCGAGCACCCCACGCACCGCACCGCCG
GCGCCGAGCAGGAGAACCCGCTTGCCGCGCAGCTCGACCCCGGCGTTCGCCGTCAGGTCCCGCAGCAGGCCGGCGCCGTCGG
TGTTGTCGCCGCGCAGGCGACCGTCGGCGAGCCGAATCAGGGTGTTCACCGCCCCGGCCCGGGTGGCCCGCTCGCTCAACTC
GTCAACCAGACGATAGGCCTCTTCCTTGAACGGCACGGTGACATTGGCGCCCTTGCCCTGCTCGAAGAAGCGCCGGGCGAACC
CGGGGAAATCGTCCAGCGGCGCCAGTTGCGCGTCATAGACAAGCGCCTCGCCGGTCTGCTCGGCGAACAGGCGGAGGATCA
GCGGCGACTTGCTGTGGCCGATGGGGTTGCCGAATACGCAATAGCGGTCCATGGGTTCGTCCTTTTGCCGGAAGTGGGACGC
GACGAAGCGGACTCGTCCCCTGGAGAGCGGGTCAAGGCTTGGCCGGCCAAGCCAATCAGCGGTCGGGCGAGGAAATACTCC
GGTCAGGCGCGCTTCGTCGTGGCCGCTGAAAAAAAACAAAACCCCCACCCCCCCACCCCAAAAAAAAAAAAAAAGGCGGGCG
GCGAAAAAATGG

P. aeruginosa tulpina nr. 21 (guaA R)


TCCCGCGAACGCGCAGTTCCTCGATGAGATGTGGTCGGCCTGGCGCAGCAGGTCGGCGTACTCCTTCTTCACCTCGCCGAGGA
TGCGCACGCCCAGGCCCGGGCCGGGGAACGGGTGGCGGTAGACCATGTCGTAGGGCAGGCCCAGCTCCAGGCCGATCTTGC
GCACTTCGTCCTTGAACAGTTCGCGCAGCGGCTCGACCAGTTCGAACTGCATGTCCTCCGGCAGGCCGCCGACGTTGTGGTGC
GACTTGATCACGTGGGCCTTGCCGGTCTTGGCGCCGGCCGACTCGATCACGTCGGGGTAGATGGTGCCCTGGGCGAGGAACT
TCACGTCCTGCAGCTTGGTGGCTTCTTCGTCGAAGACTTCGATGAAGGTGCGGCCGATGATCTTGCGCTTCTCTTCCGGGTCGG
CGACGCCGGCCAGGCGACCGAGGAACTTGTCCTCGGCGTTGGCGCGGATCACCTTCACGCCCATGTTCTCGGCGAACATGGCC
ATCACCTGGTCGCCTTCGTGCAGGCGCAGCAGGCCGTTGTCGACGAACACGCAGGTCAGTTGGTCGCCGATGGCCTTGTGCA
GCAGCGCGGCGACCACCGAGGAGTCCACGCCGCCGGAGAGGCCGAGCAGGACCTTGGAGGAACCGACCTGGGCGCGCACG
GTGGCGATGGCGTCGTCGACGATGTTCGAGGGGGTCCACAGCGCGGCGCAACCGCAGATGTCGAGAACGAAGCGCGAGAGA
ATGCGCAGGCCCTGCTTGGTGTGGGTGACTTCCGGGTGGAATTGCACGCCGTAGTAGGCGCGGGCATCGTCGGCCATGGCGG
CAATCGGGCAGCTCGGGGTGCTGGCCAGGATGTGGAAACCGGCCGGCATCTCGGTGACCTTGTCGCGTGCCCCCCCCTCTTAG
GGGGGGGGGAGGGGGGGGGGT

P. aeruginosa tulpina nr. 21 (mutL F)


CGCGGACGTCGTCACTGACGACCAGGTACTCTCGTCAAATACCGTTGACGCCGTGGTCCCGCGCGCATTGATGTCGCTAGCTC
GACCAAGGACATGATCCACTTGATCCGAGACCACGCCGACGCCATCGGCAACACGGCCGACGACTCGCCGCTGGTCCTGGCTC
GCCTCGCCACCGCCGAGATACACGAGCTGCACGACCTGGAGCGGGTGATGAGCCTCGGCTTCCGTGGCGCGGCGCTGACCTC

185

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
AATCAGTTCGGTCGCCTCACTGACCATGATCTCGAGTACCGCCGACGCCGGCGAAGCCTGGCAGGTGGAAACCGAGGGCCGC
GACATGCAGCCGCGGGTACAGCCGGCGGCGCACCCGGTGGGGACCAGCGTCGAGGTTCGCGACCTGTTCTTCACACCCCGGC
GCGGCGAAGTTCCTGCGCGCCGAGAAGACCGAGTTCGACATCTGCAGGAAGTCATCAAGCGCCTGGCGCTGGCCCGTTTCGA
CGTGGCTTTCCACCTGCGCCACAACGGCAAGACCATCTTCGCCCTGCACGAGGCGCGAGACGAGCTGGCCCGCGCGCGCCGG
GTCGGCGCGGTGTGCGGCCAGGCATTCCTCGAGCAGGCGCTGCCGATCGAGGTCGAGCGCACGGCCTGCACTGTGGGGTTG
GTCGGCTTGCGACTTTCTCCGCAGCAGCCGGACTGCAGTATTCTATGTAACGGCGCATGGGCGCGAAAGCTGTCGCCACGCGT
GCGCAGGTTATCGGACGGCTGTAAACGCCGGCATCGACTTCGGCTGTCTTCAAGCGATCGGCGTGGGGAGTCACGGCACCAA
CAAGACGAGTCGCTCCTGAAGCGGATGTCTTCTTCAGGGGAAGCCGGGGGAAACCCCTTTTTTTTTT

P. aeruginosa tulpina nr. 21 (nuoD R)


GGGCGCTATCGTCGCGTTGTGGGCAGCGGTACCTCGAACTCGAAGTTCTCGTAGCCGGAGTAGGGGCGGGCCTTGCGCAGGT
CGAAGTCGCAACCGGTGGCGCGCAGGCCGGCGCCGGTGGTGCCCCACTCGAGGGCTTCCTTGGTGTTGTACTGGGCGACGCC
GATGGTCCGGCCGCGCAGGATGCTGTTCTTCGGGGCCGCGATCTCGTACTCGTCGAGGCGCTTGGGCATCCAGTCGAGGAAC
TCGCGGACCAGCTTGTCCCAGCCGCGCGGCAGGTCGTGGGCGAGCCGCCGATGGAGACCAGGCCGGGGCAGGCGGAGCCG
GTGAGGCCTCGACACCTTGTAGCGCGCTGCGGTCGGTGAAGGGAAGAACACCGGGGCATGCGCCGACGTCCTGGATATAGTC
CCAGGTACAGCAGGTGGTCAGGAACGGAAGACTCCCTATCATGATCCGGATCCGTCGACCGCTGGGCACCTTGATCCGGCGA
GCTTCTCCCCGAGAGACGTAGGCAGGTTTTCATCCCCCGCCGAGTAGTCGATGCGGTCGGTGTAGGGAATGAACTGTGCCAG
GATTGCGCTCGGCATCTTCTCGGCGCGCGCTGCGATACCGATCTCCGGACGCAGCTATGATTCCTCGCGTCAGCTGCAGATGA
TGCGCAACGACCGTGGCCGACGGTGGTTCGGCCGAGCTGAGGACATGTAGTGTCGTCTCGCGTGCGCTAATGCACAGTCTCC
GTTTGAACGCAGGCCTCTGCTCAGGTCTGCTGGCGCGACAGGAGAGGATCGACTCGGGGCCCCCCGGTAGCCTGCGCGCGAT
GCCTCCAGTCGCGCATCACATCTGTCAGTCAGATGCTGTAAGTATCCGAATTCCAAGTCGGTGTCATTGTGTGGAAGGGGGGG
GGGGGAGGGAAAAAAGAAAAC

P. aeruginosa tulpina nr. 21 (ppsA R)


CCGGTGTCCAATGCGCGACAGGCTGGCGTCTCATTGGACTTGAAGTCGGACAGGCGCACGATGACCTTCTTCGGCCAGAACGC
CGCGGCCAGGGTGCTGATGCCCTCCACCAGTTTCTCGACGTAGAAGCCGACCGGATCGGGATAGCCGGCGATGCGCTTCTCCA
CGCTTTCCTTGATGTCCGCCGGCAGGCCGGCGAAGTTCAGCAACGCCTTGGGATGCACGCCGATCATGCGGTTGATGATGAAT
TCGAGGCGGGCCAGGCCCACGCCTTCGTTCGGCAACTGGGCGAAATCGAAAGCGCGATCGGGATTGCCGACGTTCATCATGA
TCTTGAACGGAAGGTCGGGCATGGCGTCGACCGAGTTCTTGCGCACATCGAAACCGAGTTCGCCTTCGAAGATGAAGCCGGT
ATCGCCTTCGGCACAGGAAACGGTCACCCCCTGGCCATCCTGCAGGATCTGGGTGGCGTTGCCGCAACCGACCACCGCCGGG
ATGCCCAGTTCGCGAGCGATGATCGCCGCGTGGCAGGTACGCCCGCCGCGGTTGGTGACGATGGCGCTGGCGCGCTTCATCA
CCGGCTCCCAGTCCGGGTCGGTCATGTCGGAGACCAGGACGTCACCCGGTTGGACCTTGTCCATTTCCGACACGTCGTTGATC
ACCTTGACCGGACCGGCACCGATGCGCTGGCCGATGGCACGCCCTTCCACCAGGACGGTCCCCTTCTCTGTCAGCAGGTAGCG
CTCCATGACCGTGGCGCTGGCGCGGCTCTTCACGGTTTCCGGGCGTGCCTGGACGATGTACAGCTTGCCGTCGTCACCGTCCTT
GGCCCATTCGATGTCCATCGGGCGGCCATAGTGCTTCTCGATGATCATGGGCCTGCTTGGCCAGCTCGGTGACCTCGGCGTCG
CTCAGGGCGAAGCGGGCGCGATCGGCCAATCATCAAACTAATTTTAATTTGGGGACACACACACACACAAAAGGCCCCGGAG
CGAAAA

