Sunteți pe pagina 1din 180

Zamfira MIHAIL

Maria OSIAC

LINGVISTIC GENERAL I APLICAT


ediia a II-a

Descrierea CIP a Bibliotecii Naionale a Romniei MIHAIL, ZAMFIRA Lingvistic general i aplicat / Zamfira Mihail, Maria Osiac, Ed. a 2-a, Bucureti: Editura Fundaiei Romnia de Mine, 2006 Bibliogr. 180p.; 20,5 cm. ISBN 973-725-522-4 I. Osiac, Maria

81(075.8)

Editura Fundaiei Romnia de Mine, 2006

UNIVERSITATEA SPIRU HARET

Zamfira MIHAIL

Maria OSIAC

LINGVISTIC GENERAL I APLICAT


ediia a II-a

EDITURA FUNDAIEI ROMNIA DE MINE Bucureti, 2006

CUPRINS

Introducere ..... Lingvistica general, tiin a limbii i a vorbirii (Z.M.) ..... Conceptul de lingvistic general ... Principalele probleme teoretice ale lingvisticii ...... Perspectiva istoric asupra teoriilor lingvistice (Z.M.) Bibliografie Chestionar .. Perspective metodologice de studiere a limbii (Z.M.) ... Metoda istoric (evolutiv) i diacronic ... Bibliografie Chestionar i sugestii de aplicaii ... Metoda comparativ-sincronic (analiza contrastiv) (C.D.) Bibliografie Chestionar i sugestie de aplicaie . Metoda segmentrii. Comutarea i substituia ... Bibliografie Chestionar .. Metoda tipologic ....... Bibliografie Chestionar .. Funciile limbii (M.O.) ..... Funcia emotiv . Funcia conativ . Funcia referenial . Funcia fatic .. Funcia metalingvistic ...... Funcia poetic ... Alte funcii ale limbii ..... Manifestarea funciilor limbii

9 11 11 12 15 24 25 26 26 30 30 31 37 38 38 41 41 41 43 43 44 45 47 48 48 49 49 51 53 5

Dihotomiile saussuriene (M.O.) . Limb vorbire ..... Sincronie diacronie . Sintagmatic paradigmatic (raporturi sintagmatice raporturi asociative) Semnificat semnificant .... Form coninut Lingvistic intern lingvistic extern Bibliografie . Chestionar .. Semnul lingvistic (M.O.) .. Scurt istoric al semioticii . Accepiile semnului lingvistic accepia unilateral (monoplan), bilateral (biplan), relaional .. Caracteristicile semnului lingvistic: Caracterul arbitrar al semnului lingvistic . Caracterul liniar al semnului lingvistic . Trstura informaional a semnului lingvistic Imutabilitatea i mutabilitatea semnului lingvistic ... Funciile semnului lingvistic ...... Funcia de cunoatere a realitii ...... Funcia de difereniere n cadrul sistemului Funcia de transmitere a informaiei ..... Motivarea anumitor semne lingvistice ... Motivare absolut (extern) .. Motivare relativ (intern) .... Pierderea motivrii Remotivarea . Bibliografie . Chestionar .. Schimbrile n limb n perspectiv diacronic. Contactul ntre limbi (Z.M.) ... Contactul dintre limbi . Tipurile de contacte ...... Bilingvismul ....... Interferenele Factorii de care depind dimensiunile, direcia i natura interferenelor interlingvistice . Factorul timp ...... 6

55 55 58 59 61 61 64 65 66 67 67 69 70 71 72 72 74 74 75 75 76 76 77 78 79 80 81 82 82 83 83 84 85 86

Substrat ... 86 Superstrat .... 90 Adstrat .... 91 Interferen i convergen .... 96 Diasistem ...... 99 Bibliografie 99 Chestionar ... 100 Lingvistica spaial. Ramificaiile sau unitile teritoriale ale limbii (Z.M.) .... Limb / dialect / subdialect (grai) .. Chestionar ..... Geografia lingvistic. Metod i domeniu ..... Principiile de interpretare a hrii lingvistice . Lingvistica areal ... Ariile lingvistice ... Bibliografie . Chestionar .. Limba n cadrul social. Diferenierea i unificarea limbilor (Z.M.) .. Factorii de evoluie a limbii Aspecte din istoria unor limbi romanice .... Lingvistica limbii literare i lingvistica graiurilor .. Bibliografie . Chestionar .. Fonetica (Z.M.) . Vorbirea i scrisul . Fonetica general i fonetica unei limbi naturale . Sunetul vorbirii . Fonologia (Z.M.) ... Fonem (invariant) i alofone (variante) .. Morfologia Studiul flexiunii (M.O.) .... Morfemul. Accepiile termenului ... Criteriile de clasificare a morfemelor .... Cazuri particulare de morfeme dependente. Morfemul zero .... Morfemul zero . Interfixul ... Elemente extramorfologice cu rol de morfeme gramaticale .... Morfem (invariant) i alomorfe (variante) ... Bibliografie . Chestionar .. 101 102 111 112 112 114 115 117 117 118 118 121 124 126 126 127 127 129 131 133 133 138 138 139 143 143 144 144 146 147 148 7

Sintaxa Studiul funciilor cuvintelor i propoziiilor (Z.M.) . Sintaxa tradiional i cea modern .... Modelul analitic n sintaxa modern (analiza n constitueni imediai) Modelul sintetic (gramatici generative, cu privire special asupra celei transformaionale) .... Bibliografie . Chestionar i sugestii de aplicaii .. Lexematica Studiul cuvntului (Z.M.) .... Lexem (invariant) i alolexeme (variante) ....... Tipuri de structuri lexematice Structuri paradigmatice i sintagmatice ... Cmpul lexical i clasa lexical ... Lexeme determinante i lexeme determinate .. Tipologia cmpurilor lexicale .... Clasificarea cmpurilor lexicale ..... Bibliografie . Chestionar i sugestie de aplicaii .. Semantica Studiul semnului (M.O.) .... Noiuni introductive. Conceptul de sens . Sens denotativ; sens conotativ; sens referenial Noiuni de semantic istoric (diacronic) .... Cauzele schimbrilor de sens: .... Cauze extralingvistice ... Cauze lingvistice .. Cile de realizare a schimbrilor de sens ...... Direcii de deplasare a sensului ... Noiuni de semantic sincronic . Analiza semic ..... Teoria cmpurilor semantice ..... Clasificarea cuvintelor din punctul de vedere al raportului sens-form: omonime, paronime, sinonime, antonime, hiponime . Bibliografie . Chestionar .. Abrevieri ...

149 149 151 151 154 154 155 155 155 155 155 156 159 160 161 162 163 163 164 165 165 165 166 167 167 168 168 170 171 177 178 179

INTRODUCERE

Cursul de Lingvistic general i aplicat, predat studenilor de la Facultatea de Limba i Literatura Romn i de la Facultatea de Limbi i Literaturi Strine ale Universitii Spiru Haret de prof. dr. Zamfira Mihail i lector univ. dr. Maria Osiac, reunete prelegerile susinute n anul universitar 2003-2004 i pe cele care sunt expuse n anul universitar n curs, 2004-2005. Autoarele au extins analiza lor i la aspectele de aplicabilitate a principiilor de lingvistic general n procesul didactic de predare / nvare a limbilor strine i de aprofundare a terminologiei metalingvistice. Acest curs de cunotine generale cuprinde elementele teoretice de baz pentru nelegerea structurii limbii i a compartimentelor ei. Exemplificarea n limbi strine servete, de asemenea, ca suport pentru aplicarea tezelor saussuriene i ale celorlali lingviti, ale cror teorii constituie principiile de baz ale tiinei limbii. O dat cu detalierea metodologiei folosite n cercetrile n dubl perspectiv, a considerrii limbii ca sistem i a analizei funcionrii ei ca mijloc oral de comunicare, prin intermediul lingvisticii vorbirii, tezele teoretice care vehiculeaz conceptele de sorginte saussurian au antrenat folosirea analizei contrastive n prezentarea realitii lingvistice. Aceast metod contrastiv const n compararea organizrii a dou limbi cu scopul identificrii, pe niveluri lingvistice (fonologie, morfologie, sintax, lexic) a zonelor de contrast i a celor cu organizare identic, n vederea unui obiectiv aplicativ imediat: optimizarea procedeelor i a materialelor pedagogice de nvare a limbilor strine. Ipoteza teoretic a analizei contrastive este c zonele de contrast maxim din organizarea a dou limbi sunt potenial generatoare de erori n achiziia limbii strine (aa-numitul transfer negativ), n timp ce zonele cu organizare identic sau asemntoare faciliteaz nvarea (aa-numitul transfer pozitiv) (DL*, p.52).
DL = Dicionar al tiinelor limbii (autori: Angela Bidu-Vrnceanu, Cristina Clrau, Liliana Ionescu-Ruxndoiu, Mihaela Manca, Gabriela Pan Dindelegan), Bucureti, Editura Nemira, 2001.
*

Au fost invocate i aspecte ale istoriei limbilor, cu deosebire a celor romanice, pentru c o astfel de abordare este benefic pentru nelegerea aplicat a principilor teoretice i pentru dezvoltarea universului intelectual. n elaborarea cursului, fiecare autor i-a pstrat deplina autonomie a expunerii. Dezvoltarea problematicii teoretice i a ramurilor lingvisticii (fonetica i fonologia, morfologia, sintaxa, lexematica, semantica) a avut n vedere ceea ce n timp real este audiat, lundu-se n consideraie i timpul necesar pentru studiu i nvare de ctre studeni, pentru nelegerea i meditaia asupra nelesurilor multiple ale teoriilor lingvistice. n acelai scop, a fost recomandat ca lectur suplimentar i o bibliografie minimal.

10

LINGVISTICA GENERAL, TIIN A LIMBII I A VORBIRII

CONCEPTUL DE LINGVISTIC GENERAL

Lingvistica general este tiina care studiaz limba din punctul de vedere teoretic. Ea este parte component a lingvisticii ca atare, adic tiina despre limb n general, care i pune toate problemele n legtur cu cunoaterea obiectului cercetrii, dar, n acelai timp, principiile teoretice pe care le-a emis reprezint argumente de baz pentru disciplinele speciale ale lingvisticii. Adic, bazndu-se pe toate aceste discipline particulare, consideraiile teoretice i gsesc formularea cea mai adecvat, conform cu adevrul i abordarea teoretic reprezint coagulantul pentru cercetrile aplicate n disciplinele respective. Prin urmare, lingvistica general este nsi lingvistica sau, altfel spus, tiina despre limb. Prestigiul lucrrii lui Ferdinand de Saussure denumit Cours de linguistique gnrale (tiprit postum n 1916, la Paris-Lausanne, de ctre elevii si Ch. Bally, A. Sechehaye, i cu A. Riedlinger) considerm c a fost determinant pentru ca adjectivul general s capete drept de cetate, adic s fie folosit de ntreaga lume tiinific drept marcator al domeniului teoretic despre limb. Folosirea denumirii de lingvistic general este aleatorie, dar a intrat n uz, presupunem, nc din deceniul al doilea al sec. al XX-lea, n primul rnd prin lucrarea lui Antoine Meillet (fost elev al lui Saussure) care a tiprit n 1921, Linguistique historique et linguistique gnrale, 2 vol., Paris, continund cu lucrarea de mare autoritate a lui Hugo Schuchardt, Ein Vademecum der allgemeinen Sprachwissenschaft, Halle, 1928 (ediia a 2-a), a fost adoptat de Roman Jakobson pentru volumul su Essais de linguistique gnrale, Paris, f.a., ca i de A. Martinet, Elments de linguistique gnrale, Paris, 1967. Ali lingviti au continuat s-i denumeasc lucrrile de lingvistic teoretic numai La linguistique (Jean Perrot), Language (E. Sapir, New York, 1921, Otto Jespersen, Londra, 1922), Le langage (J. Vendryes, Paris, 1923), John Lyons prefernd s-i intituleze lucrarea Introducere n lingvistica teoretic. Eugen Coeriu
11

pentru primul su curs a folosit titlul Introducere n lingvistic, ntreaga problematic fiind ns cea de lingvistic general. Termenul de lingvistic, la rndul su, a fost n concuren cu mai vechea denumire filologie, care era folosit pentru cercetrile relative la limb. Deoarece acestea se fceau pe baza textelor scrise, ca singure mrturii despre aspecte revolute, a fost inevitabil ca aprecierile despre text s predomine. Atunci ns cnd cercettorii s-au referit doar la limba din texte, folosirea termenului filologie a devenit superflu. Lingvistica este, n principiu, distinct de filologie, pentru c studiul limbii este scopul primordial pentru lingvist, i nu studiul textului. Independent de coninutul unui text, lingvistul caut s afle indicii despre limba folosit n text. ns nu a existat niciodat o frontier net ntre cele dou discipline, pentru c i filologul a fost i este n acelai timp i lingvist. Termenul linguiste a fost folosit prima dat n limba francez abia n 1816 de Raynouard, iar termenul linguistique abia n 1833. Asupra terminologiei folosite ne atrage atenia faptul c n limba englez philology are sensul de lingvistic; comparative philology nseamn lingvistic comparat. n epoca modern termenul englez linguistics a fost folosit n S.U.A. pentru a denumi tendinele noi ale cercetrii lingvistice. n engleza comun din Europa, linguist nseamn persoan cunosctoare a mai multor limbi. n limba francez se face distincia ntre philologie i linguistique. n limba italian, pe lng linguistica se folosete i denumirea glottologia (din gr. gltta limb), n limba rus, de asemenea sunt n uz doi termeni, i e, iar n limba german numai calcul Sprachwissenschaft. Este o situaie paradoxal c tocmai denumirea pentru tiina limbii a avut asemenea fluctuaii.
PRINCIPALELE PROBLEME TEORETICE

Considerm c cele mai vechi analize ale limbajului uman se reflect n modurile de scriere pe care le-a adoptat, succesiv, umanitatea, analiza morfemelor, a silabelor, a grupurilor consonantice i abia apoi a sunetelor regsindu-se n variatele moduri de consemnare material, prin semne arbitrare, a fluxului sonor (cf. analiza detaliat n cap. Fonetic). Dup apariia scrisului, a fost normal ca referirile la limb s se fac pe baza acestor dovezi concrete, de limb consemnat. Deoarece preocuprile filosofilor se ndreptau spre definirea limbajului i
12

ncercrile de a-i stabili esena, descrierea sau analizarea unor limbi naturale nu a interesat n antichitatea timpurie sau trzie. nregistrarea textelor, compararea lor i mai ales multiplicarea textelor prin copiere s-a constituit ntr-un tezaur implicit i a formelor lingvistice din diferite locuri i perioade. Filologia a fost o form de manifestare i a cercetrilor lingvistice. Uneori textele au perpetuat i forme de limb vorbit: de exemplu, vestita list de cuvinte din Appendix Probi, din sec. al III-lea d.Hr. consemneaz forme paralele n limba latin, unele considerate corecte, i recomandate probabil elevilor, iar altele, care circulau n limbajul oral, dezavuate. De exemplu, n aceast list sunt enumerri de felul: auricula non oricla, vetulus non veclus n care tocmai formele respinse au fost continuate de ctre limbile neolatine. Cu patru secole .Hr. gramatica lui Pnini era rezultatul unor cercetri sistematice asupra limbii sanscrite, identificnd cele dou pri de vorbire: numele i verbul i descriind limba sanscrit ntr-o manier riguroas. n acest demers de cunoatere a produsului uman necesar comunicrii, fr de care omul nu poate fi considerat ca atare, generaii succesive, de-a lungul mileniilor au adugat produsul propriilor observaii. Problemele teoretice principale au vizat mecanismele de producere a limbii, componena ei, regulile ei de funcionare. Obiectul acestei preocupri de cunoatere pentru a deveni tiin i-a delimitat obiectul de studiu care este limba, caracterizat prin trsturile sale specifice, i anume de a fi mijlocul articulat de comunicare ntre oameni. Abia ns Ferdinand de Saussure a contribuit decisiv la progresul cercetrii lingvistice prin faptul c el a trecut de la acea sum de afirmaii despre limb, formulate de precursori, la o poziie radical diferit. El a expus ntr-un sistem coerent concepte proprii lingvisticii, plecnd de la premisa c limba este un sistem riguros i teoria trebuie s fie un sistem la fel de riguros ca i limba. Ideile teoretice principale saussuriene sunt: ideea de valoare relaional, opozitiv, a entitilor lingvistice; ideea conex de sistem; ideea necesitii consecvente de a distinge o lingvistic a strilor de o lingvistic a realizrilor i a evoluiilor (Curs de lingvistic general, p. 267). Definiiile tiinifice ale limbii sunt numeroase. Reinem formularea lui A. Martinet care considera limba instrument de comunicare
13

prin care experiena uman se analizeaz, diferit n fiecare colectivitate [n sens larg, n.n.], n uniti dotate cu coninut semantic i cu o expresie fonic, monemele; aceast expresie fonic se articuleaz, la rndul ei, din uniti distincte i succesive, fonemele, n numr determinat n fiecare limb, a cror natur i raporturi mutuale difer de asemenea de la o limb la alta (Elm. de ling. gn., p.20) sau pe cea din DL, p.293: Limba, n sens riguros tiinific, desemneaz un ansamblu de sisteme legate unele de altele; unitile fiecruia dintre aceste sisteme (sunete, foneme, morfeme, lexeme, cuvnt) sunt identificate n funcie de relaiile de echivalen sau de opoziie dintre aceste uniti. Definiia formulat de E. Coeriu sesizeaz faptul c lingvistica este tiina care studiaz din toate punctele de vedere posibile limbajul uman articulat, n general i n formele sale specifice de realizare, adic n actele lingvistice i n sistemele de izoglose, care, tradiional sau convenional, se numesc limbi.

14

PERSPECTIVA ISTORIC ASUPRA TEORIILOR LINGVISTICE

Consideraiile despre istoria lingvisticii ntr-un curs de lingvistic general sunt necesare pentru situarea n timp a principiilor teoretice pe care le-au avut n vedere savanii atunci cnd s-au referit la obiectul lor de studiu, limba. Trecerea n revist a etapelor cercetrilor n acest domeniu relev c a fost nevoie de un lung exerciiu de abstractizare i de precizare a conceptelor pentru ca s se ajung la acea imperativ exigen a unei teorii a descrierii lingvistice, care nu fusese nc formulat explicit nainte de Saussure. Acesta a caracterizat lingvistica din epoca n care s-a format, a doua jumtate a sec. al XIX-lea, ca insuficient n ceea ce privete principiile i metodele (subl.n.), de aceea ntreaga sa via a cutat legile directoare care ar fi putut s orienteze gndirea prin acel haos (Mauro, p.266). Cel care avea s marcheze nnoirea total a lingvisticii, modernizarea ei, Ferdinand de Saussure (1857-1913), i-a dovedit spiritul independent fa de teoriile curente ale vremii lui nc de la primele lucrri, redactate n 1872 sau 1874, fcndu-se cunoscut n lumea savant din 1878, cnd a aprut la Leipzig prima sa oper de referin Mmoire sur le systme primitif des voyelles dans les langues indo-europennes. Dup o analiz critic a principiilor lingvistice, el abordeaz problematica lingvisticii generale i preocuprile pentru teoria general a limbii sunt preponderente nc nainte de 1880. Pentru istoria lingvisticii este important precizarea cronologiei apariiei unor teorii tiinifice, dar este nendoielnic c n anumite perioade unele idei plutesc n aer i formularea lor poate fi prezent n lucrrile mai multor cercettori. Saussure a fost o personalitate cu o gndire profund original n tezele sale teoretice despre limb i manifestrile ei, pe care le-a elaborat de-a lungul ntregii sale activiti didactice, ca profesor la Universitile din Paris i Geneva. Lucrarea sa fundamental, Cursul de lingvistic general, predat n anii 1907-1910, a fost tiprit postum, de ctre discipolii si Ch. Bally i A. Sechehaye, abia n 1916, pe baza unor notie scoase la cursuri de ctre studeni. De atunci ideile sale productive nu numai c
15

formeaz baza teoretic a tiinei limbii, dar continu s constituie ele nsele obiectul unor exegeze aprofundate. n 1908-1909 au fost formulate problemele eseniale ale raportului dintre teoria semnelor i teoria limbii i definiiile conceptelor de sistem, unitate, identitate, valoare lingvistic. Din acest corpus de definiii Saussure deduce existena a dou perspective metodologice pentru studiul faptelor lingvistice: descrierea sincronic i descrierea diacronic. n opera sa au fost folosii pentru prima dat ori au primit consfinirea definitiv ntr-o anume accepie, bine determinat, perpetuat apoi ca atare, termenii: sincronie, diacronie, idiosincronic, pancronie, pancronic etc; limb, limbaj, vorbire; semn, semnificant, semnificat; unitate lingvistic; sintagm, sintagmatic; execuie, contiin lingvistic; fonem, fonologie; substan i form lingvistic; economie lingvistic, valoare lingvistic; cod, circuit al vorbirii, model; stare de limb, static, semiologie, semiologic, sem; opoziie, opozitiv, relativ, diferenia; lan, poate structur, cu siguran sistem (Mauro, p.9-10). G. Mounin observ ns c Saussure a folosit cu sens invers termenii fonetic i fonologie. El a fost preocupat, de la nceput, de analiza terminologiei folosite de naintai i contemporani i de precizarea accepiei termenilor folosii de el nsui. Pentru aspectele teoretice ale unei discipline tiinifice, necesitatea de a folosi o terminologie tiinific apropriat (potrivit pentru un scop anumit, cf. fr. approprier), corespunztoare unor concepte bine definite, constituie o premis obligatorie a deontologiei tiinifice. (Deontologia este acea parte a eticii care studiaz normele i obligaiile activitii profesionale). Termenii folosii de Saussure, majoritatea pentru prima dat n tiina limbii, au devenit cuvinte-cheie (adic de referin) ale lingvisticii moderne. Atragem atenia, cu deosebire, aa cum o face i Tullio de Mauro n Introducerea sa, asupra faptului c proclamarea de ctre Saussure a caracterului sistemic al limbii a impus i lingvisticii o atitudine sistematic: chiar dac trebuie s descriem o unitate minimal, cci a o descrie nseamn a-i determina valoarea, este nevoie s o vedem n toate asociaiile sale opozitive posibile (pe care le numim astzi paradigmatice) i n toate posibilitile sale de combinare sintagmatic. Altfel spus, chiar dac obiectivul studiului nu este n mod direct sistemul, ci numai o parte din el, chiar minim, pentru ca studiul s fie complet trebuie s considerm acea parte n raport cu totalitatea care i d valoare sau n raport cu ntregul sistem lingvistic. Este o recomandare util pentru oricine se apleac asupra problemelor de lingvistic, de a
16

analiza fiecare informaie n corelaie cu altele, pentru a nu scpa din vedere ansamblul lor, pentru a nelege finalitatea demersului oricrei lucrri de lingvistic general, deci i a celei de fa. i, mai ales, pentru a cuta s ne nsuim ideile deschiztoare de orizonturi largi, n sens intelectual, pe care tezele de lingvistic general ale lui Saussure le conin din belug. Saussure a sesizat dublul caracter al obiectului de studiu, difereniind, ca fiind n opoziie, cele dou aspecte ale sale: limb / vorbire. Prin limb (langue) el a avut n vedere sistemul, adic ansamblul regulilor care determin folosirea sunetelor, a formelor i a mijloacelor de expresie sintactice i lexicale. Limba este sistemul supraindividual, o abstracie, a crei existen este condiia nsi a comunicrii ntre oameni. Prin conceptul i termenul vorbire (parole) a fost difereniat forma concret a limbii, aa cum este ea actualizat la un moment dat de un locutor (sau vorbitor) determinat. Vorbirea este individual, limba este un fenomen social. Limba poate fi cunoscut studiind vorbirea (oral sau n texte), care furnizeaz informaiile referitoare la sistemul limbii. Pentru c, element definitoriu, limba este un sistem, un ensemble o tout se tient: fiecare element lingvistic este determinat de relaiile i de funcia sa. Exemplul ilustrativ pentru nelegerea accepiilor sub care este considerat limba ca sistem a fost analogia pe care Saussure a sugerat-o cu jocul de ah. Astfel, diferitele piese ale acestui joc (pion, cal, turn, nebun, regin, rege) se definesc numai prin funciile care le sunt conferite de regulile jocului. Forma exterioar a piesei ca atare, dimensiunile, materialul din care este confecionat sau culoarea nu au nici o importan pentru jocul n sine. De asemenea, orice pies poate fi nlocuit printr-un alt obiect, dac el este utilizat n acelai scop. Este necesar doar diferenierea pieselor printr-un element caracteristic, pentru ca s nu se produc confuzie. Transpus pe plan lingvistic, exemplul sugereaz c orice element lingvistic se definete prin relaiile sale cu celelalte elemente sau prin funcia sa n sistem i nu prin proprietile sale fizice, deci, n ansamblu limba este un sistem. Totodat, prin acest exemplu a fost enunat i teza c limba este form i nu substan. Un loc central n Cursul lui Saussure a fost ocupat de discutarea i definirea semnului lingvistic care reprezint unirea dintre concept i imaginea acustic i ale crui componente interne sunt semnificant i semnificat (signifiant i signifi). Valoarea acestei teze const, dup cum apreciaz B. Malmberg, n faptul c Saussure a sesizat c nu exist concepte sau reprezentri fr denumire corespunztoare i a
17