P. aeruginosa tulpina nr. 21 (trpE R)


CCCCTCCCGCGTGCCCGAGTCGGCACGATACCGCCGCCGGCCTGCACGTGGAGTTCACCGTTCTTGATCACCGCGGTGCGGAT
GGCAATGGCGGTGTCCATGTTGCCGTTCCATGCCAGGTAGCCGACCGCGCCGCCGTAGACTCCACGCTTGACCGGCTCCAGCT
CGTCGATGATCTCCATGGCGCGGATCTTCGGCGCGCCGGATAGAGTGCCCGCCGGCAGGATCGCCCGCAGCGCGTCCATCGC
GCTGAGCCCCTCGCGCAATTGCCCGGTGACGTTGGACACGATGTGCATGACGTTGGAGTAACGTTCGATCACCATTTTTTCGGT
GACCTTCACCGCGCCGATATCGGACACCCGCCCCACGTCGTTGCGCCCCAGGTCGATCAGCATCAGGTGCTCGGCGATCTCCTT
GGCGTCCGACAGCAGATCCTGCTCCAGTGCCAGGTCGGCCTCTTCGTTGATCCCGCGCGGACGGGTACCGGCGATCGGGCGC
ACCGTCACCAGGCCATCCTCGACCCGTACCAGCACCTCCGGCGAGCTGCCCACGACATGGAAGTCGCCGAAGTTGAAGAAGTA
CATGTAGGGCGTCGGATTGAAACAGCGCAGCGCGCGGTACAGGTCGATGGGCGCCGCCTTGAATTCGATGGACATGCGCTGC

186

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GACGGCACCACCTGCATGCAGTCGCCGGCCAGGATGTAGTCCTTGATCCTTCCTACCGCGTTTTCATAGTCCTCGCGGGTGAAG
CTGGCACGAAACGCAGTCGCCCTTTGGGGGGGAACAGAAAAGTCCGGGGGGTTT

P. aeruginosa tulpina nr. 26 (acsA R)


GGGCTGCGTCTGCCGACACCGCCGCCTCGGCGACCTTCGGGTGGGCGACCATCGCGCTTTCCACCTCGGCGGTGCCCATGCGG
TGGCCGGAGACGTTGAGCACGTCGTCGACCCGCCCGGTGATCCAGTAGTAGCCGTCCTCGTCGCGGCGCGCGCCGTCGCCGG
TGAAGTACATGCCCTTGAAGGTCTTGAAGTAGGTGTCGACGAAGCGGTCATGGTCGCCGAACAGGGTCCGCGCCTGGCCCGG
CCAGGAGTCGAGGATCACCAGGTTGCCCTCGGCGGCGCCCTCGATCAGGTTGCCGAGGTTGTCCACCAGCGCCGGGACCACG
CCGAAGAACGGCTTGGCCGCGGAGCCCGGCTTCATCGCATGGGCGCCCGGCAACGGGGTCATCAGGCAGGCGCCGGTCTCG
GTCTGCCACCAGGTGTCGACGATCGGGCAGCGCGACTGGCCGACGGTCTCGTAGTACCACTGCCAGGCTTCCGGGTTGATCG
GCTCGCCCACCGAACCGAGCAGACGCAGGCTGGAACCGTCGGCACCGGCGACCGCCGCCTTGCCTTCGGCCATCATCGCGCG
GATCGCGGTCGGCGCGGTGTAGAGGATGTTGACCTTGTGCTTGTCGATGATTTTCGCCACGCGGGTCACGTCGGGGTAGTTCG
GCACGCCCTCGAACAGAATGGTGGTGGCGCCGTTGGCCAACGGGCCATAGACGATGTAGGTGTGGCCGGTGACCCAGCCGAT
GTCGGCGGTGCACCAGTAGACTTCGCCCGGACGGTAGTCGAAGACCCGCTCGTGTACAGGGGAACCCCAGAGAAAAAAGAA
AAAAAAAGAAAAGCCCGGAGAAAATCGTAAACTAAAGGG

P. aeruginosa tulpina nr. 26 (aroE R)


GGCGTGATGTACCGATTTGAGACGTACGTCTCAATGCTGTCTGACAACTCAGACAGTTGCCAATTGCCGGCGCAGCGTCTCCA
ACACTGGCGCCGAGGCAGGACGCACGCCACGCCAGAGGAAGAATGCCTCGGCGGCCTGCTCCACCAGCATGCCCAGGCCATC
CAGGGTACGCGCCGCACCGCGTTCGGCGGCCCAGCGGTTGAAGGCGGTCGGTTCCTTGGCATACATCATGTCGTAGCAAACG
GTACGGCCGGGCTCGATCACGCTCTGCGCCAGCGGCGGCACGTCGCCGGCAAGACTGGCCGAGGTGCCGTTGACGATCAGGT
CGAAAGGCCCTTCGACCTCGGCGAAACCGCAGCCGTGCACCGCGCCGAGGTCGGCGAACCGCTCGGCCAGGTCCACGGCCTT
CCGCGCCGTGCGGTTGGCGATCAGCACCTCCGCCGGGCACTCGCCGAGGAAGGGTTCGAGCACCCCACGCACCGCACCGCCG
GCGCCGAGCAGGAGAACCCGCTTGCCGCGCAGCTCGACCCCGGCGTTCGCCGTCAGGTCCCGCAGCAGGCCGGCGCCGTCGG
TGTTGTCGCCGCGCAGGCGACCGTCGCCGAGCCGAATCAGGGTGTTCACCGCCCCGGCCCGGGTGGCCCGCTCGCTCAACTC
GTCCACCAGACGATAGGCCTCTTCCTTGAACGGCACGGTGACATTGGCGCCCTTGCCCTGCTCGAAGAAGCGCCGGGCGAACC
CGGGGAAATCGTCCAGCGGCGCCAGTTGCGCGTCATAGACCAGCGCCTCGCCGGTCTGCTCGGCGAACAGGCGGTGGATCAG
CGGCGACTTGCTGTGGCCGATGGGGTTGCCGAATACGCAATAGCGGTCCATGGTTCGTTCCTTTTGCCGGAGTGGGACGGGA
CGAGCGGACTCGTCCCCTGGAGGCCGGGTCAGGGCTTGTCCGGCCAAGCCAATCAGCGGTCGGCAGAGGAAATTACTCGGTC
AGGCGCGCTTCCTCGCTGCCCGCTGATAAAAAAAAAAAAACACCCCCCAACCACAACAAAAAAAAAAAGGCGGTTTTATATTA
AACGG

P. aeruginosa tulpina nr. 26 (guaA R)


TCCGGTCTAAGGCGCATTCCTCGATGAGATGTGGTCGGCCTGGCGCAGCAGGTCGGCGTACTCCTTCTTCACCTCGCCGAGGA
TGCGCACGCCCAGGCCCGGGCCGGGGAACGGGTGGCGGTAGACCATGTCGTAGGGCAGGCCCAGCTCCAGGCCGATCTTGC
GCACTTCGTCCTTGAACAGTTCGCGCAGCGGCTCGACCAGTTCGAACTGCATGTCCTCCGGCAGGCCGCCGACGTTGTGGTGC
GACTTGATCACGTGGGCCTTGCCGGTCTTGGCGCCGGCCGACTCGATCACGTCGGGGTAGATGGTGCCCTGGGCGAGGAACT
TCACGTCCTGCAGCTTGGTGGCTTCTTCGTCGAAGACTTCGATGAAGGTGCGGCCGATGATCTTGCGCTTCTCTTCCGGGTCGG
CGACGCCGGCCAGGCGGCCGAGGAACTTGTCCTCGGCGTTGGCGCGGATCACCTTCACGCCCATGTTCTCGGCGAACATGGCC
ATCACCTGGTCGCCTTCGTGCAGGCGCAGCAGGCCGTTGTCGACGAACACGCAGGTCAGTTGGTCGCCGATGGCCTTGTGCAA
CAGCGCGGCGACCACCGAGGAGTCCACGCCGCCGGAGAGGCCTAGCAGGACCTTGGAGGAACCGACCTGGGCGCGCACGGT
GGCGATGGCGTCGTCGACGATGTTCGAGGGGGTCCACAGCGCGGCGCAACCGCAGATGTCGAGGACGAAGCGCGAGAGAAT
GCGCAGGCCCTGCTTGGTGTGGGTGACTTCCGGGGTGGAATTGCACGCCGTAGTAGGCGCGGGCATCGTCGGCCATGGCGG
CGATCGGGCAGCTCGGGGTGCTGGCCAAGGATGTGGAAAGCCGGCCGGCATCTCGGTGACCTTGTCGCGTGCCCACCCCCTG
GAAAAAAGAGAGAGAGCGCGCGGGACCCCCCTCCCCAA

187

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti

P. aeruginosa tulpina nr. 26 (mutL F)


GCGGTCTCGCACTGCGTCAGTACTCCCGTCGAAGCCTTGACGCGGGCCGGCGCTTGATGTGTAGGCGAGGGGACGTGTCCAC
TTGATCCGAGACACGCCGACGCCCGGGGCTCCCCGCCGACGACCTGCCGCTGCTCCTGGCCGCTTCTACCTGGCGAGATAGAC
GAGCGCCGACCTGGGGCGGGATCCGAGCCTCGGCTTCCGTGGCGAGGTTGCCACTCTCTCAGTTCGGGAGCTCCCCGACCAT
GATCTCGCGTACCGCCGACGCCGGCAAAGCCTGGAGGGGGAAACCGAGGGCCGCGACATGCAGCCGCGGTTACAGCCGGCG
GCGCACCCGGGGGGGACCAGCGTCAGGGTCGGCGACCTGTTCTTAAACACCCCGGCGGGGGAAAGTTCTTGCGTGCCGAAA
AGACAGAGTTCACCCTTCTGCGGGAGGTCATCAAGCGCCTGGGGCTGCCCGTTTCGAGGGGCTTTCCACCTGCCCAAAAGCGG
CAAGACCATCTTCGCCCTGCAGGGGCGCGAGAGGGCTGCCCGCGCGCCCCGGTCCGGCGCGTTTGCGGCCAGCTTTCCTCGG
GCGGCCTGCAATCGAGGCGAGCCAAGGCCTGCCCTGGGGGCTGGGTGGTTTGCAACTTTCTCCGAGCAGCCGGACTGCATTT
TTCTATGTAACGGCCGAGGGGGGAAAGTGCCCCCACGGGGGCCAGTTATCGCACGGGTGAAAAGGCGAATCCACTTCGTGTG
TCTCAAGCAATCGGGGTGGAGACGCACTGACCCACAAGAGATTGCTCGAGAGCGATACTCTTCTTTTTAA

P. aeruginosa tulpina nr. 26 (nuoD R)


GGGGGCGGATCGTCGCGTTGTGGGCAGCGGTACCTCGAACTCGAAGTTCTCGTAGCCGGAGTAGGGGCGGGCCTTGCGCAG
GTCGAAGTCGCAACCGGTGGCGCGCAGGCCGGCGCCGGTGGTGCCCCACTCGAGGGCTTCCTTGGTGTTGTACTGGGCGACG
CCGATGGTCCGGCCGCGCAGGATGCTGTTCTTCAGGGCCGCGGTCTCGTACTCGTCGAGGCGCTTGGGCATCCAGTCGAGGA
ACTCGCGGACCAGCTTGTCCCAGCCGCGCGCAGGTCGTGGGCGAGCCGCCGATCGGTACCAGGCCGGGGCAGGCGGAGCCG
GGATGGCCTCGACCACCTTGTAGCGCGCTGGCGGCGGTGAAGGGAAGAACACCGGGGTCATGGCGCCGACGTCCTGGATAT
AGGTCCCAGGTACAGCAGGTGGTCAGGAACGGAAGACTCCCCATCATGATCCGGATCACGTCGACCGCTGCGCACCTTGATCC
CGGGAGCTTCTCCCCGAGAGACGTAGGCAGGTTTTCATCCCCCGCCGAGTAGTCGATGCGGTCGGTGTAGGGAATGAACTGT
GCCAGGACTGGCGCTCGGCCATCTTCTCGGCGCCGCGCTGATGATAGCCGATCTCCGGGACGCAGTCTATGATCTCCTCGCCG
TCGAGTTGCAGCATGATGCGTAACGCACCAGTGGCCGCACGGGTGGTTCGAGCCGAGCTTGAGGAACATGTAGTCCTCGTTCT
ACGCGTGGCGCTACATGCACCAGTCTTCCGGCTTGAAGCGCAGCGCCTCCTGCTCCAGGTCCTGCTTTGGCGACGACAGCGAG
TAGGAATCCGTCTCGGTGGCACGCGCCGGGTAGTCCTTGCCAGCGGATGGCCTGCCAGGTCGGCGCATCAGCATGCGGTCAG
GTGCGGATGCTGTGAAGTAATGCCGTAATGTCCACATTCCGCTCTACATGTGGTGGGAGGAGGGCGGGGAGGGAGAGAAAA
AAGGGGGGGGGGAAGAGGAGAAGG

P. aeruginosa tulpina nr. 26 (ppsA R)


CCCTTGATTCGTCGCGCGACAGCGTGGCGTCTCATTGGACTTGAAGTCGGACAGGCGCACGATGACCTTCTTCGGCCAGAACG
CCGCGGCCAGGGTGCTGATGCCCTCCACCAGTTTCTCGACGTAGAAGCCGACCGGATCGGGATAGCCGGCGATGCGCTTCTCC
ACGCTTTCCTTGATGTCCGCCGGCAGGCCGGCGAAGTTCAGCAACGCCTTGGGATGCACGCCGATCATGCGGTTGATGATGAA
TTCGAGGCGGGCCAGGCCCACGCCTTCGTTCGGCAACTGGGCGAAATCGAAAGCGCGATCGGGATTGCCGACGTTCATCATG
ATCTTGAACGGAAGGTCGGGCATGGCGTCGACCGAGTTCTTGCGCACATCGAAACCGAGTTCGCCTTCGAAGATGAAGCCGG
TATCGCCTTCGGCACAGGAAACGGTCACCCCCTGGCCATCCTGCAGGATCTGGGTGGCGTTGCCGCAACCGACCACCGCCGGG
ATGCCCAGTTCGCGAGCGATGATCGCCGCGTGGCAGGTACGCCCGCCGCGGTTGGTGACGATGGCGCTGGCGCGCTTCATCA
CCGGCTCCCAGTCCGGGTCGGTCATGTCGGAGACCAGGACGTCACCCGGTTGGACCTTGTCCATTTCCGACACGTCGTTGATC
ACCTTGACCGGACCGGCACCGATGCGCTGGCCGATGGCACGCCCTTCCACCAGGACGGTCCCCTTCTCTTTCAGCAGGTAGCG
CTCCATGACCGTGGCGCTGGCGCGGCTCTTCACGGTTTCCGGGCGTGCCTGGACGATGTACAGCTTGCCGTCGTCACCGTCCTT
GGCCCATTCGATGTCCATCGGGCGGCCATAGTGCTTCTCGATGATCATGGCCTGCTTGGCCAGCTCGGTGACCTCGGCGTCGC
TCAGGGCGAAGCGGGCGCGATCGGCCAATCATCAACATATGATTAATGTGGGGGAACACAAAACAAAAAAAAAACCCCCCCC
GC

P. aeruginosa tulpina nr. 26 (trpE R)


CCCCTCCCGCGGGCCCGAGTCGGCACGATACCGCCGCCGGCCTGCACGTGGAGTTCACCGTTCTTGATCACCGCGGTGCGGAT
GGCAATGGCGGTGTCCATGTTGCCGTTCCATGCCAGGTAGCCGACCGCGCCGCCGTAGACTCCACGCTTGACCGGCTCCAGCT
CGTCGATGATCTCCATGGCGCGGATCTTCGGCGCGCCGGATAGAGTGCCCGCCGGCAGAATCGCCCGCAGCGCGTCCATCGC
GCTGAGCCCCTCGCGCAATTGCCCGGTGACGTTGGACACGATGTGCATGACGTTGGAGTAACGTTCGATCACCATTTTTTCGGT

188

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GACCTTCACCGCGCCGATATCGGACACCCGCCCCACGTCGTTGCGCCCCAGGTCGATCAGCATCAGGTGCTCGGGATCTCCTTG
GGTCCGAAACAGATCCTGCTCAAGTCCAGGTCGGCCTCTTCGTTGATCCCGCGCGGACGGGTACCGGCGATCGGGCGCACCGT
CACCAGGCCGTCCTCGACCCGTACCAGCACCTCCGGCGAGCTGCTCACGACATGGAAGTCGCCGAAGTTGAAGAAGTACATGT
AGGTCGTCGGATTGAAACAGCGCAGCGCACGGTACAGGTCGATGGTCCCCGCCTTGAATTCGATGGACATGCGCTGCGATGG
CACCACCTGCATGCAGTCGCCGGCCAGGATGTAGTCCTTGATCCTTCCTACCGCGTTTTCATAGTCCTCGCGGGTGAAGCTGGC
ACGAAACGCAGCTCACCCCCGGGCGGCCCAAAAAACCCCCCCGCCCCCCA