introdus astfel sistemul noional n sistemul lingvistic i, implicit, semantica n rndul disciplinelor lingvistice. O alt consecin a analizei semnului lingvistic n perspectiva raportului dintre signifiant i signifi este demonstraia c legtura dintre ele este arbitrar i, prin extrapolare, semnul lingvistic este considerat drept arbitrar. Cercetarea limbii a fost plasat ntr-o dubl perspectiv de abordare, sincronic / diacronic n funcie de considerarea fenomenelor pe axa de simultaneitate (analiza sincronic, descriptiv) sau de succesivitate (analiza diacronic, istoric). n primul caz, lingvistul analizeaz relaiile existente ntre elementele limbii la un moment dat, iar n al doilea caz se fac referiri la etape cronologic anterioare. Limba n sine este considerat de Saussure linear, ea nu permite producerea sau receptarea simultan a dou elemente, ci ele se ordoneaz totdeauna ntr-un ir, mai mult sau mai puin extins, numit sintagm. Sintagma alturi de paradigm (expresie sau rezultat al raporturilor asociative, paradigmatice pe care orice element lingvistic l suscit n vorbitor sau asculttor) sunt factorii fundamentali ai mecanismului limbajului uman. Valoarea fiecrui element dintr-o sintagm depinde de contrastul creat fa de elementul care l precede i de cel care i succede, funcia sa n limb este determinat de opoziie. Afirmaia dans la langue il ny a que des diffrences este fundamental pentru lingvistica modern. Ideile lui Saussure au avut cel mai mare impact n lingvistic, dar i n cultura mondial, chiar dac au trebuit s treac cteva decenii pn s se impun definitiv. Este semnificativ c la coala sa s-au format unii dintre cei mai mari savani, care au ilustrat noua orientare, modern, a lingvisticii din secolul nostru. Iar discipolii si, ce constituie coala genevez de lingvistic, au fost cei care au contribuit ntr-o msur decisiv la rspndirea operei sale, prin iniiativa de a tipri notiele de la cursuri pentru reconstituirea gndirii sale novatoare, prin investigaiile pentru recuperarea tuturor manuscriselor i mrturiilor disparate. S-a afirmat, pe bun dreptate, c pe baza ideilor sale au fost fundamentate noi direcii de cercetare: sociolingvistica, de ctre A. Meillet i A. Sommerfelt, stilistica genevez, de Ch. Bally, lingvistica psihologic de ctre A. Sechehaye, funcionalismul (care urmrete cum funcioneaz o limb ntr-o etap dat a istoriei ei), de ctre H. Frei i A. Martinet, instituionalismul (limba-instituie social), de ctre G. Devoto i G. Nencioni, fonologia i structuralismul praghez (cu N.S. Trubekoi, S. Karcevski i R. Jakobson), lingvistica matematic, de ctre B. Mandelbrot i G. Herdan, semantica, de ctre St. Ullmann, L. Prieto, Jost Trier, J. Lyons, psiholingvistica, de ctre
18

F. Bresson i Ch. Osgood, direcia istoricist, de ctre A. Pagliaro i Eugeniu Coeriu, precum i cercetrile structuraliste pe care le-au ilustrat L. Bloomfield, L. Hjelmslev (i coala sa glosematic) sau N. Chomsky (Mauro, p.9). Orict s-ar diversifica teoria lingvistic actual, ea tot de la Saussure se trage i tocmai faptul c toate dezvoltrile se concateneaz la principiile elaborate (sau formulate) de el fac proba viabilitii i generalitii acestei teorii. Considerm c ceea ce face s fie de neegalat contribuia sa este unitatea concepiei i perspectiva de ansamblu, total, asupra limbii. n genere, se poate spune c acum lingvitii din toat lumea au adoptat viziunea teoretic saussurian asupra limbii. Mai mult, i citm n acest sens prerea unuia dintre cei mai avizai specialiti, gndirea lui Saussure s-a aflat i se afl n centrul multor cercetri i din domeniul tiinelor istorice i antropologice, la care adugm c mai pot fi luate n consideraie i alte domenii. De altfel, nc n sec. al XIX-lea lingvistica devansase celelalte tiine umaniste i rigoarea cercetrilor sale a servit de exemplu, pentru etnologie i pentru folclor, de a accede la statutul de tiine. n secolul nostru mai exist nc o direcie a dezvoltrii lingvistice, care, dei aflndu-se n universul saussurian, se plaseaz totui pe un palier distinct. Eugeniu Coeriu a formulat principiile teoretice ale vorbirii*, aspect neabordat de F. de Saussure. Firete, numai economia lucrrii de fa ne mpiedic s ne referim i la alte personaliti, la principiile lor teoretice despre limb i la metodologia folosit. O aseriune, obligatorie a fi cunoscut de orice intelectual,
Eugenio Coseriu, Sistema, norma y habla, Montevideo, 1952; La geografia lingstica, Montevideo, 1956; Teora del lenguaje y lingstica general, Madrid, 1962. La socio- y etnolingstica: sus fundamentos y sus tareas, n Anuario de Letras, XIX, Mexico, 1981, p. 5-29 .a. Operei lui Eugeniu Coeriu i-au fost consacrate numeroase studii i analize. Citm cteva dintre volumele omagiale: Logos semantikos. Studia Linguistica in Honorem Eugenio Coseriu, Berlin New York i Madrid, 1981, 5 vol., LXX + 2376 p. Hommage au Professeur Eugenio Coseriu, n Dacoromania (Jahrbuch fr stliche Latinitt, nr.5 pentru anii 1979-1980), Freiburg Mnchen, 1982, 248 p. Energeia und Ergon. Sprachliche Variation Sprachgeschichte Sprachtypologie. Studia in honorem Eugenio Coseriu, Tbingen, 1988, 3 vol., LXVIII + 1532 p. Omul i limbajul su. Studia linguistica in honorem Eugenio Coseriu, n Analele tiinifice ale Universitii Al. I. Cuza din Iai, tomul XXXVII XXXVIII, pentru anii 1991-1992, Iai, 1993, 360 p. 19
*

postuleaz c n orice tiin progresul cunoaterii este asigurat de totalitatea cercetrilor ntr-un domeniu, dar numai unele personaliti, denumite de obicei cu termenul geniu, greu de definit, sunt cele care coaguleaz summum-ul cunotinelor umane i produsul creaiei lor devanseaz chiar cu secole epoca n care triesc. Aceasta este motivarea noastr pentru a ne referi, cu precdere, la Saussure. nc n ultimul sfert al secolului al XIX-lea, ncepnd din 1870, lingvistica traverseaz o perioad de cutare i stabilire a specificului su ca tiin autonom, cu principii teoretice i domeniu de cercetare, metodologie i terminologie specifice i se delimiteaz de intruziunile altor tiine. n mod special a fost respins invocarea similitudinilor cu tiinele naturii i consecinele care decurgeau din aceasta. Faptul c ntreaga micare lingvistic s-a acordat la evoluia general a tiinelor a permis ca n secolul XX disciplina noastr s-i rafineze i s nuaneze conceptele, s diversifice metodologia i s apeleze la formule interdisciplinare. Dup etapa de delimitri, a urmat cea n care ea nglobeaz i informaiile din alte domenii ale tiinei n propria sfer de preocupri (din psihologie, sociologie, etnografie .a.). Unele principii care au dominat cercetarea tiinific din tiinele exacte se rentlnesc n lingvistic; astfel prioritatea ntregului asupra prii are n vedere c ntregul nu este o sum de elemente, deci nu este determinat de ctre pri, ci dimpotriv, ntregul se descompune n pri. Astfel, obiectul este un ntreg, o totalitate, un ansamblu coerent, a crui form este mai mult dect suma prilor. Principiul prioritii ntregului i-a gsit aplicare n lingvistica structural, care are n vedere n primul rnd ansamblul; astfel se demonstreaz teza c limba este altceva dect un repertoriu de cuvinte i sensul unei propoziii este mai mult dect suma sensurilor componentelor sale (T.L.G., p.66). Dintre principiile matematice au fost folosite, cu multiple conotaii, teoria mulimilor, logica matematic, de asemenea metoda frecvenei, cunoscut de filologi din sec. al XIX-lea pentru a urmri particulariti ale textului, a fost dezvoltat n metoda statistic. Teoria informaiei propulseaz datele lingvisticii n universul comunicaional al viitorului, prin suportul pe care acestea le constituie pentru teoria comunicrii, n genere. Cercettorii limbii s-au situat, n general, n secolul al XX-lea, n gruparea structuralitilor (adepi ai principiilor lui Saussure) sau n cea a nonstructuralitilor. Ei au dezvoltat metodologii i principii diferite i mai ales au pus n circulaie o terminologie specific fiecrei orientri (ap. Spence, p.10).
20

n majoritatea cazurilor opinia asupra naturii i scopului lingvisticii care se manifest n metode, terminologie etc. a marcat diferena dintre colile lingvistice. De fapt, deosebirea nu este att de tranant ntre descriptivitii structuraliti i istoritii nonstructuraliti; cercetrile n domeniul geografiei dialectale au relevat importana interaciunii ntre diversele elemente ale unui sistem lingvistic. ns mai puin acceptabile pentru structuraliti sunt analizele sincronice ale non-structuralitilor, dup cum nici analizele sincronice ale structuralitilor nu sunt acceptate de nonstructuraliti. La un nivel mai profund, cele dou mari orientri n lingvistica secolului al XX-lea, se caracterizeaz prin: 1. concepii diferite cu privire la ceea ce este tiinific i ce ar trebui s fie tiinific n studiul limbii; 2. concepii diferite cu privire la realitatea lingvistic. Pentru majoritatea structuralitilor poziia este clar: lingvistica structural este o tiin, iar nonstructuralitii sunt atiinifici. De aceea, lucrrile ultimilor ar fi inutile (caracterizate drept produse ale colii-anticariat de lingvistic). coli structuraliste diferite sunt de acord asupra acestui punct de vedere. Ideea lor comun este c limbile sunt sisteme i trebuie studiate ca sisteme, n termenii diferitelor elemente cuprinse n fiecare sistem i pe ct posibil fr referire la semnificaie (meaning), care este insuficient structurat i prea puin accesibil criteriilor obiective. Datele primare ale limbii sunt supuse unor analize ce implic diverse grade de abstracie, cu intenia de a penetra diversele nivele ale sistemului, concepute ca pri ale unei anumite realiti interioare, aflate n spatele nveliului limbii. De fapt, structura limbii poate fi apreciat fr a contesta c i ceea ce nu este discutat n termeni de structur este valabil din punct de vedere tiinific, dup cum tehnicile structuraliste pot fi aplicare fr exclusivismul de a fi considerate singurele valabile. Dar o tiin a limbii care ignor coninutul limbii semnificaia nu mai este de conceput dect ca o etap experimental. i structuralitii accept astzi, din ce n ce mai mult, o perspectiv nglobant asupra limbii, restriciile referitoare la semnificaii nu sunt totale i metodele tiinelor experimentale sunt aplicate prin adecvare specific la o tiin umanist. Principiile acestui curs de lingvistic general considerm c vor fi mai bine nelese, n implicaiile lor umane, prin cunoaterea principiilor care l-au cluzit, n activitatea sa tiinific, pe marele
21