MLST la A. baumannii
A. baumannii tulpina 27 (rpoD R)
CCTTGGGGTTTACCGGTCCATAACGGCCACGACGTACTGCATAACGCATAATTTCACGTTCATTGGCACGAATTTGTTCATGAG
TTCCGCGAATCATTTCTGAAATGATGTCAAATAAACGTGGAGTAAATTTAAACATCATAAATACAGTTGCTAAAGACTCAAGAG
CTTCATTTGCTTCAGGGCTATTACGGCCATGTTTTTCGATGACAGCTTTAGTTTGAGCCCATGCAGCTTCTAATTCAGCAAAACG
AACTTTTGCAACTTCAGGGTCTGGACCTGAATCACCTTCAGAATCATCATCACCTTCAGACTCTTCTTCTTCATCGTCATCATCAA
GCTTAACTTCTTTCGTTGACTTTGTAGATGATTCGTCTTCTTCCTCAAGCTCTTCAACATCTTCTAAAACTTCAGGAATATCTTCGT
CAGTTTCAGGGTCTAAATAACCAGATAAGATATCGGCAAGACGGCGTTCGCCAGTTAAAAAATCATTATATTCTTTTAATACAA
CTTCAACAGCATTTGGCCAGTAAGCGATTGAGTTCAAGACATCACGAATGCCTTCTTCAATACGTTTAGCAATGTGTTCCCCCCC
TTTTAAAAAAAATTTGCTATTTTTTTCCCAAG

A. baumannii tulpina 27 (recA R)


TTGCAAGCAATTGCTCAATGTCAAAAATCTGGTGGTACATGTGCCTTCATTGATGCTGAGCACGCCCTAGACCCTCAATATGCA
CGCAAACTTGGTGTAGATATTGATAACCTACTTGTTTCACAACCCGACAACGGTGAGCAAGCACTTGAAATTGCTGACATGCTT
GTCCGTTCAGGCGCAATTGATTTAATCGTTGTGGACTCGGTAGCTGCACTTACCCCTAAAGCAGAAATCGAAGGTGAGATGGG
TGACTCTCATATGGGTCTACAAGCACGTCTTATGAGCCAGGCACTTCGTAAAATTACGGGTAATGCTAAACGTTCAAACTGTAT
GGTTATCTTCATTAACCAGATTCGTATGAAAATTGG

A. baumannii tulpina 27 (gyrB R)


GACAACGGCATTGCTGTAGAAGTAGCATTGCAATGGAACGATAGTTACCAAGAAAATGTTCGCTGTTTCACAAACAACATTCC
ACAAAAAGATGGTGGTACGCACTTAGCAGGTTTCCGCGCAGCTTTAACACGTGGCTTAAACCAGTATCTTGAAAATGAAAATA
TTCTCAAGAAAGAAAAAGTGAATGTGACTGGTGATGATGCGCGTGAAGGTTTAACAGCCATTATTTCTGTTAAGGTTCCTGATC
CGAAATTCTCGTCTCAGACAAAAGAAAAATTGGTATCAAGTGAGGTAAAACCAGCGGTAGAGCAAGCAATGAACAAAGAGTT
CTCTGCTTACTTACTTGAGAATCCACAAGCTGCAAAATCAATTGCAGGCAAGATTATTGATGCTGCACGCGCACGTGATGCTGC
ACGTAAAGCACGTGAAATGACACGCCGTAAGAGTGCATTAGCC

A. baumannii tulpina 27 (gpi R)


CGCGGTGCTACGGGTGAAGTGATTCAGGATGTCGTTAATATTGGTGTAGGTGGTTCCGATTTAGGGCCTCAAATGGTGACCCA
TGCACTATGCGATTTTAAAGTAAAAACTGCCAAACCTCTTAATGTACACTTCGTTTCGACTATGGATGGTAGCCAGTTATCAGAT
TTGCTCCATCAACTGCGTCCAGAAACAACTTTATTTATTATTTCTTCAAAGTCATTTGGTACCATTGATACCTTATCAAATGCACA
AACAGTTCGTCAGTGGCTTGAAAAAGCTTTAGGAAAGCATGACCGCGTTGT

A. baumannii tulpina 27 (gltA R)


GATCCTGGTTTTATGGCGACAGCTTCATGCGAGTCTAAAATCACATTTATCGATGGTGACAAAGGTATTTTATTACACCGCGGT
TACCCGATTGACCAGTTAGCGACTCAAGCAGACTACCTTGAAACTTGTTATTTATTATTAAATGGCGAGTTACCAACTGCTGAA
CAAAAAGTTGAGTTCGATGCGAAAGTTCGTGCTCATACTATGGTTCATGATCAAGTTAGCCGTTTCTTCAATGGTTTCCGTCGT
GATGCTCACCCTATGGCAATCATGGTTGGTGTAGTAGGCGCATTATCTGCTTTCTATCACAACAACCTTGACATTGAAGACATC
AACCACCGCGAAATTACTGCGATTCGTTTGATTGCTAAAATTCCAACGCTTGCTGCTTGGAGCTACAAATATACTGTAGGTCAG

189

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
CCATTCATCTATCCACGTAATGACTTAAATTACGCGGAAAACTTCTTACACATGATGTTTGCAA

A. baumannii tulpina 27 (gdh R)


AGAGTAAATCCTGAATCTGGTAGCGCGAAAACAGTATTTCAGGTTCCTGAAATTGTGAGTGATGCTGATGGGCAAAATGGTTT
GTTAGGCTTTGCTTTTCATCCTGACTTTAAACATAACCCTTATATCTATATTTCAGGCACTTTTAAAAATCCAAAATCTACAGATA
AAGAGTTACCTAATCAGACGATTATTCGTAGATATACCTATAACAAAACTACAGATACATTTGAAAAGCCTATTGATTTGATTGC
AGGTTTACCGTCATCAAAAGACCATCAGTCTGGTCGTCTTGTCATTGGTCCAGACCAAAAAATCTACTATACGATTGGTGACCA
AGGCCG

A. baumannii tulpina 27 (cpn60 R)


ATGAACCCAAGGAGTAAAACGCGGTATCGACAGGCAGTAAAAACTGTAGTTGAAAATATCCGTTCTATTGCTAAACCAGCTGA
TGATTTCAAAGCAATTGAACAAGTAGGTTCAATCTCTGCTAACTGTGATACTACTGTTGGTAAACTTATTGCTCAAGCAATGGA
AAAAGTAGGTAAAGAAGGCGTAATCACTGTAGAAGAAGGCTCAGGCTTCGAAGACGCATTAGACGTTGTAGAAGGTATGCAG
TTTGACCGTGGTTATATCTCTCCGTACTTTGCAAACAAACAAGATACTTTAACTGCTGAACTTGAAAATCCGTTCATCCTTCTTGT
GATAAAAAAA

A. baumannii tulpina 27 (cpn60 F)


CCAACCTGTGTGCATGGAAAAACTTGTATGTTTGAAAATATGCCCTTCTATTGCTGAACCAGCTGATGATTTCAAGCAATTGAA
CAAGTAGGTTCAATCTCTGCTAACTCTGATACTACTGTTGGTAAACTTATTGCTCAGGCAATGCAAAAAGTAGGTAAAGAAGGC
GTAATCACTGTAGAAGAAGGCTCAGGCTTCGAAGACGCATTACACGTTGTAGAAGGTATGCAGTTTGACCGTGGTTATATCTC
TCCGTACTTTGCAAACTAACAGATACTTTAACTGCTGAACTTGAAAATCCGTTCATCCTTCTTGTTGATAAATAAATCAGCAACA
TTCGTGAATTGATTTCTGTTTTAGAAGCAGTTGCTAAAACTGGTAAACCACTTCTTATCATCGCTGAAGATGTGGGGGGGAAAG
GGGG

A. baumannii tulpina A (rpoD R)


TGGCCAAATGCTGTTGAAGTTGTATTAAAAGAATATAATGATTTTTTAACTGGCGAACGCCGTCTTGCCGATATCTTATCTGGTT
ATTTAGACCCTGAAACTGACGAAGATATTCCTGAAGTTTTAGAAGATGTTGAAGAGCTTGAGGAAGAAGACGAATCATCTACA
AAGTCAACGAAAGAAGTTAAGCTTGATGATGACGATGAAGAAGAAGAGTCTGAAGGTGATGATGATTCTGAAGGTGATTCAG
GTCCAGACCCTGAAGTTGCAAAAGTTCGTTTTGCTGAATTAGAAGCTGCATGGGCTCAAACTAAAGCTGTCATCGAAAAACAT
GGCCGTAATAGCCCTGAAGCAAATGAAGCTCTTGAGTCTTTAGCAACTGTATTTATGATGTTTAAATTTACTCCACGTTTATTTG
ACATCATTTCAGAAATGATTCGCGGAACTCATGAACAAATTCGTGCCAATGAACGTGAAATTATGCGTTATGCAGTACGTCGTG
GCCGTATGGAC

A. baumannii tulpina A (recA R)


TTGCAAGCAATTGCTCAATGTCAAAAATCTGGTGGTACATGTGCCTTCATTGATGCTGAGCACGCCCTAGACCCTCAATATGCA
CGCAAACTTGGTGTAGATATTGATAACCTACTTGTTTCACAACCCGACAACGGTGAGCAAGCACTTGAAATTGCTGACATGCTT
GTCCGTTCAGGCGCAATTGATTTAATCGTTGTGGACTCGGTAGCTGCACTTACCCCTAAAGCAGAAATCGAAGGTGAGATGGG
TGACTCTCATATGGGTCTACAAGCACGTCTTATGAGCCAGGCACTTCGTAAAATTACGGGTAATGCTAAACGTTCAAACTGTAT
GGTTATCTTCATTAACCAGATTCGTATGAAAATTGG

A. baumannii tulpina A (gyrB R)


GACAACGGCATTGCTGTAGAAGTAGCATTGCAATGGAACGATAGTTACCAAGAAAATGTTCGCTGTTTCACAAACAACATTCC
ACAAAAAGATGGTGGTACGCACTTAGCAGGTTTCCGCGCAGCTTTAACACGTGGCTTAAACCAGTATCTTGAAAATGAAAATA
TTCTCAAGAAAGAAAAAGTGAATGTGACTGGTGATGATGCGCGTGAAGGTTTAACAGCCATTATTTCTGTTAAGGTTCCTGATC
CGAAATTCTCGTCTCAGACAAAAGAAAAATTGGTATCAAGTGAGGTAAAACCAGCGGTAGAGCAAGCAATGAACAAAGAGTT

190

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
CTCTGCTTACTTACTTGAGAATCCACAAGCTGCAAAATCAATTGCAGGCAAGATTATTGATGCTGCACGCGCACGTGATGCTGC
ACGTAAAGCACGTGAAATGACACGCCGTAAGAGTGCATTAG

A. baumannii tulpina A (gpi R)


CGCGGTGCTACGGGTGAAGTGATTCAGGATGTCGTTAATATTGGTGTAGGTGGTTCCGATTTAGGGCCTCAAATGGTGACCCA
TGCACTATGCGATTTTAAAGTAAAAACTGCCAAACCTCTTAATGTACACTTCGTTTCGACTATGGATGGTAGCCAGTTATCAGAT
TTGCTCCATCAACTGCGTCCAGAAACAACTTTATTTATTATTTCTTCAAAGTCATTTGGTACCATTGATACCTTATCAAATGCACA
AACAGTTCGTCAGTGGCTTGAAAAAGCTTTAGGAAAGCATGACCGCGTTGT

A. baumannii tulpina A (gltA R)


GATCCTGGTTTTATGGCGACAGCTTCATGCGAGTCTAAAATCACATTTATCGATGGTGACAAAGGTATTTTATTACACCGCGGT
TACCCGATTGACCAGTTAGCGACTCAAGCAGACTACCTTGAAACTTGTTATTTATTATTAAATGGCGAGTTACCAACTGCTGAA
CAAAAAGTTGAGTTCGATGCGAAAGTTCGTGCTCATACTATGGTTCATGATCAAGTTAGCCGTTTCTTCAATGGTTTCCGTCGT
GATGCTCACCCTATGGCAATCATGGTTGGTGTAGTAGGCGCATTATCTGCTTTCTATCACAACAACCTTGACATTGAAGACATC
AACCACCGCGAAATTACTGCGATTCGTTTGATTGCTAAAATTCCAACGCTTGCTGCTTGGAGCTACAAATATACTGTAGGTCAG
CCATTCATCTATCCACGTAATGACTTAAATTACGCGGAAAACTTCTTACACATGATGTTTGCAA

A. baumannii tulpina A (gdh R)


TGTCATTACTATTGGAGCTCTTGCTGAGTCGGAGTATGCTGTGCCTGATTTGGTAAGAACAGATAAGCTAACTGATTACGGCCT
TGGTCACCAATCGTATAGTAGATTTTTTGGTCTGGACCAATGACAAGACGACCAGACTGATGGTCTTTTGATGACGGTAAACCT
GCAATCAAATCAATAGGCTTTTCAAATGTATCTGTAGTTTTGTTATAGGTATATCTACGAATAATCGTCTGATTAGGTAACTCTT
TATCTGTAGATTTTGGATTTTTAAAAGTGCCTGAAATATAGATATAAGGGTTATGTTTAAAGTCAGGATGAAAAGCAAAGCCTA
ACAAACCATTTTGCCCATCAGCATCACTCACAATTTCAGGAACCTGAAATACTGTTTTCGCGCTACCAGATTCAGGATTTACTCT
TAAAATTTTGCCAGTTGCACGTTCGGTTAACCAAATTTGATTATCTGGCCCCCATAAAAACAAGGTGGAA

A. baumannii tulpina A (cpn60 R)


TACAGTTTTAGCAACTGCTTCTAAAACAGAAATCAATTCACGAATGTTGCTGATTTTTTTATCAACAAGAAGGATGAACGGATTT
TCAAGTTCAGCAGTTAAAGTATCTTGTTTGTTTGCAAAGTACGGAGAGATATAACCACGGTCAAACTGCATACCTTCTACAACG
TCTAATGCGTCTTCGAAGCCTGAGCCTTCTTCTACAGTGATTACGCCTTCTTTACCTACTTTTTCCATTGCTTGAGCAATAAGTTT
ACCAACAGTAGTATCAGAGTTAGCAGAGATTGAACCTACTTGTTCAATTGCTTTGAAATCATCAGCTGGTTTAGCAATAGAACG
GATATTTTCAACTACAGTTTTTACTGCAATGTCGATACCGCGTTTTAAATCCATTGGGTTCATACCAGCAGTTACTGATTTGATAC
CTTCATTTAAAATTGCTTGAGTTGTTTACTGGCTA

A. baumannii tulpina A (cpn60 F)


ATGAACCCAATGGATTTAAAACGCGGTATCGACATTGCAGTAAAAACTGTAGTTGAAAATATCCGTTCTATTGCTAAACCAGCT
GATGATTTCAAAGCAATTGAACAAGTAGGTTCAATCTCTGCTAACTCTGATACTACTGTTGGTAAACTTATTGCTCAAGCAATG
GAAAAAGTAGGTAAAGAAGGCGTAATCACTGTAGAAGAAGGCTCAGGCTTCGAAGACGCATTAGACGTTGTAGAAGGTATGC
AGTTTGACCGTGGTTATATCTCTCCGTACTTTGCAAACAAACAAGATACTTTAACTGCTGAACTTGAAAATCCGTTCATCCTTCTT
GTTGATAAAAAAATCAGCAACATTCGTGAATTGATTTCTGTTTTAGAAGCAGTTGCTAAAACTGGTAAACCACTTCTTATCATCG

A. baumannii tulpina n (rpoD R)


TGGCCAAATGCTGTTGAAGTTGTATTAAAAGAATATAATGATTTTTTAACTGGCGAACGCCGTCTTGCCGATATCTTATCTGGTT
ATTTAGACCCTGAAACTGACGAAGATATTCCTGAAGTTTTAGAAGATGTTGAAGAGCTTGAGGAAGAAGACGAATCATCTACA
AAGTCAACGAAAGAAGTTAAGCTTGATGATGACGATGAAGAAGAAGAGTCTGAAGGTGATGATGATTCTGAAGGTGATTCAG

191

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
GTCCAGACCCTGAAGTTGCAAAAGTTCGTTTTGCTGAATTAGAAGCTGCATGGGCTCAAACTAAAGCTGTCATCGAAAAACAT
GGCCGTAATAGCCCTGAAGCAAATGAAGCTCTTGAGTCTTTAGCAACTGTATTTATGATGTTTAAATTTACTCCACGTTTATTTG
ACATCATTTCAGAAATGATTCGCGGAACTCATGAACAAATTCGTGCCAATGAACGTGAAATTATGCGTTATGCAGTACGTCGTG
GCCGTATGGAC

A. baumannii tulpina n (recA R)


TTGCAAGCAATTGCTCAATGTCAAAAATCTGGTGGTACATGTGCCTTCATTGATGCTGAGCACGCCCTAGACCCTCAATATGCA
CGCAAACTTGGTGTAGATATTGATAACCTACTTGTTTCACAACCCGACAACGGTGAGCAAGCACTTGAAATTGCTGACATGCTT
GTCCGTTCAGGCGCAATTGATTTAATCGTTGTGGACTCGGTAGCTGCACTTACCCCTAAAGCAGAAATCGAAGGTGAGATGGG
TGACTCTCATATGGGTCTACAAGCACGTCTTATGAGCCAGGCACTTCGTAAAATTACGGGTAATGCTAAACGTTCAAACTGTAT
GGTTATCTTCATTAACCAGATTCGTATGAAAATTGG

A. baumannii tulpina n (gyrB R)


GACAACGGCATTGCTGTAGAAGTAGCATTGCAATGGAACGATAGTTACCAAGAAAATGTTCGCTGTTTCACAAACAACATTCC
ACAAAAAGATGGTGGTACGCACTTAGCAGGTTTCCGCGCAGCTTTAACACGTGGCTTAAACCAGTATCTTGAAAATGAAAATA
TTCTCAAGAAAGAAAAAGTGAATGTGACTGGTGATGATGCGCGTGAAGGTTTAACAGCCATTATTTCTGTTAAGGTTCCTGATC
CGAAATTCTCGTCTCAGACAAAAGAAAAATTGGTATCAAGTGAGGTAAAACCAGCGGTAGAGCAAGCAATGAACAAAGAGTT
CTCTGCTTACTTACTTGAGAATCCACAAGCTGCAAAATCAATTGCAGGCAAGATTATTGATGCTGCACGCGCACGTGATGCTGC
ACGTAAAGCACGTGAAATGACACGCCGTAAGAGTGCATTAG