lingvist de origine romn Eugeniu Coeriu (19217 sept.2002), pe care el le-a expus n martie 1992, cu prilejul desemnrii sale ca Membru de onoare al Academiei Romne. Reproducem fragmente din alocuiunea rostit de domnia sa, pe baza notielor noastre: Principiile care m-au cluzit, care reprezint unitatea activitii mele, sunt eseniale i configureaz o unitate de gndire i eluri pentru disciplina noastr (lingvistica): 1. obiectivitate (realism), 2. umanism, 3. principiul continuitii (al tradiiei), 4. principiul generozitii (i al antidogmatismului), 5. principiul responsabilitii sociale (al utilitii publice). 1. Obiectivitatea (realismul) este principiul general al tuturor cercettorilor, nu numai al celor din domeniul culturii, orice om de tiin astzi i pune probleme de etic tiinific, care presupune obiectivitate. Obiectivitatea impune ca obiectul cercetrii s fie studiat n realitatea sa, cercettorul eliminndu-se pe sine nsui i ceea ce este contigent, care ar putea modifica viziunea. Platon n Dialogul despre sofism a stabilit principiul a spune lucrurile aa cum sunt, adic nu parial, sau cum au fost, sau cum vor fi sau cum ar putea fi. E cel mai greu de a lsa lucrul s apar n lumina sa, cci de obicei parializm. Principiul e obligatoriu s fie respectat, dar tim c orice obiect se afl ntr-o serie infinit de conexiuni i cercettorul trebuie s-i pun problema pn unde poate s in seama de ele. Adevrata originalitate tiinific este respectarea obiectului. Istoria culturii nu merge pe ci mrginae, ci pe aceea a tradiiei i continuitii. Principiul implic corolarul universalitii: obiectul trebuie prezentat aa cum oricine ar putea s-l vad. 2. Principiul umanismului e specific fiinelor umane realitatea de care vorbim i cea de care dm seama e una pe care o cunoatem ca oameni limbajul nu ine de lumea necesitii, ci de cea a libertii: ea este un scop ( I.Kant). Cnd studiem limbajul plecm de la noi nine, avem baza pentru cunoaterea n toate formele sale, nu este o ipotez, ci e tiina originar pe care o are omul n ceea ce-l caracterizeaz ca om: limba, arta, religia, cultura sunt forme ale spiritului, activitate creatoare ca atare, creativitatea nsi, iar cultura este obiectivitate n form istoric. Aceast tiin originar este premergtoare tuturor tiinelor
22

omului despre sine nsui. Altfel spus, n lingvistic este vorba de a transforma ceea ce se cunoate intuitiv (Bekannt) n ceea ce se cunoate raional i reflexiv (Erkannt). Cognitio confusa (ap. Leibnitz) se transform n cognitio adequata, fondat pe corolarul (aproape paradoxal), pentru c lingvistul nu tie altceva dect vorbitorul, dar tie altfel, c: vorbitorul are totdeauna dreptate. Primul corolar: limbajul nu e creat de i pentru lingviti, ci de vorbitori, pentru vorbitori. Al doilea corolar: unitatea ntre teorie i studiul empiric; ntre ele nu este nici un conflict, ele constituie o unitate. Plecm de la Bekannt (teoria realului, a faptelor = teoria e recunoaterea universalului n fapte concrete). Orice interpretare conine n mod necesar o teorie i nu exist nici o teorie impus realitii (dac teoria nu se aplic, cu att mai ru pentru teorie, cci nu mai e teorie, ci prostie Ortega y Gasset). Punctul de plecare e faptul c baza este omul ca om. El a putut ti ntotdeauna c e subiect de cultur. 3. Principiul continuitii sau tradiiei n lingvistic [E. Coeriu consider c nu trebuie fcut diferen ntre teoria limbajului i ideile universale, ntre lingvistica pretiinific i cea tiinific]. Primul corolar: ideile lui Aristotel despre limbaj sunt tot att de valabile ca i cea mai recent idee lingvistic lansat. [n interpretarea obiectului, Eugeniu Coeriu a plecat, ntotdeauna, de la tradiia Aristotel, Sf. Augustin, Sf. Toma dAquino]. Al doilea corolar: n studiile despre istoria lingvisticii s ne referim la intuiiile exacte ale naintailor, la concepia lor, care a devenit tradiional. [Eugeniu Coeriu a ntreprins recuperri ale operelor unor savani din trecut: de exemplu a lui H. Tiktin care a expus principiile sintaxei structurale, n 1895 , dar gramatica sa fiind n limba romn, nu a fost citat n bibliografiile lingvistice internaionale]. 4. Punctul de vedere sincronic este cuprins n principiul antidogmatismului i al generozitii tiinifice. Toi lingvitii au tiut ce sunt faptele lingvistice prin calitatea lor de vorbitori = toi lingvitii de bun credin merit respect, fie c sunt sau nu sunt de acord cu noi. Primul corolar: aplicarea la studiul limbilor a acestui principiu [a fost considerat un fel de eclectism al lui Eugeniu Coeriu, reprezentantul unui structuralism moderat]. El ns declar: Fiecare punct de vedere i are limitele necesare, trebuie s tim ce punem ntre paranteze. Cuvntul grecesc methodos nseamn drum, deci toate metodele sunt drumuri, fiecare duce undeva, trebuie
23

s tim doar ce putem face cu o anumit metod i cum interpretm metalingvistic rezultatele la care ajungem. Trebuie s avem generozitate i trebuie s nelegem dinluntrul ei fiecare teorie. Pornim cu ncredere, analizm orice teorie nou i explicm, dac e cazul, devierea. Ceea ce se critic nu sunt consecinele, ci principiul nsui [este cazul criticii pe care E. Coeriu a fcut-o teoriei lui Bloomfield]. 5. Dac lingvistica vorbete despre ceea ce tiu oamenii i se bazeaz pe aceast intuiie a vorbitorului, trebuie s inem seama de tot ceea ce intereseaz pe vorbitor. Primul corolar se refer la expresie: un limbaj formalizat al lingvisticii se va adresa specialitilor, n rest trebuie s folosim un limbaj accesibil oricrui cititor [terminologia folosit de Eugeniu Coeriu pleac de la noiunile curente]. Al doilea corolar: lingvistica aplicativ ine seama de interesele vorbitorilor; lingvistul se va preocupa i de teoria corectitudinii lingvistice, de teoria predrii limbilor, de teoria traducerilor .a..
BIBLIOGRAFIE Eugenio Coeriu, Introducere n lingvistic, traducere de Elena Ardeleanu i Eugenia Bojoga, cuvnt nainte de Mircea Borcil, ediia a II-a, Ed. Echinox, Cluj-Napoca,1999. Eugen Coeriu, Prelegeri i conferine, Ed. Academiei, Iai, 1994. Constantin Dominte, Zamfira Mihail, Maria Osiac, Lingvistic general, Ed. Fundaiei Romnia de Mine, Bucureti, 2003. Constantin Frncu, Curente i tendine n lingvistica secolului nostru, Casa Editorial Demiurg, Iai, 1999. DL = Dicionar al tiinelor limbii (autori: Angela Bidu-Vrnceanu, Cristina Clrau, Liliana Ionescu-Ruxndoiu, Mihaela Manca, Gabriela Pan Dindelegan), Bucureti, Ed. Nemira, 2001. Emil Ionescu, Manual de lingvistic general, Ed. All, Bucureti, 2001. Bertil Malmberg, Les nouvelles tendances de la linguistique, Paris, PUF, 1968. A. Martinet, Elments de linguistique gnrale, Paris, Ed. A. Colin, 1967. Geeorges Mounin, Istoria lingvisticii, traducere i prefa de Constantin Dominte, Ed. Paideia, Bucureti, 1999. Ferdinand de Saussure, Curs de lingvistic general (ediie critic de Tulio de Mauro), Ed. Polirom, Iai, 1998. N.C.W. Spence, Spre o nou sintez n lingvistic: opera lui Eugenio Coeriu, n Echinox, Cluj, XXVIII, 1996, nr.10-11-12, p.10-13. Tratat de lingvistic general (=T.L.G.), sub redacia Al. Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucureti, 1971. 24

CHESTIONAR 1. Care sunt ideile centrale ale gndirii saussuriene ? 2. Care este importana folosirii unei terminologii tiinifice adecvate ? 3. Care este natura i scopul lingvisticii ? 4. Expunei unul sau mai multe principii care l-au cluzit pe Eugen Coeriu n activitatea sa lingvistic. 5. Care sunt perspectivele metodologice ale studiului asupra faptelor lingvistice ? 6. Citai una dintre definiiile limbii. 7. Citai una dintre definiiile lingvisticii. 8. n ce const obiectivitatea de abordare a cercetrii lingvistice? 9. De ce este important principiul responsabilitii sociale (al utilitii publice) al lingvisticii aplicate ?

25

PERSPECTIVE METODOLOGICE DE STUDIERE A LIMBII

METODA ISTORIC (EVOLUTIV) I DIACRONIC

n deceniul VIII al secolului al XIX-lea, o dat cu modificarea perspectivei asupra limbii ca obiect de studiu, s-au nmulit i metodele de studiu. De la abordarea comparativ a limbilor s-a trecut la stabilirea istoriei fiecrei limbi n parte (mai nti pentru cele indoeuropene) n care existau informaii scrise de o lung perioad de timp. Acestea erau limbi europene (limbi germanice i romanice) pentru care corpusul de informaii comparate putea fi analizat i n sens cronologic. Gramatica romanic a lui Friederich Diez (1836) a contribuit din plin ca noiunea de evoluie istoric a limbilor s constituie baza teoretic a noii direcii de cercetare. Atestarea documentar (n scris) a unor limbi ntr-o perioad de aproximativ 2000 de ani nregistra diferenele intervenite i invita la explicarea lor. Dar a fost necesar o schimbare de viziune asupra limbii nsei (ca obiect de studiu) pentru ca metoda istoric, folosit de ctre neogramatici dup 1870, s valorifice, cu bune rezultate, constatrile lingvisticii comparate. Ei au situat n perspectiv istoric toate rezultatele comparaiei, i, prin aceasta, au nlnuit faptele n ordinea lor natural (Saussure, p.32). Georges Mounin a artat c aportul esenial al neogramaticilor const n afirmarea: 1) caracterului absolut al legilor fonetice; la care adaug alte dou contribuii (mai puin puse n valoare de sintezele aprute): 2) teza c lingvistica este o tiin istoric i 3) reacia violent contra opiniilor limitate sau false ale naintailor (Mounin, p.144-145). Lingvitii, prin explorarea mrturiilor despre diverse limbi, cercetnd stadiile de limb intermediare, ntre un moment iniial, luat n consideraie ca cel mai vechi, i un moment din prezent, au ajuns, ca n orice domeniu al tiinei, la descoperirea unor legi care i exercit puterea, primele formulate ca atare fiind legile fonetice. Un deceniu de discuii fertile, la care au participat savani din diferite ri, au nuanat conceptul de lege, care subsumeaz corespondene n spaiu i timp, concept care nu este infailibil. Dificultatea a intervenit n
26

momentul aplicrii unei legi la studiul concret al unei limbi, cnd s-a constatat c, limbile fiind n contact unele cu altele, istoria lor este condiionat sub acest aspect. H. Schuchardt a atras atenia asupra variabilelor care acioneaz asupra legilor fonetice (i nu numai), iar Otto Jespersen asupra rolului semnificaiei (signification), n consecinele pe care sensul i folosirea cuvintelor n context le au asupra diferenierilor n tratamentul lor fonetic. Spre sfritul secolului al XIX-lea se considera c singurul studiu tiinific al limbajului este metoda istoric i c orice studiu lingvistic tiinific care nu este istoric n scopurile sale nici n metodele sale, se poate explica fie printr-o deficien a cercettorului, fie prin insuficiena surselor de care el dispune (Mounin, p.145). Aceast perspectiv restriciona ns studiul limbii, presupunnd eludarea aspectelor descriptive i sincronice. Puncte de vedere diferite, n aceeai epoc, au ntreinut interesul pentru abordarea sincronic a cercetrii, H. Schuchardt cu deosebire promovnd cercetare aspectului vorbit al limbii (studiul limbajului). Prin urmare, metoda istoric bazat pe legile fonetice a suferit ea nsi nuanri i, dac n formularea iniial nu a mai fost acceptat, ea s-a perpetuat n convingerea lingvitilor c n limb schimbrile se supun unei anumite regulariti, c n nici un domeniu al ei nu acioneaz hazardul. Complexitatea factorilor care intervin i existena (sau apariia) unor tendine contrare determin excepiile, iregularitile, devierile. Dei combtut, principiul legilor fonetice rmne baza (deci posibilitatea nsi de existen) a lingvisticii istorice (Oancea, p.56). Criticii metodei istorice a neogramaticilor au atacat doar exagerrile lor, nu principiile ca atare; nuanrile aduse acestei metode au apelat la argumente care pun n lumin faptul c fenomenele limbii sunt complicate i depind i de factori extralingvistici. n secolul al XX-lea s-a ajuns la concluzia c aceast complexitate caracteristic schimbrilor ce au loc n toate domeniile limbii ar recomanda renunarea la formularea elementelor definitorii sub form de legi propriuzise, meninndu-se observarea lor ca regulariti generalizate. Preponderena interesului pentru studiul limbilor n perspectiv cronologic a determinat diferenierea preocuprilor ntr-un domeniu de sine stttor: lingvistica istoric. Fr s mai fie subordonat concepiei mecaniciste, ea privilegiaz n continuare studiul n perspectiv istoric a limbajului, ns ea se bazeaz pe metode funcionale i structurale i constituie, nu numai terminologic, o alt entitate, cea a diacroniei.
27