A. baumannii tulpina n (gpi R)


CTGGAGCACAACTGATTTTCAGGAGCAATCCCCCACTCAGTCATTTTTTCAGCTTTTGTAGATACACCAATGAAGTGACTTTTTA
CAACGCGATCATGTTTTCCTAAAGCTTTTTCAAGCCACTGACGAACTGTCTGTGCATTTGATAAGGTATCAATGGTACCAAATG
ACTTTGAAGAAATAATAAATAAAGTTGTTTCCGGACGCAGTTGATGGAGTAGGTCTGATAACTGGCTACCATCCATAGTCGAA
ACAAAGTGTACATTAAGTGGTTTGGCAGTTTTTACTTTAAAATCGCATAGTGCATGGGTCACCATTTGAGGCCCTAAATCGGAA
CCACCTACACCAATATTAACGACATCCTGAATCACTTCACCCGTAGCACCGCGGTATTGCCGCGGCGGTTTTAATAATC

A. baumannii tulpina n (gltA R)


GATCCTGGTTTTATGGCGACAGCTTCATGCGAGTCTAAAATCACATTTATCGATGGTGACAAAGGTATTTTATTACACCGCGGT
TACCCGATTGACCAGTTAGCGACTCAAGCAGACTACCTTGAAACTTGTTATTTATTATTAAATGGCGAGTTACCAACTGCTGAA
CAAAAAGTTGAGTTCGATGCGAAAGTTCGTGCTCATACTATGGTTCATGATCAAGTTAGCCGTTTCTTCAATGGTTTCCGTCGT
GATGCTCACCCTATGGCAATCATGGTTGGTGTAGTAGGCGCATTATCTGCTTTCTATCACAACAACCTTGACATTGAAGACATC
AACCACCGCGAAATTACTGCGATTCGTTTGATTGCTAAAATTCCAACGCTTGCTGCTTGGAGCTACAAATATACTGTAGGTCAG
CCATTCATCTATCCACGTAATGACTTAAATTACGCGGAAAACTTCTTACACATGATGTTTGCAA

A. baumannii tulpina n (gdh R)


AGAGTAAATCCTGAATCTGGTAGCGCGAAAACAGTATTTCAGGTTCCTGAAATTGTGAGTGATGCTGATGGGCAAAATGGTTT
GTTAGGCTTTGCTTTTCATCCTGACTTTAAACATAACCCTTATATCTATATTTCAGGCACTTTTAAAAATCCAAAATCTACAGATA
AAGAGTTACCTAATCAGACGATTATTCGTAGATATACCTATAACAAAACTACAGATACATTTGAAAAGCCTATTGATTTGATTGC
AGGTTTACCGTCATCAAAAGACCATCAGTCTGGTCGTCTTGTCATTGGTCCAGACCAAAAAATCTACTATACGATTGGTGACCA
AGGCCGCATACTCCGACTCAGCAAGAGCTCAATAGTAAAGACTACCATGT

A. baumannii tulpina n (cpn60 R)


CTGGCTTCTAAAACAGAAATCAATTCACGAATGTTGCTGATTTTTTTATCAACAAGAAGGATGAACGGATTTTCAAGTTCAGCA
GTTAAAGTATCTTGTTTGTTTGCAAAGTACGGAGAGATATAACCACGGTCAAACTGCATACCTTCTACAACGTCTAATGCGTCTT
CGAAGCCTGAGCCTTCTTCTACAGTGATTACGCCTTCTTTACCTACTTTTTCCATTGCTTGAGCAATAAGTTTACCAACAGTAGTA

192

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
TCAGAGTTAGCAGAGATTGAACCTACTTGTTCAATTGCTTTGAAATCATCAGCTGGTTTAGCAATAGAACGGATATTTTCAACT
ACAGTTTTTACTGCAATGTCGATACCGCGTTTTAAATCCATTGGGTTCATACCAGCAGTTACTGATTTGATACCTTCATTTAAAAT
TGCTTGGGGGAAAAGGGGGA

A. baumannii tulpina n (cpn60 F)


ATGCGGACATTTGCAGTAAAAACTGTAGTTGAAAATATCCGTTCTATTGCTAAACCAGCTGATGATTTCAAAGCAATTGAACAA
GTAGGTTCAATCTCTGCTAACTCTGATACTACTGTTGGTAAACTTATTGCTCAAGCAATGGAAAAAGTAGGTAAAGAAGGCGT
AATCACTGTAGAAGAAGGCTCAGGCTTCGAAGACGCATTAGACGTTGTAGAAGGTATGCAGTTTGACCGTGGTTATATCTCTC
CGTACTTTGCAAACAAACAAGATACTTTAACTGCTGAACTTGAAAATCCGTTCATCCTTCTTGTTGATAAAAAAATCAGCAACAT
TCGTGAATTGATTTCTGTTTTAGAAGCAGTTGCTAAAACTGGTGAACCACTTCTTATCATCGCTGAAGATGTGGGGGGAAAAG
GGGGA

P. aeruginosa tulpina miu (VEBR)


GAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGGAATTCCCTAATGGAACAAC
TTTGACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGG
AACTGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGA
TTGGAATACCCAATATCAAAATTGGGCAACCCCAACAAA

P. aeruginosa - tulpina R (VEBR)


TTTTGTCTGAGATAGATAAAGGGAATCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGA
GTCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAAT
ATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAACTGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTC
AATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAAA

n urma comparrii secvenelor utiliznd soft-ul Clustal W au fost identificate genele blaVEB-1 la
tulpina de P. aeruginosa codificat R i blaVEB-3 la tulpina de P. aeruginosa codificat miu.
CLUSTAL 2.1 multiple sequence alignment (P. aeruginosa tulpina

R)

VEB-1
VEB2
MY
VEB-3
VEB-7

GATCAACCGAAATTTGCCCTAACAAATGCTTCAACCTGACAATTCCTGTTGTCATGGTTT 60
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

VEB-1
VEB2
MY
VEB-3
VEB-7

GTGCTGTCGCTTTGCTCAGCACAAACCACGCCAAGCCCTTCGGGCCGGAATTGCAGGTTA 120
---------------------------------------------------------TTA 3
----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

VEB-1
VEB2
MY
VEB-3
VEB-7

AGCAAATGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAAAG
AGCAAATGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAAAG
-----------------------------------------------------------------TGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAAAG
-------------------------------------------ATGAAAATCGTAAAAAG

VEB-1
VEB2

GATATTATTAGTATTGTTAAGTTTATTTTTTACAATTGTGTATTCAAATGCTCAAACTGA 240
GATATTATTAGTATTGTTAAGTTTATTTTTTACAATTGTGTATTCAAATGCTCAAGCTGA 123

193

180
63
54
17

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
MY
VEB-3
VEB-7

-----------------------------------------------------------GATATTATTAGTATTGTTAAGTTTATTTTTTACAGTTGTGTATTCAAATGCTCAAACTGA 114
GATATTATTAGTATTGTTAAGTTTATTTTTTACAGTTGAGTATTCAAATGCTCAAACTGA 77

VEB-1
VEB2
MY
VEB-3
VEB-7

CAACTTAACTTTGAAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGC
CAACTTAACTTTGAAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGC
-----------------------------------------------------------CAACTTAACTTTGAAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGC
CAACTTAACTTTGAAAATTGAGAATGTTTTAAAGGCAAAAAATGCCAGAATAGGAGTAGC

300
183

VEB-1
VEB2
MY
VEB-3
VEB-7

AATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACGACTTCCATTTCCCGAT
AATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACGACTTCCATTTCCCGAT
-----------------------------------------------------------AATATTCAACAGCAATGAGAAGGATACTTTTAAGATTAATAACGACTTCCATTTCCCGAT
AATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACGACTTCCATTTCCCGAT

360
243

VEB-1
VEB2
MY
VEB-3
VEB-7

GCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAA
GCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAA
------------------------------------TTTGTCTGAGATAGATAAAGGGAA
GCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAA
GCAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTTTGTCTGAGATAGATAAAGGGAA
************************

420
303
24
294
257

VEB-1
VEB2
MY
VEB-3
VEB-7

TCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAG
TCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAG
TCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAG
TCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAG
TCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTGCCTAAAACGTGGAG
************************************************************

480
363
84
354
317

VEB-1
VEB2
MY
VEB-3
VEB-7

TCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTA
TCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTA
TCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTA
TCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTA
TCCGATTAAAGAGGAATTCCCTAATGGAACAACTTTGACGATTGAACAAATACTAAATTA
************************************************************

540
423
144
414
377

VEB-1
VEB2
MY
VEB-3
VEB-7

TACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAAC
TACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAAC
TACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAAC
TACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAAC
TACAGTATCAGAGAGCGACAATATTGGTTGTGATATTTTGCTAAAATTAATCGGAGGAAC
************************************************************

600
483
204
474
437

VEB-1
VEB2
MY
VEB-3
VEB-7

TGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAA
TGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAA
TGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAA
TGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAA
TGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTCACTGATATTTCAATCAAAGCAAA
************************************************************

660
543
264
534
497

VEB-1
VEB2
MY
VEB-3
VEB-7

CGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAGC
CGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAGC
CGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAAA
CGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAGC
CGAAGAACAAATGCACAAGGATTGGAATACCCAATATCAAAATTGGGCAACCCCAACAGC
**********************************************************..