Diacronia este perspectiva structuralist asupra istoriei limbii. F. de Saussure a fundamentat posibilitatea de a studia limba cu metode tiinifice sub ambele aspecte (descriptiv i istoric). El ns le-a prezentat ca fiind distincte i le-a ilustrat sub forma unui sistem de axe (Saussure, p.98):
C A D B

Axa A B simbolizeaz simultaneitatea, iar C D succesiunea. Lingvistica istoric sau evolutiv studiaz diferitele stadii ale limbii, distanate n timp i spaiu, comparndu-le apoi unele cu altele. Astfel, pe axa diacronic se pot succede analize sincronice ale unei limbi (x), de exemplu:
C (limba n perioada 1520-1580) (limba n perioada 1600-1650) (limba n perioada 1700 - ) (limba n perioada - ) A D B (limba n perioada contemporan)

Rezultanta prospectrii n timp a unei limbi (x) prin analize sincronice conduce la o cunoatere a ei diacronic. Pe baza unui ir de exemple de tipul: lat. maturu se opune v.fr. mer, lat. cantata se opune v.fr. chante, Saussure a ajuns la concluzia c n perioada (intervalul) dintre latina clasic i vechea francez, adic ntre secolele I al XII-lea, sunetul -t- intervocalic a disprut. Pe baza atestrilor scrise din limbile latin i francez sau a cronologiei relative se ajunge la determinarea (mai mult sau mai puin exact) a datei cnd s-a produs acest fenomen. Se poate aduga studiul rspndirii n spaiu al acestui fenomen fonetic. Astfel, -t- intervocalic latin s-a meninut n provensal n form de -d-; s-a precizat perioada (cronologic) ntre dispariia complet a lui t i sonorizarea lui t n d. n acest fel evenimentul temporal este proiectat i pe plan geografic. Saussure a postulat c analiza n seciune transversal A-B (sincronic) poate face total abstracie de factorul timp (i lingvistica
28

structuralist modern utilizeaz cu preponderen aceast perspectiv n analizele i teoriile sale). Unul dintre exemplele sale n acest sens este planul sincronic al limbii, asemntor cu poziia figurilor pe o tabl de ah, care n orice moment poate fi analizat ca situaie n sine (fr s fie nevoie s se reconstituie situaiile anterioare). De exemplu, n limba francez exist o conexiune intim ntre identitatea morfologic a nominativului i a acuzativului i caracterul inflexibil al ordinii cuvintelor n propoziie (subiect verb obiect). O propoziie ca la mre embrasse sa fille este stereotip n ceea ce privete ordinea cuvintelor, pentru c aceast ordine reprezint singurul mijloc de a diferenia subiectul activ de subiectul pasiv. Exist, deci, un raport cauzal n afara procesului temporal, proces cauzal care se exercit n interiorul limbii ca sistem. Saussure a divizat astfel tiina limbii n dou pri: una dinamic, istoric denumit de el i evolutiv sau diacronic i alta static, descriptiv sau sincronic. Ca argument al absenei unor raporturi ntre axa vertical i cea orizontal, Saussure a dat ca exemplu formarea pluralului prin metafonie n german i n englez. n englez, cuv. fot picior avea pl. foti ntr-o perioad veche a limbii. A intervenit apoi metafonia. Acest fenomen pur fonetic nu are nimic de-a face cu formarea pluralului. El transform o form verbal, de ex. germ. tragit > trgt la fel ca i pl. subst. gasti > gste. La fel s-au petrecut lucrurile n englez pentru din fti, muiat n i care a dat n engleza modern feet. Deci, evoluia fonetic, prin acest proces punctual (particular), a modificat ntregul sistem al formrii pluralului. Procesul n sine nu este morfologic, dar el efectueaz o modificare morfologic. Saussure a indicat urmtoarea schem: f t f t f ti f t momentul A momentul B

Astfel, dup opinia lui Saussure, lingvistica sincronic constat faptul c n momentul A formarea pluralului se fcea dup modelul (paradigma) f t f ti, iar n momentul B dup modelul (paradigma) f t f t (prin metafonie). ns considernd lucrurile n perspectiv diacronic se constat c vocala a fost muiat nainte de i pentru a deveni (i mai trziu ee) (ap.Wartburg, p.11). Saussure a atras atenia asupra faptului c: fiecare limb formeaz, practic, o unitate de studiu, i, prin fora lucrurilor, ajungem s o studiem, pe rnd, n mod static i n mod istoric. Indiferent dac, n studiul unei limbi, observaia se ndreapt spre o latur sau spre cealalt, trebuie cu orice pre s situm fiecare fapt n sfera sa i s nu confundm metodele (Saussure, p.113).
29

Saussure i-a bazat aprehensiunea asupra oricrui raport posibil ntre axele vertical i orizontal ale schemei sale, postulnd c: /lingvistului i/ este interzis de a studia simultan (subl. n.) raporturile n timp i raporturile n sistem. Aceast concepie intransigent a fost nuanat de ctre continuatorii si, care au explicat-o pe msur ce s-a apelat tot mai mult la metoda diacronic. A. Meillet a subliniat c studiul istoric, diacronic, reprezint, de fapt, compararea mai multor stri sincronice. Ar fi ideal s se poat urmri curba evoluiei limbii n toate detaliile ei. Concluzia sa a fost c n fond, nu exist... n ceea ce privete studiul pozitiv al limbilor particulare, dect o singur disciplin gramatical, n acelai timp descriptiv i istoric i care doar pune n eviden latura descriptiv sau cea istoric, n funcie de sensul special al cercetrii ntreprinse (Meillet, p.48). De fapt punctul de vedere al observatorului (lingvistului) este cel care instituie perspectiva sincronic sau diacronic asupra unuia i acelai obiect al cercetrii, care este limba.
BIBLIOGRAFIE A. Meillet, Linguistique historique et linguistique gnrale, ed. a 2-a, Paris, 1952. W. von Wartburg, Problmes et mthodes de la linguistique, P.U.F., Paris, 1963. Tratat de lingvistic general (T.L.G.), sub redacia Al. Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucureti, 1972. Ferdinand de Saussure, Curs de lingvistic general, Ed.Polirom, Iai, 1998. G. Mounin, Istoria lingvisticii, traducere i postfa de Constantin Dominte, Ed. Paideia, Bucureti, 1999. Ileana Oancea, Lingvistic romanic i lingvistic general. Interferene, Ed. Amarcord, Timioara, 1999, p.41-65. CHESTIONAR I SUGESTII DE APLICAII 1. Care este principiul metodei istorice i evolutive de cercetare a unei limbi? 2. Care este lucrarea n care a fost fundamentat aceast metod? 3. Menionai unul dintre factorii lingvistici care condiioneaz istoria limbilor. 4. Caracterizai noiunea de lege lingvistic versus regulariti lingvistice (generalizate). 5. Enunai definiia noiunii de diacronie. 6. Analizai sistemul de axe (descriptiv i istoric) preconizat de F. de Saussure. 7. Difereniai abordarea sincronic i cea diacronic a paradigmei de formare a pluralului n limba englez dat ca exemplu. 30

METODA COMPARATIV-SINCRONIC* (analiza contrastiv)

Fenomenul lingvistic poate fi studiat din trei perspective: 1) sincronic sau descriptiv; 2) diacronic (istoric sau evolutiv) i 3) comparativ. Din perspectiv sincronic pur se poate studia cte o singur limb, alegndu-se o anumit etap din evoluia ei (de exemplu: limba francez din secolul al XVII-lea sau limba romn din secolul al XIX-lea), pentru a fi cercetat din mai multe puncte de vedere (fonetic i fonologic, morfologic, lexical, sintactic, stilistic). Din perspectiv diacronic se poate studia, de asemenea, cte o singur limb, dar, de data aceasta, inndu-se seama de succesiunea mai multor etape din evoluia ei, eventual de succesiunea tuturor etapelor cunoscute (din texte) ale evoluiei limbii avute n vedere; se realizeaz, n felul acesta, studiul numit istorie a limbii respective. Spre deosebire de perspectivele sincronic i diacronic, care pot regiza n mod independent studiul unei limbi sau al alteia, n mprejurri speciale cele dou perspective putnd fi conjugate, aplicate mpreun, alternativ sau simultan, perspectiva comparativ nu este independent de celelalte dou: este vorba, n realitate, fie de o perspectiv comparativ diacronic (ceea ce se cunoate sub denumirea de studiu comparativ-istoric al fenomenului lingvistic), fie de o perspectiv comparativ sincronic. n afar de aceasta, dac din perspectivele sincronic i diacronic se poate studia cte o anumit limb, din perspectiva comparativ, dimpotriv, studiul postuleaz atenia acordat la dou sau mai multor limbi, simultan, comparaia implicnd ntotdeauna cel puin doi termeni: termenul de comparat i cel cu care se compar precedentul. Studiul comparativ diacronic, realizat prin metoda comparativistoric, se aplic mai multor limbi, care trebuie s ndeplineasc condiia de a fi nrudite (adic de a fi provenit din aceeai protolimb), n scopul de a le reconstitui trecutul istoric, eventual pe cel preistoric, comun (n acest context, adjectivul istoric se refer la etapele pentru care exist atestri n texte sau inscripii , iar adjectivul preistoric se refer la etapele din istoria limbilor nrudite pentru care nu posedm
* Mulumim i pe aceast cale domnului prof. univ. dr. Constantin Dominte, care a fost de acord s reproducem acest capitol, redactat de d-sa, pentru a face cunoscute studenilor cercetrile sale (cf. Constantin Dominte, Negaia n limba romn, Bucureti, Editura Fundaiei Romnia de Mine, 2003), ap. Constantin Dominte, Zamfira Mihail, Maria Osiac, Lingvistic general, Bucureti, Ed. Fundaiei Romnia de Mine, 2003, p. 48-55. 31

nici un fel de atestare grafic; pe scurt istoria limbilor ncepe o dat cu atestarea lor n scris, nainte de acest moment putndu-se vorbi de preistoria lor, dar pentru comoditate se prefer denumirea global istorie pentru ntreaga evoluie n timp a unei limbi sau a alteia: intr aici att etapele propriu-zis istorice, ct i cele preistorice, care urmeaz a fi reconstruite prin comparaie). Studiul comparativ-sincronic, n schimb, nu se aplic, de obicei, mai multor limbi simultan, ci doar asupra a numai cte dou limbi, pentru care nu este obligatorie condiia de a fi nrudite; singura condiie de ndeplinit n acest caz este ca din cele dou limbi comparate s se aleag stri de evoluie contemporane (de exemplu: limbile romn i francez n secolul al XIX-lea sau limba romn i limba maghiar n secolul al XX-lea). Ce se poate urmri printr-un astfel de studiu? De bun seam, punerea n eviden a elementelor de structur comune i, mai ales, a acelora distincte (numite contraste) din structurile limbilor comparate. Metoda comparativ-sincronic, aplicat n felul acesta, cu scopul precizat aici, se mai numete i analiz contrastiv. Prin ce se motiveaz o astfel de cercetare, n ce const utilitatea ei? Este vorba de o dubl motivaie: una de ordin cognitiv, teoretic, cealalt de ordin practic. Din punct de vedere teoretic se urmrete mai buna nelegere a particularitilor, a specificului de structur i de sisteme ale celor dou limbi, cu rezultate foarte utile tipologiei lingvistice (studiului tipurilor structurale de limbi). Din punct de vedere practic, nelegerea mai bun a sistemelor i structurilor limbilor comparate sincronic (sau analizate contrastiv) duce, se nelege, la mai buna stpnire i practicare a celor dou limbi comparate, cu consecine pozitive att pentru didactic (predarea limbilor), ct i pentru traductologia aplicativ (traducerea exact, ct mai fidel a textelor dintr-o limb n cealalt). Din punct de vedere didactic, de pild, orice manual de predare a unei limbi strine este, implicit, o lucrare de ordin contrastiv: n leciile lui sunt comparate (fonetic i fonologic, morfologic, lexical etc.) limba care se pred i limba n care se pred (de obicei, limba matern a elevilor sau studenilor), pentru a se atrage atenia cu deosebire asupra punctelor, aspectelor, elementelor n privina crora cele dou limbi se deosebesc mult, eventual foarte mult, i aceasta tocmai n vederea nelegerii mai bune, a cunoaterii i stpnirii acelor elemente difereniatoare, n scopul practicrii, al folosirii ct mai adecvate, ct mai corecte a limbii strine avute n vedere. Dou exemple, foarte elementare, vor lmuri mai bine n ce const i cum se aplic analiza contrastiv. 1) S vedem mai nti, pe baza a dou enunuri ndeajuns de simple, prin ce se aseamn i prin ce se deosebesc (contrasteaz)
32

unele structuri ale limbilor romn i francez. Pornim de la enunurile rom. (1) Merge la coal pe jos; (2) Merge la coal cu maina, crora le corespund fr. (1) Il va lcole pied; (2) Il va lcole en voiture. Contrastul cel mai frapant, chiar de la o prim privire, apare n compararea complementelor circumstaniale de mod din cele dou limbi: rom. (1) pe jos cu fr. (1) pied; expresiile lor, echivalente semantic, se deosebesc din punct de vedere gramatical: romna recurge la adverbul jos, pe cnd franceza, la substantivul pied, la numrul singular i, n plus, romna recurge la o propoziie care, prin sensurile ei principale, corespunde, n alte contexte, prepoziiei fr. par sau sur, iar franceza recurge la o propoziie care, prin aceleai sensuri principale ale sale, corespunde, n alte contexte, prepoziiei rom. la. Cele dou enunuri par mai apropiate structural n prima lor parte; faptul este adevrat din punct de vedere lexical: avem aici cte un verb, referitor la deplasare, i cte un substantiv, desemnnd cldirea unei instituii de nvmnt ca int a deplasrii. Dar din punct de vedere gramatical, la o cercetare aprofundat aadar, constatm deosebiri importante ntre structurile romn i francez implicnd verbul-predicat i complementul lui circumstanial de loc. n privina predicatului constatm c n romnete este suficient forma verbal, care, prin desinen, implic i subiectul (un subiect de persoana a III-a singular, numit subiect subneles); n francez, n contextul echivalent, forma verbal, pur i simpl, nu este suficient pentru exprimarea subiectului: ei i se adaug i pronumele personal de persoana a III-a singular (masculin, aici, dar care ar fi putut s fie i de gen feminin: elle) n forma aton sau neaccentuat de caz nominativ (numit n gramatica francez pronom sujet). Dac ne raportm la complementele circumstaniale de loc, i aici constatm echivalena lexical, dar i un contrast de ordin gramatical, chiar dac prepoziiile (rom. la, fr. ) sunt echivalente, prin sensurile lor principale, actualizate n context. Contrastul const n faptul c substantivul romnesc este nearticulat, pe cnd substantivul francez este articulat definit. Dac am introduce un atribut exprimat prin adjectiv posesiv (rom. sa, fr. sa), contrastul dintre cele dou construcii s-ar amplifica: rom. la coala sa, fa de fr. son cole. Amplificarea contrastului romno-francez, ntr-o astfel de mprejurare, const din urmtoarele: n romn, adjectivul posesiv se plaseaz dup substantiv; n francez naintea substantivului; n romn, acelai adjectiv i menine, prin acord, forma de gen feminin; n francez, adjectivul echivalent capt o form aparent de gen masculin, terminant n sonant (n realitate, el este tot de gen feminin, dar expresia lui fonic nu este sa, ci son, pentru a se evita hiatul dintre -a final, din sa, i - iniial, din cole, altfel spus
33

34

35

Fr a fi necesare, pentru moment, alte detalii, numai din lista sumar de mai sus se poate deduce un anumit contrast ntre limbile romn i englez, anume c, n romn, negaia profraz i negaia verbal sunt omonime (cf.rom. Nu, nu vede), de aceea, pentru a diferenia grafic cele dou feluri de negaie se poate recurge la maniera lexicografic de a le marca cu indici cifrici (rom. Nu1, nu2 vede), pe cnd, n limba englez, aceleai dou feluri de negaie nu sunt omonime (cf.engl. No, he does not see). Alt contrast poate fi pus n eviden att de exemplele de mai nainte, ct i de acestea din urm: negaia verbal romneasc (nu2) este simpl i antepus formelor verbale de mod predicativ (ca i de infinitiv), dar negaia verbal englez este uneori simpl i postpus (cf. engl. The whale is not a fish), alteori complex i antepus (cf. engl He does not see) formelor verbale predicative (engl. is, respectiv see). Pe de alt parte, limba romn admite cumulul negaiilor verbal i lexematic n structura unuia i aceluiai enun negativ analizabil (cf. rom. Nu vede nimic, sau Nu vede pe nimeni, eventual Nu vede nimic, niciodat i nicieri), n contrast cu limba englez, care nu admite un astfel de cumul (cf. engl. He does not see anything, respectiv He sees nothing). Lingvitii afirm n astfel de mprejurri c limba romn este redundant, adic face risip de material lingvistic, repetnd exprimarea negaiei, pe cnd limba englez este economic, adic exprim negaia o singur dat, fie gramatical (... does not see ... ), fie lexical (... sees nothing). Aceasta nu nseamn nicidecum vreun gen de superioritate a limbii engleze fa de limba romn, cci sunt posibile structuri n care, dimpotriv, limba englez manifest redundan n contrast cu romna, care se dovedete a fi mai economic n structurile corespunztoare, echivalente. De exemplu, n limba romn este suficient forma gramatical a verbului-predicat, s zicem vede, pentru a ne da seama c este vorba de un subiect de persoana a III-a (desinena e ne spune acest lucru); n schimb, n englez, chiar dac verbul are form de persoana a III-a, sees (cu desinena s), acest lucru nu este ndestultor, fiind necesar i antepunerea unui pronume, ca he sau she (se exprim astfel de dou ori valoarea de persoan a III-a). Toate faptele puse n lumin pn aici in de structurile limbilor comparate, se manifest pe axa sintagmatic. Dac ne raportm ns i la sistem, adic la fapte de ordin paradigmatic, atunci mai poate fi evideniat un alt contrast ntre limbile avute n vedere. Pentru aceasta trebuie s lum n considerare i afirma ia profraz (rom. da; engl.
36

yes), cu observaia c, n timp ce n romn afirmaia profraz, ca rspuns la o interogaie de aspect negativ ( Nu este iarn n Romnia, n luna ianuarie? Ba da), difer de afirmaia profraz, ca rspuns la o interogaie de aspect afirmativ ea nsi ( Este iarn n Romnia, n luna ianuarie? Da), n schimb, n englez, se rspunde n acelai fel, prin yes, la interogaiile de ambele aspecte, afirmativ i negativ. Nu este mai puin adevrat ns, c n situaia rspunsului minimal afirmativ la o ntrebare negativ, n englez se prefer, de obicei, n locul simplului yes, reluarea interogaiei convertite n propoziie enuniativ (cu verbul auxiliar to do), cf.engl. Do you not see? I do (see). innd aadar seama de ceea ce se numete adverbe asertive (afirmaie i negaie profraz), este de conchis c romna dispune de trei astfel de adverbe, pe cnd engleza, numai de dou, cu ocurene (apariii) distincte n dialoguri, dup cum se arat n schema de mai jos, n care I = interogaie (ntrebare), R = replic (rspuns), + = pozitiv (afirmativ), iar = negativ:
(1) (2) (3) (4) I + + R + + Rom.: Da Nu Nu Ba da Engl.: Yes No No (Yes)

Pentru a conchide, se poate spune c contrastul dintre limbile romn i englez, n privina exprimrii negaiei, const n linii mari din urmtoarele: negaiile romneti profraz i verbal sunt omonime, pe cnd cele engleze nu sunt omonime; limba romn admite, n acelai enun, cumulul negaiilor verbal i lexematic, pe cnd engleza nu admite cumulul lor; limba romn dispune de trei adverbe asertive, pe cnd limba englez, numai de dou.
BIBLIOGRAFIE R.A.Budagov, Introducere n tiina limbii, traducere i note de G.Mihil, Ed. tiinific, Bucureti, 1961, p.269 i n.1-3. Sorin Stati, Lingvistica structural, din vol. Solomon Marcus, Edmond Nicolau, Sorin Stati, Introducere n lingvistica matematic, Ed. tiinific, Bucureti, 1966, p.17-19. 37

Sorin Stati, Varietatea limbilor i problema cunoaterii, din vol. Interferene lingvistice. Din istoria relaiilor lingvisticii cu alte tiine, Ed. tiinific, Bucureti, 1971, p.146-178. Teodora Cristea, lments de grammaire contrastive. Domaine franais-roumain, Ed. Didactic i Pedagogic, Bucureti, 1977. Constantin Dominte, Schi de caracterizare tipologic a negaiei romneti, n Studii i cercetri lingvistice, XXXVI, 1985, nr.5, p.404-407 (versiune francez n Balkan Studies, Thessaloniki, XXXVI, 1995, nr.1, p.5-10; rezumat englez, p.195). CHESTIONAR I SUGESTIE DE APLICAIE 1. Ce particularitate prezint perspectiva comparativ din care pot fi studiate limbile, n raport cu perspectivele descriptiv i istoric? 2. Ce condiii trebuie s ndeplineasc limbile cercetate din perspectiva comparativ-sincronic? 3. Care sunt scopurile i utilitatea aplicrii analizei contrastive? 4. n ce const contrastul dintre limbile romn i englez n privina structurilor lor verbale negative? 5. Se dau enunurile echivalente: rom. Crede c sora lui a citit; germ. Er glaubt, da seine Schwester gelesen hat i se cere s se arate prin ce contrasteaz ele. METODA SEGMENTRII. COMUTAREA, SUBSTITUIA

Considerarea limbii ca o structur are drept corolar constatarea c o nsumare a unor particule elementare, cele mai mici pri constitutive ale limbii deduse prin intuiie, ar avea ca rezultat reflectarea doar parial a realitii. Acest fapt a determinat pe cercettori s porneasc de la premisa c, pentru a putea analiza elementele ei componente este necesar s se porneasc de la ntreg, limba considerat ca un tot, pentru ca s se ajung la elementele de baz, care nu ar putea fi identificate tiinific dect prin acest procedeu. Lingvistul danez Louis Hjelmslev a introdus n lingvistica structuralist, pornind de la principiul coninutului i formei limbii propus de Saussure, o nou metod de cercetare a limbii, n sine i pentru sine. Lingvistica tradiional s-a bazat, dup afirmaiile sale, pe ipoteze exterioare limbii i nici un lingvist n-ar fi descris ceea ce este limba nsi. Lingvistica anterioar a fost denumit transcendent (folosindu-se termenul filosofic care nseamn ceea ce este dincolo [de o anumit limit]), n timp ce lingvistica construit pe baza
38

teoriei sale o numete imanent (folosindu-se termenul filosofic care nseamn ceea ce este n interior, ceea ce are fundamentul n obiectul nsui). El consider c lingvistica trebuie s caute s determine ceea ce este caracteristic i comun tuturor limbilor, ca i ceea ce determin ca o limb natural s fie constant cu ea nsi. Pentru o descriere lingvistic exact, fr contradicii, exhaustiv i cea mai simpl posibil, care s rspund celor trei cerine ale principiului empirismului n cunoatere, Hjelmslev pornete de la noiunea text care nseamn, n accepia sa, tot ceea ce este o limb determinat sau toate limbile de astzi ale omenirii sau textul reprezint un enun, vorbit sau scris, lung sau scurt, vechi sau recent. Aceast noiune este privit ca o clas care se divizeaz n genuri, fiecare gen devenind la rndul su o clas pentru a fi divizat succesiv pn la epuizarea posibilitilor de divizare, prin urmare se segmenteaz ntregul pentru a ajunge la unitate. Aceast metod a segmentrii el a denumit-o analitic, specificant i deductiv, opunnd-o metodei tradiionale care este sintetic, generalizant i inductiv. Prin urmare, punctul de plecare l constituie ntregul limbii, care se mparte n fragmente din ce n ce mai reduse din punctul de vedere al corpului sonor, urmrindu-se att legturile dintre aceste fragmente, ct i relaiile fiecrui fragment cu ntreg ansamblul limbii. Fragmentul ultim rezultat va trebui s reprezinte o unitate articulat dotat cu sens. Pentru realizarea acestui deziderat L. Hjelmslev a operat segmentarea unui enun n fragmente, pri constitutive ale limbii. Pentru a verifica dac un asemenea segment reprezint efectiv o parte constitutiv, el este introdus n alt context i dac corespunde, adic conduce la acelai rezultat, din punctul de vedere al mesajului, se consider c este produs dovada unei segmentri realizate corect. Nivelele la care se practic operaia sunt diferite, se poate diviza din fluxul vorbirii enunul, care la rndul lui s reprezinte punctul de plecare pentru alte segmentri subiacente, sau se iau n considerare fragmente mai mici, cum este silaba, pentru analiza constituenilor. De exemplu, prin analiza doar a unor texte reprezentative dintr-o limb, se obin o serie de cunotine despre sistemul limbii respective, pe baza crora pot fi create noi texte. Aceasta pentru c totalitatea nu se compune din elemente, ci din interdependena dintre ele. Existena tiinific se datoreaz nu substanei, ci relaiilor interne. Prin aceast opinie Hjelmselv a dus pn la capt teza saussurian potrivit creia limba este form, nu substan. Prin urmare, el i-a propus drept scop principal al analizei determinarea relaiilor ntre prile componente ale textului.
39