720
603
324
594
557

VEB-1

GATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAG 780

194

174
137

234
197

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
VEB2
MY
VEB-3
VEB-7

GATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAG 663
-----------------------------------------------------------GATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAG 654
GATGAACAAACTGTTAATAGATACTTATAATAATAAGAACCAATTACTTTCTAAAAAAAG 617

VEB-1
VEB2
MY
VEB-3
VEB-7

TTATGATTTTATTTGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGG
TTATGATTTTATTTGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGG
-----------------------------------------------------------TTATGATTTTATTTGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGG
TTATGATTTTATTTGGAAAATTATGAGAGAAACAACAACAGGAAGTAACCGATTAAAAGG

840
723

VEB-1
VEB2
MY
VEB-3
VEB-7

ACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACTTCCGGAATAAATAATGG
ACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACTTCCGGAATAAATAATGG
-----------------------------------------------------------ACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACTTCCGGAATAAATAATGG
ACAATTACCAAAGAATACAATTGTTGCTCATAAAACAGGGACTTCCGGAATAAATAATGG

900
783

VEB-1
VEB2
MY
VEB-3
VEB-7

AATTGCAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTT
AATTGCAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTT
-----------------------------------------------------------AATTGCAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTT
AATTACAGCAGCCACTAATGATGTTGGGGTAATTACTTTACCGAATGGACAATTAATTTT

960
843

VEB-1
VEB2
MY
VEB-3
VEB-7

TATAAGCGTATTTGTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTC
TATAAGCGTATTTGTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTC
-----------------------------------------------------------TATAAGCGTATTTGTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTC
TATAAGCGTATTTGTTGCAGAGTCCAAAGAAACTTCGGAAATTAATGAAAAGATTATTTC

1020
903

VEB-1
VEB2
MY
VEB-3
VEB-7

AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAAACTACCG----CTA
AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAAACTACCG----CTA
-----------------------------------------------------------AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAGGGTATAGGAAGTAT
AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAA-----------------

1076
959

VEB-1
VEB2
MY
VEB-3
VEB-7

ACACTGGCTCATAGGCAATGGCGG-GTTGAAGTGCAATTTGCA-AAGTCGGTAGCCCGCC 1134
ACACTGGCTCATAGGCAATGGCGG-GTTGAAGTGCAATTTGCA-AAGTCGGTAGCCCGCC 1017
-----------------------------------------------------------AAACCACCTTTTTGCTCCTGGCTCTGTTGCAAAG--ATTGGCGGCAGTCAGAGGTAGGCT 1012
------------------------------------------------------------

VEB-1
VEB2
MY
VEB-3
VEB-7

CGAGCGTTTTCTCGGTTTGACAGGAAAGGCTCACGCAAACCG-CCACTGCCCATAGCCCA 1193
CGAGCGTTTTCTCGGTTTGACAGGAAAGGCTCACGCAAACCG-CCACTGCCCATAGCCCA 1076
-----------------------------------------------------------GTCGC-TCTGCGCCGAT---CAGG--CGGCTGCTGCGAAATGGTGGTTGAGCAT-GCCCA 1065
------------------------------------------------------------

VEB-1
VEB2
MY
VEB-3
VEB-7

AACCGTTAGGCCGCATGGACACAACGCAGGTCACATTGATACACAAAATTCTAGCTGCGG 1253
AACCG------------------------------------------------------- 1081
-----------------------------------------------------------T----------------------------------------------------------- 1066
------------------------------------------------------------

195

714
677

774
737

834
797

894
857

954
900

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
VEB-1
VEB2
MY
VEB-3
VEB-7

CAGATGAGCGAAATCTGCCGCTCTGGATC 1282
-----------------------------------------------------------------------------------------------------------------

CLUSTAL 2.1 multiple sequence alignment (P. aeruginosa tulpina

miu)

VEB-1
VEB2
VEB-7
VEB-3
MY

--GATCAACCGAAATTTGCCCTAACAAATGCTTCAACCTGACAATTCCTGTTGTCATGGT 58
---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AAGGGAATCTTTCTTTTGAACAAAAAATAGAGATTACCCCTCAAGACCTTTTG-CCTAAA 59

VEB-1
VEB2
VEB-7
VEB-3
MY

TTGTGCTGTCGCTTTGCTCAGCACAAACCACGCCAAGCCCTTCGGGCCGGAATTGCAGGT 118
-----------------------------------------------------------T 1
----------------------------------------------------------------------------------------------------------------------ACGTGGAGTCCGATTAAAGAG----------GAATTCCCTAATGGAACAACTTTGACGAT 109

VEB-1
VEB2
VEB-7
VEB-3
MY

TAAGCAAATGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAA
TAAGCAAATGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAA
---------------------------------------------ATGAAAATCGTAAAA
--------TGTTAGCGGTAATTTAACCAGATAGGAGTACAGACATATGAAAATCGTAAAA
TGAACAAATACTA-----AATTATACAGTATCAGAGAGCGACAATATTGGTTGTGATATT
** ..:: *::*::

178
61
15
52
164

VEB-1
VEB2
VEB-7
VEB-3
MY

AGGATATTATTAGTAT--TGTTAAGTTTATTTTTTACAATTG-TGTATTCAAATGCTCAA
AGGATATTATTAGTAT--TGTTAAGTTTATTTTTTACAATTG-TGTATTCAAATGCTCAA
AGGATATTATTAGTAT--TGTTAAGTTTATTTTTTACAGTTG-AGTATTCAAATGCTCAA
AGGATATTATTAGTAT--TGTTAAGTTTATTTTTTACAGTTG-TGTATTCAAATGCTCAA
TTGCTAAAATTAATCGGAGGAACTGATTCTGTTCAAAAATTCTTGAATGCTAATCATTTC
: *.**::****.*.
*::.:*:**.* ** :*.*.** :*:** *:*** .* :.

235
118
72
109
224

VEB-1
VEB2
VEB-7
VEB-3
MY

ACTGACAACTTAA-CTTTGAAAATTGAGAATGTTT--TAAAGGCAAAAAATG-CCAGAAT
GCTGACAACTTAA-CTTTGAAAATTGAGAATGTTT--TAAAGGCAAAAAATG-CCAGAAT
ACTGACAACTTAA-CTTTGAAAATTGAGAATGTTT--TAAAGGCAAAAAATG-CCAGAAT
ACTGACAACTTAA-CTTTGAAAATTGAGAATGTTT--TAAAGGCAAAAAATG-CCAGAAT
ACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATACCCAATAT
.**** *: * ** *:::*.*** .**** .::* :.****.::..***. ***.:**

291
174
128
165
284

VEB-1
VEB2
VEB-7
VEB-3
MY

AGGAGTAG-------CAATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACG
AGGAGTAG-------CAATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACG
AGGAGTAG-------CAATATTCAACAGCAATGAGAAGGATACTTTGAAGATTAATAACG
AGGAGTAG-------CAATATTCAACAGCAATGAGAAGGATACTTTTAAGATTAATAACG
CAAAATTGGGCAACCCCAACGTCTTCCAATGCGGGGCCGACCCACCCGCGCCTGCCCCCC
...*.*:*
*.*:. **::*...:. *.*.. ** .*:
..*. *.. ..*

344
227
181
218
344

VEB-1
VEB2
VEB-7
VEB-3
MY

ACTT-CCATTTCCCGATG-----CAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTT
ACTT-CCATTTCCCGATG-----CAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTT
ACTT-CCATTTCCCGATG-----CAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTT
ACTT-CCATTTCCCGATG-----CAAAGCGTTATGAAATTTCCGATTGCTTTAGCCGTTT
CCTCGGCTGCGCCCGCGGACCTTCACACCTCTCTCCCGGTACTGGATACTCCTTCTG-TC
.**
*:
****. *
**.* * *.* ... *:* *.:*.** : * * *

398
281
235
272
403

VEB-1
VEB2
VEB-7

TGTCTGAGATAGATAAAGGGAAT--CTTTCTTTTGAACAAAAAATAGAGATTACCCCTCA 456
TGTCTGAGATAGATAAAGGGAAT--CTTTCTTTTGAACAAAAAATAGAGATTACCCCTCA 339
TGTCTGAGATAGATAAAGGGAAT--CTTTCTTTTGAACAAAAAATAGAGATTACCCCTCA 293

196

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
VEB-3
MY

TGTCTGAGATAGATAAAGGGAAT--CTTTCTTTTGAACAAAAAATAGAGATTACCCCTCA 330
GGCCAGCGCCCGCTCCTGGTACGGCCGTCCCGTAATACTTCCCCCCTGGCGTATCCGGCC 463
* *:*.*. .*.*..:** *.
* * * *:.:**::.... . .*. ** ** *.