Metoda segmentrii presupune un procedeu prin care se izoleaz i se identific prile constitutive ale limbii ntr-un mod asemntor cu acela utilizat de vorbitori cnd pun n micare limba pentru a comunica unii cu alii (Coteanu, p. 24). Acest procedeu a fost folosit n dou direcii de cercetare ale structuralismului din sec. al XX-lea, anume de ctre reprezentanii colii pragheze i de ctre adepii principiilor glosematicii, iar, ntr-o alt perspectiv, de ctre descriptivitii americani. Tehnica utilizat este similar, pentru c ei i-au propus s ajung la descifrarea constituenilor limbii avnd n vedere principiul segmentrii, a crui corectitudine de realizare este ns valorizat n moduri diferite. Astfel, pentru a se face controlul corectitudinii segmentrii se apeleaz la nlocuirea unei pri din enun cu alt material lingvistic, procedeu denumit de ctre Hjemslev comutare i, respectiv, de ctre Z.S.Harris, descriptivist american, substituie; Einar Haugen a folosit termenul nlocuire. Hjelmslev a stabilit o relaie important ntre ceea ce numete funcia i i (conjuncia logic) i funcia sau sau (disjuncia logic) ca baz a diferenei ntre procesul limbii (textul) i sistemul limbii. Numai n sistem relaia este sau sau, n timp ce n succesiunea procesului vorbirii relaia este i i. Dac se iau dou cuvinte: lac, sac ele pot fi transformate n altele dac se modific cte un element, adic l prin r, c prin d, a prin o, rezultnd cuvintele rod, roc, soc etc. Acest procedeu de nlocuire a unui element printr-un alt element n paradigm a fost numit de Hjelmslev, comutare. Pe cnd comutarea se opereaz ntre invariante, ntre variante se realizeaz o substituie (de exemplu, ntre r iniial i r final din cuvntul rar). Teoria lui Hjelmslev a fost numit de ctre discipolii si glosematic pornind de la glosem forma minimal pe care analiza o poate determina, adic invariante ireductibile (pe planul coninutului i al expresiei). Dei i s-au adus numeroase critici, ea reprezint o contribuie major la promovarea structuralismului saussurian. coala american descriptivist, reprezentat de L. Bloomfield, K.L.Pike, E. Nida, Ch. Fries, are n vedere, de asemenea, faptul c descrierea lingvistic trebuie s fie bazat numai pe fapte determinabile lingvistic (exist similitudini cu principiul imanenei invocat de glosematicieni). Din punctul de vedere al metodei, Bloomfield procedeaz ca i reprezentanii colii fonologice de la Praga (fonemul este o calitate sonor i caracteristicile distinctive sunt ale proprietilor sonore, Malmberg, p.245). El nu ia n consideraie, n analiza coninutului, distincia ntre form i substan.
40

Discipolii si, unii structuraliti riguroi, au definit unitile minimale numai pe baza distribuiei (Z. S. Harris), fr nici o legtur cu semnificatul. Utiliznd procedeul segmentrii enunului i, pentru verificare apelnd la substituie, Harris n-a reuit s demonstreze, de fapt, cum pot fi determinate invariantele lingvistice fr referire la semnificaie (Malmberg, p.253).
BIBLIOGRAFIE I.Coteanu, Comutarea i substituia, n Elemente de lingvistic structural, Ed. tiinific, Bucureti, 1967, p.23-37. Al. Graur, Lucia Wlad, Scurt istorie a lingvisticii, Ed. Didactic i Pedagogic, Bucureti, 1977, p 204-223. Valeria Guu-Romalo, Distribuia, n vol.cit., p.38 58. John Lyons, Introducere n lingvistica teoretic, Ed. tiinific, Bucureti, 1995, p. 206-207, 241-244. B. Malmberg, Les nouvelles tendances de la linguistique, PUF, Paris, 1966, p.207-260. CHESTIONAR 1. Care este sensul noiunii text folosit de Hjelmslev ? 2. Care sunt etapele segmentrii? 3. n ce scop se folosesc procedeele de comutare i de substituie? METODA TIPOLOGIC

Interesul crescnd pentru cercetarea fundamental s-a manifestat n lingvistic printr-o atenie special acordat problemelor clasificrii tipologice a limbilor, eseniale att pentru studiile de gramatic general, ct i pentru cele de comparare a limbilor. Tipologia lingvistic este o direcie modern de cercetare care consist, dup definiia pe care o d Carlo Tagliavini, n gruparea limbilor dup diverse tipuri care ar corespunde structurilor mentale ale diverselor popoare. Se consider c numai prin tipologie lingvistica poate atinge puncte de vedere absolut generale. Ea este n direct legtur cu studiul universaliilor. Cercetrile consacrate clasificrii tipologice au scos la iveal faptul c n fiecare limb predomin anumite procedee de exprimare a coninutului gramatical, n schimb altele lipsesc sau sunt folosite rar. Tipologia se sprijin pe structura limbii i este definit prin mijloace gramaticale de expresie, eseniale pentru fiecare caz n parte. n
41

clasificarea tipologic (spre deosebire de cea genealogic) nu mai intereseaz nrudirea morfemelor i, implicit, nici filiaia lingvistic, ci tipul limbii, cu alte cuvinte asemnrile i deosebirile ce se manifest n structura gramatical a limbilor, indiferent de originea lor. Conceptul de tipologie, folosit pentru prima dat n 1928 n tezele colii de la Praga, este calitativ diferit de conceptul folosit n sec. al XIX-lea, care se referea de fapt la o clasificare a limbilor. Cf. gruparea limbilor n patru mari tipuri: aglutinant, flexionar, incorporant, izolant. Tipologia n accepia modern a termenului a progresat pe msur ce metodologia sa a devenit mai complex, pe msur ce s-a ridicat la un grad de abstractizare superior i a putut s cuprind un numr tot mai mare de trsturi distinctive i caracterizante ale limbilor analizate. Rafinndu-i criteriile de analiz, aceasta a cptat din ce n ce mai mare putere de penetrare n structura intim a limbilor. O istorie corelativ a tipologiei i a tipologiilor lingvisticii comparate nu a fost nc realizat. Este totui general acceptat teza c noua tipologie se afl ntr-o corelaie specializat cu gramatica teoretic, cci fr aceasta o disciplin tipologic nu mai este astzi de conceput. Fiecare epoc are nu numai o filozofie care i corespunde, ci i o gramatic a sa. Cercetarea este axat att pe nregistrarea integral a rezultatelor de pn acum n acest domeniu, ct i pe o organizare metodic a punctelor de vedere pe care le-au avut n vedere cercettorii anteriori. Nu poate fi vorba de o ierarhizare a rezultatelor obinute pn acum, pentru c fiecare dintre tipologiile propuse, chiar incomplete, contribuie cu sugestii valoroase la cunoaterea tot mai aprofundat a limbii. Etalonul cu care se opereaz n cursul analizei este modelul metalingvistic. Tipologia areal este un concept impus lumii tiinifice, de asemenea, de coala lingvistic de la Praga. S-a constatat existena, n anumite perioade istorice, a unor tendine convergente n limbi care se afl n continuitate teritorial i nu sunt nrudite genetic, ceea ce a determinat pe Trubekoi s propun ca tendinele comune s fie studiate n ansamblu, iar pentru grupul de limbi astfel constituit s se foloseasc termenul de Sprachbund (fr. union linguistique uniune lingvistic). Analiza tipologic consider c pe glob exist multe asemenea nuclee, printre care Balkan-, baltischer und Donaubund; Wikinger Bund; Inselsprachbund, Litoralbund, Bund der DiasporaSprachen, Uniune lingvistic balcanic, Uniune lingvistic dunrean, Uniune lingvistic viking (a teritoriilor locuite de urmaii vikingin42

gilor), Uniune lingvistic insular, Uniune lingvistic a limesurilor (a litoralului), Uniunea limbilor din diaspora .a. Trsturi comune mai multor limbi care nu sunt nrudite sunt constatate n toate domeniile, n special n morfologie, fonologie i lexic i ele sunt explicate prin motenirea unui fond comun i nu prin mprumut.
BIBLIOGRAFIE Al. Ionacu, Clasificarea tipologic, n Tratat de lingvistic general, sub redacia Al. Graur, Sorin Stati, Lucia Wald Ed. Academiei, Bucureti, 1972, p. 452-482. L. Renzi, Histoire et objectifs de la typologie linguistique, n History of Linguistic Thought and Contemporany Linguistics, Ed. H. Parret, Berlin New-York, 1976. Klaus Steinke, A. Vraciu, Introducere n lingvistica balcanic, Ed. Universitii Al. I. Cuza, Iai, 1999. Carlo Tagliavini, Originile limbilor neolatine, Ed. tiinific, Bucureti, 1977. CHESTIONAR 1. Care sunt criteriile clasificrii tipologice? 2. Ce este tipologia areal? 3. Enumerai cteva nuclee de Sprachbund.