VEB-1
VEB2
VEB-7
VEB-3
MY

AGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGG-----AATTCCCTAATGGAACA
AGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGG-----AATTCCCTAATGGAACA
AGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGG-----AATTCCCTAATGGAACA
AGACCTTTTGCCTAAAACGTGGAGTCCGATTAAAGAGG-----AATTCCCTAATGGAACA
AACGCCTTCCCCCAAGCCGCGCGGGGCGGGTGGACACCTCGCCCTCCCCCTTCTTTAAAT
*.. * ** ** **..** * .* **. *..* *
.: ****:.* **.:

511
394
348
385
523

VEB-1
VEB2
VEB-7
VEB-3
MY

ACTTTG-ACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTG
ACTTTG-ACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTG
ACTTTG-ACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTG
ACTTTG-ACGATTGAACAAATACTAAATTATACAGTATCAGAGAGCGACAATATTGGTTG
TCCATGCCCACTTGGCTTGGTATCCCATCCGTCGACCCCAGGGCTCCACGGCACCTG-CC
:* :** .*..***.. :..** ..** . :*.. . ***.*. * **.. *
*

570
453
407
444
582

VEB-1
VEB2
VEB-7
VEB-3
MY

TGATATTTTGCTAAAATTAATCGG-AGGAACTGATTCTGTTCAAAAATTCTTGAATGCTA
TGATATTTTGCTAAAATTAATCGG-AGGAACTGATTCTGTTCAAAAATTCTTGAATGCTA
TGATATTTTGCTAAAATTAATCGG-AGGAACTGATTCTGTTCAAAAATTCTTGAATGCTA
TGATATTTTGCTAAAATTAATCGG-AGGAACTGATTCTGTTCAAAAATTCTTGAATGCTA
CGCCCCCAAGCTAGCATAGCTCCCTCCGTTACATCCCCGATCCCCTTTCCTCCGCCCCGT
*. . ::****..**:..**
. *::. .: * *:**...::* ** .. * :

629
512
466
503
642

VEB-1
VEB2
VEB-7
VEB-3
MY

ATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATA
ATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATA
ATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATA
ATCATTTCACTGATATTTCAATCAAAGCAAACGAAGAACAAATGCACAAGGATTGGAATA
ACCGATAGGCTCCCGGTTCAGCCTCCCTTCCCATGGCCCCACTAAGCATTCCAGCGAAGT
* *.:*: .** . . ****. *:.. :..*.:.*..*.*.*...**: .: *** :

689
572
526
563
702

VEB-1
VEB2
VEB-7
VEB-3
MY

C-----CCAATATCAAAATTGGGCAACCCCAACAG-CGATGAACAAACTGTTAATAGATA
C-----CCAATATCAAAATTGGGCAACCCCAACAG-CGATGAACAAACTGTTAATAGATA
C-----CCAATATCAAAATTGGGCAACCCCAACAG-CGATGAACAAACTGTTAATAGATA
C-----CCAATATCAAAATTGGGCAACCCCAACAG-CGATGAACAAACTGTTAATAGATA
CGGCCACCCCCCGCCCCCTTGCCCCCTAATCCCAGTCCCTTGCCTCCGGGCGAAAACCTT
*
**.. . *....*** *.. .. ..*** * .* ..*:.. * **:* .*:

743
626
580
617
762

VEB-1
VEB2
VEB-7
VEB-3
MY

CTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATTTGGAAAA--CTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATTTGGAAAA--CTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATTTGGAAAA--CTTATAATAATAAGAACCAATTACTTTCTAAAAAAAGTTATGATTTTATTTGGAAAA--TTTCGTTAAGTTTGGTCCCTTTTCCAAATTGGCTAAATCCTTTTCCTTTCCGGGTAAGCC
**. :::*.*::*.:**.:**:* ::.*:...:**.* .* :* *:* **.:**

800
683
637
674
822

VEB-1
VEB2
VEB-7
VEB-3
MY

---TTATGAGAGAAACAACAACAGGAAG---TAACCGATTAAAAGGAC----AATTACCA
---TTATGAGAGAAACAACAACAGGAAG---TAACCGATTAAAAGGAC----AATTACCA
---TTATGAGAGAAACAACAACAGGAAG---TAACCGATTAAAAGGAC----AATTACCA
---TTATGAGAGAAACAACAACAGGAAG---TAACCGATTAAAAGGAC----AATTACCA
CCTGTTTGCAAGCCCCTCCCCCCGCCGGGGCCAGCCTTTTTAATCCCCCCCTTCTTACCA
*:**..**...*:.*..*.* ..*
*.** :**:**: .*
:.******

850
733
687
724
882

VEB-1
VEB2
VEB-7
VEB-3
MY

AAGAATACAAT-TGTTGCT--CATAAAACAGGGACTTCCGGAATAAATAATGGAATTGCA
AAGAATACAAT-TGTTGCT--CATAAAACAGGGACTTCCGGAATAAATAATGGAATTGCA
AAGAATACAAT-TGTTGCT--CATAAAACAGGGACTTCCGGAATAAATAATGGAATTACA
AAGAATACAAT-TGTTGCT--CATAAAACAGGGACTTCCGGAATAAATAATGGAATTGCA
AAAAACCCCCCGTTTTGAAGGGTCAAACCCCCAAAATCCCCCTCTCTTCCCCTTTTTAAA
**.** .*.. * ***.:
: ***.*. .*.:*** .: :.:*..
::**..*

907
790
744
781
942

VEB-1
VEB2

GCAGCCACTAATGATG--TTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAA 965
GCAGCCACTAATGATG--TTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAA 848

197

Markeri fenotipici i moleculari de rezisten la antibioticele -lactamice la tulpini de bacili Gram


negativi non fermentativi oportuniti
VEB-7
VEB-3
MY

GCAGCCACTAATGATG--TTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAA 802
GCAGCCACTAATGATG--TTGGGGTAATTACTTTACCGAATGGACAATTAATTTTTATAA 839
ACCCCCCTTTTTCTTTTTTTTCTTTCTTTTTTTTTCCCCCCCCCCCCCTTTTTTTTAAAA 1002
.*. **. *::* :*
**
*.:**: ***:** ..
.*.. *::******:**

VEB-1
VEB2
VEB-7
VEB-3
MY

GCGTATTTGTTGCAGAGTCCAAAG-----AAACTTCGGAAATTAATGAAAAGATTATTTC
GCGTATTTGTTGCAGAGTCCAAAG-----AAACTTCGGAAATTAATGAAAAGATTATTTC
GCGTATTTGTTGCAGAGTCCAAAG-----AAACTTCGGAAATTAATGAAAAGATTATTTC
GCGTATTTGTTGCAGAGTCCAAAG-----AAACTTCGGAAATTAATGAAAAGATTATTTC
AAAAAAAAAACCCAACCCCCCTTTTTTTCCTTTTTTTTTTTTTTCTAAAAATTTTTTTCC
...:*:::.: **.. **.::
.:: **
:::**:.*.**** :**:** *

1020
903
857
894
1062

VEB-1
VEB2
VEB-7
VEB-3
MY

AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAAACTACCG----CTA
AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAAACTACCG----CTA
AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAA----------------AGACATTGCAAAAATAACGTGGAATTACTATTTGAATAAATAAAAGGGTATAGGAAGTAT
CCCCCTTTTTTTTTTTTAATTTTTTCCCCTTTTAAACCCCCGGGTCCCCCCCCCCCCCTT
. .*.** :::::*::..* ::* .* :***.** ... ..

1076
959
900
954
1122

VEB-1
VEB2
VEB-7
VEB-3
MY

ACACTGGCTCATAGGCAATG--GCGG-GTTGAAGTGCAATTTGCA-AAGTCGGTAGCCCG
ACACTGGCTCATAGGCAATG--GCGG-GTTGAAGTGCAATTTGCA-AAGTCGGTAGCCCG
-----------------------------------------------------------AAACCACCTTTTTGCTCCTG--GCTCTGTTGCAAAG--ATTGGCGGCAGTCAGAGGTAGG
TCCCTTTTTTTTAAAAAAAACCCCCCCCTTTTTTTTCCTTTTTCCCACTTTTTGGGCTTT

1132
1015

VEB-1
VEB2
VEB-7
VEB-3
MY

CCCGAGCGTTTTCTCGGTTTGACAGGAAAGGCTCACGCAAACCGCCACTGCCCATAGCCC
CCCGAGCGTTTTCTCGGTTTGACAGGAAAGGCTCACGCAAACCGCCACTGCCCATAGCCC
-----------------------------------------------------------CTGTCGCTCTGCGCCGATCAGGCGG------CTGCTGCGAAATGGTGGTTGAGCATGCCC
CCAAATTTTTGGCCCTTTTTTTTAAAATTTTTTTTTCCCCCCCCCCCCCCCCTTTTTTGG

1192
1075

VEB-1
VEB2
VEB-7
VEB-3
MY

AAACCGTTAGGCCGCATGGACACAACGCAGGTCACATTGATACACAAAATTCTAGCTGCG
AAACCG----------------------------------------------------------------------------------------------------------------AT---------------------------------------------------------GGGGTTTAAT-------------------------TTTTTTCCCCAAATTT---------

1252
1081

VEB-1
VEB2
VEB-7
VEB-3
MY

GCAGATGAGCGAAATCTGCCGCTCTGGATC 1282
---------------------------------------------------------------------------------------------------------------------

198

1010
1182

1064
1242

1066
1268

S-ar putea să vă placă și