43

FUNCIILE LIMBII

Limba ndeplinete o serie de funcii, dintre care cea mai important este cea de comunicare interuman. A comunica nu nseamn ns, neaprat, a folosi o limb. Oamenii pot comunica ntre ei i prin intermediul gesturilor, al mimicii, al semnalelor acustice sau luminoase, al simbolurilor matematice ori chimice, al notelor muzicale, al culorilor etc. Limba reprezint ns, indiscutabil, mijlocul de comunicare cel mai important ntre membrii aceleiai comuniti. Funcia de comunicare este strns legat de natura social a limbii. Ea presupune existena unei societi n cadrul creia se manifest, n primul rnd, ca o necesitate. Nevoia de a comunica este de neconceput n afara unor grupuri sociale de dimensiuni mai reduse sau mai mari, ntre apariia, dezvoltarea i perfecionarea limbii i cea a societii existnd raporturi de intercondiionare, de interdependen. Funcia esenial a limbii ca instrument nota Andr Martinet e aceea de comunicare: romna, de pild, e nainte de toate unealta care permite vorbitorilor de limba romn s intre n legtur unii cu alii (Martinet, p. 26). n desfurarea ei, funcia de comunicare, funcie global a limbii, se ntemeiaz pe alte cteva funcii particulare, specializate, legate de factorii eseniali ai comunicrii verbale. n opinia lui Karl Bhler aceti factori sunt subiectul vorbitor, destinatarul i coninutul comunicrii. Fiecare determin o alt funcie a limbii: funcia expresiv, apelativ, respectiv reprezentativ. Modelul triadic propus de Bhler a fost reluat de lingvistul de origine rus Roman Jakobson, care identific i ali factori constitutivi ai actelor de vorbire. Transmitorul (emitorul) trimite un mesaj destinatarului (receptorului); pentru ca mesajul s-i ndeplineasc funcia e nevoie de un context la care se refer (de un referent), de un cod comun sau parial comun transmitorului i destinatarului i de un contact, o conduct material sau o legtur psihologic ntre cei doi.
44

Fiecare dintre aceti factori, dispui conform schemei context mesaj transmitor contact cod determin o alt funcie a limbii: referenial poetic emotiv fatic metalingvistic Funciile identificate de Bhler se regsesc, sub denumiri noi, n studiul lui Roman Jakobson: funciei expresive i corespunde funcia emotiv, celei apelative funcia conativ, funciei reprezentative cea referenial. Apar, n plus, funciile fatic, metalingvistic i poetic. Ne vom opri, pe rnd, la fiecare dintre ele.
FUNCIA EMOTIV

destinatar

conativ

Funcia emotiv (creia i corespunde l i m b a j u l a f e c t i v la Joseph Vendryes sau, la Bhler, f u n c i a e x p r e s i v ) e orientat ctre emitor care, dincolo de mesajul propriu-zis transmite i informaii despre el nsui: sex, vrst, atitudinea fa de cele spuse, starea afectiv n care se afl, temperament etc. Mrcile acestei funcii se ntlnesc att la nivel fonetic (intonaie, accent, tempo-ul vorbirii, lungirea sau eliminarea unor sunete), ct i la nivel sintactic, morfologic sau lexical. Vorbind despre limbajul afectiv, Vendryes sublinia c acesta este prin excelen stilistic i sintactic. El remarca rolul deosebit de important ce revine, pe de o parte, alegerii cuvintelor, iar pe de alta, aezrii, ordinii lor. Dei ordinea cuvintelor n limb e relativ fix, afectivitatea i poate face simit prezena n structura frazei: Uneori zvrlim un cuvnt, un membru al frazei n fruntea acesteia, pentru a-l relua apoi cu ajutorul unui element morfologic, particul ori pronume; alteori l aruncm la sfrit, izolat de context, pentru a-l anuna de mai
45

nainte prin anticipaie n corpul frazei, alteori, n sfrit, rupem brusc legtura frazei, din care jumtatea a doua o ndrumm dup un nou plan, fr nici un raport cu cea dinti. Aceste proceduri deosebite, curente n limbajul vorbit, au fost deseori mprumutate de limbajul scris, cnd a fost vorba de a crea ntr-adevr (Vendryes, apud Drganu, p. 206). n limbajul afectiv ordinea ideilor este alta dect n limbajul logic. Ea este dictat nu de regulile gramaticii, ci de importana pe care le-o acord subiectul vorbitor ori pe care acesta vrea s i-o sugereze interlocutorului su. i categoriile gramaticale sunt exprimate uneori afirm Vendryes prin mijloace ale limbajului afectiv: viitorul, la care raportm ndeplinirea gndurilor noastre e un timp subiectiv, iar trecutul, care nu mai depinde de noi, e un timp obiectiv. ntrebuinarea cu miestrie a verbului, a succesiunii timpurilor este remarcat de Tudor Vianu n lucrarea Istoria romnilor sub Mihai-vod Viteazul a lui Nicolae Blcescu. n descrierea btliei de la Clugreni de pild, scriitorul pune la prezentul istoric aciunile lui Mihai-vod i la trecut faptele turcilor. Prin acest joc al timpurilor verbale care trimite n planuri mai ndeprtate faptele otirii turceti i aduce n prim plan o descriere mai vie, mai direct a aciunilor lui Mihai, Blcescu i exprim admiraia i ataamentul fa de voievodul romn. Funcia emotiv se exercit i prin intermediul formelor pronominale cu valoare de dativ etic ntlnite mai cu seam n creaia popular, pentru a sublinia participarea sufleteasc a naratorului la cele povestite: Cnd fu aicea-n cap de sear / Pus june pe leu josu, / Cum mi-l pus, zgard-i pus / i mi-l leg-n curea neagr / i-l scobor jos la ar. Gradul superlativ poate fi redat i prin procedee ce in de limbajul afectiv: repetarea adjectivelor (o fat frumoas, frumoas), lungirea, repetarea vocalelor sau a consoanelor (o ap liiimpede, rrrece), repetarea substantivului la genitiv plural (voinicul voinicilor, floarea florilor), transformarea adjectivului ntr-un substantiv legat de altul prin prepoziia de: (o frumusee de fecior, o buntate de om), construcii exclamative echivalente cu superlativul: Frumoas e pajitea asta!, Ct de albastru e cerul!, adverbe cu valoare expresiv: nespus de blnd, teribil de mincinos, locuiuni adverbiale: din cale-afar de detept .a. Menionm, de asemenea, rolul deosebit al interjeciilor pseudopropoziii a cror for emotiv d savoare tuturor expresiilor noastre (Jakobson, p.51).
46

Funcia poate fi marcat i prin intermediul sufixelor: cele diminutivale nu numai micoreaz, dar pot fi i marc a afeciunii emitorului (bunicu), a ironiei acestuia (doctora, avocel); sufixele augmentative mresc, dar sunt i depreciative, ironice (muieroi, bieoi). Funcia emotiv se manifest, de fapt, n mai toate mesajele, nsi alegerea unor formule de construcie mai simple, mai impersonale, mai reci, constituind tot un semn al unei anumite atitudini a vorbitorului fa de cele transmise (Iordan, Robu, p.67). Fenomenele lingvistice sus-menionate sunt nsoite, n comunicarea oral, de gesturile, de mimica emitorului care, voluntar sau involuntar, contient sau nu, se comunic pe sine nsui, i manifest emoia, sentimentele, dispoziia afectiv.
FUNCIA CONATIV

Funcia conativ (l i m b a j a c t i v, n termenii lui Vendryes sau f u n c i a a p e l a t i v , la Bhler) este orientat ctre destinatar, urmrindu-se obinerea unui rezultat, efect, a unei reacii sau a unei replici a acestuia, de natur fie verbal, fie nonverbal. Deosebit de important, aceast funcie e posibil s fi fost prima dintre funciile limbii; oamenii au nceput, probabil, s vorbeasc, pentru a-i determina pe semenii lor s ntreprind anumite aciuni (s atace, s se retrag, s se adposteasc etc.). Limba primitiv s-a adresat deci, mai puin minii sau inimii, ca n zilele noastre, ct voinei (Herseni, p.117). Emitorul urmrete s-l implice pe receptor n actul comunicrii, s acioneze asupra lui, s-i determine un anumit comportament, o anumit atitudine, o anumit reacie. Face apel, n acest scop, la formele de imperativ ale verbelor (sau ale conjunctivului ori indicativului sinonime cu imperativul), la cele de vocativ ale substantivelor i pronumelor, la interjeciile de apel (hei!, bre!, mi!, b!, hai!, psst!, na!). Menionm aici i comenzile militare: La stnga!, nainte, mar!, Pe loc repaus!. Funcia se materializeaz n porunci, sfaturi, ndemnuri, rugmini, indicaii, interdicii, n enunurile incantative de urare, adulaie, peiorative etc. Deoarece exteriorizeaz emoiile, respectiv voina transmitorului, mesajele n care domin funciile emotiv i conativ nu pot fi supuse unui test al adevrului.
47

FUNCIA REFERENIAL

Funcia referenial (remarcat de Vendryes sub denumirea de l i m b a j i n t e l e c t u a l sau l o g i c, denumit de Bhler r e p r e z e n t a t i v ) este orientat ctre context (referent) i domin n textele tiinifice, n mare parte a mesajelor care comunic o informaie. Funciei i se mai spune i denominativ. Datele obinute prin senzaii i percepii de la realitatea nconjurtoare, prin abstractizare primesc nume, gndirea fixndu-le prin intermediul cuvintelor care denumesc diverse noiuni. Sunt incluse n aceast clas substantivele, adjectivele, numeralele, verbele (mai puin cele auxiliare i copulative), adverbele (cu excepia celor care nu au sens deplin i nu pot ndeplini funcii sintactice). Judecile i raionamentele capt i ele o form concret, material, cuvintele intrnd n alctuirea propoziiilor i a frazelor. Limba funcioneaz, astfel, ca instrument al gndirii, al materializrii, al exteriorizrii ideilor. Gndirea nsi nu poate fi conceput n afara limbii. Fr expresia sa n limb afirma Saussure gndirea noastr nu este dect o mas amorf i indistinct. Luat n sine, gndirea este ca o nebuloas n care nimic nu este delimitat n mod necesar. Nu exist idei prestabilite i nimic nu este distinct nainte de apariia limbii (Saussure, p.126). Funcia e numit uneori i cognitiv. Prin intermediul ei se realizeaz transmiterea de date, de informaii de la individ la individ, dar i, n timp, de la o generaie la alta, asigurndu-se, astfel, progresul cunoaterii. Mesajele n care domin aceast funcie pot fi supuse testului adevrului, putnd fi controlate prin raportare la realitatea obiectiv.
FUNCIA FATIC

Prin intermediul funciei fatice, orientate ctre contact, se stabilete, se verific i se menine comunicarea. Funcia se realizeaz prin formule care, aparent, nu comunic nimic: Ascultai?, Ce zici, nu-i aa?, Vezi?, M auzi? sau I-auzi!, Ia te uit!, neleg!, Nu mai spune!. Scopul lor este de a controla dac i cum funcioneaz canalul i circuitul, de a verifica, ntri i confirma atenia receptorului, de a comunica atitudinea fa de unele secvene ale mesajului. Specifice acestei funcii sunt i formulele prin care emitorul ia contact cu receptorul n vederea iniierii, declanrii unei comunicri verbale (formule de salut, interjecia alo!). Comunicarea poate debuta
48

ns i direct, uneori impunndu-se, chiar, contactul non-fatic: n cazurile de urgen, de pild, cnd cineva strig Srii!, Ajutor!. Funcia, comun i celorlalte vieuitoare, e prima funcie verbal pe care i-o nsuesc copiii mici: prin gnguritul lor, ei tind s comunice cu cei din jur, nainte de a putea trimite sau primi orice fel de comunicare ce cuprinde o informaie (Jakobson, p.53).
FUNCIA METALINGVISTIC

Funcia metalingvistic este centrat pe cod, pe limba n care se comunic, devenit referent, obiect al actului de comunicare. Cea mai clar expresie a funciei se ntlnete n lucrrile tiinifice care in de domeniul lingvisticii, n care sunt definite elemente ale codului verbal sau fenomene specifice punerii lui n micare. Funcia se manifest ns i n conversaia obinuit, prin explicarea, precizarea sensului unor cuvinte, al unor expresii existente n mesaj, fie n situaia n care unul dintre interlocutori vorbete ntr-o limb mai puin cunoscut partenerului su de dialog, fie cnd, dei sunt de aceeai etnie, emitorul i receptorul aparin unor graiuri, dialecte, uneori chiar generaii diferite. Destinatarul cere lmuriri n legtur cu ntrebuinarea unor termeni al cror neles nu i este cunoscut: Ce nseamn mildness?, Ce s neleg prin il a la tte prs du bonnet?, Cum adic beton?, Ce e corlata?, Ce-ai vrut s spui prin avea mn lung?. Pentru a preveni replici cum sunt cele de mai sus, emitorul i adreseaz receptorului ntrebri de tipul: nelegi ce spun? Alteori emitorul explic el nsui, de la nceput, sensul unui termen, al unei expresii care crede c-i este necunoscut colocutorului su, pentru a se asigura c mesajul este corect receptat: Dafinul aa i se spune pe la noi salcmului a nflorit deja; Das fnfte Rad am Wagen a cincea roat la car, n plus, de prisos, n-a fost niciodat. Operaiile metalingvistice sunt prezente n orice proces de nsuire a unei limbi, fie matern, fie strin.
FUNCIA POETIC

Funcia poetic, centrat asupra mesajului ca atare, e dominant, determinant n arta verbal. Pe emitor l intereseaz nu numai ceea ce transmite, informaia n sine, ci i modul n care mesajul este organizat, armonia lui estetic. E important ca mesajul s i plac, s-l sensibilizeze pe cel care-l ascult, s determine emoii artistice.
49

Pentru a stabili specificul artei poetice Roman Jakobson pornete de la cele dou moduri principale de aranjament folosite n actul lingvistic: selecia i combinarea. n comunicarea obinuit vorbitorul alege, pe baza principiului echivalenei, un cuvnt dintre altele, semantic nrudite i, n baza principiului contiguitii, l combin n lanul vorbirii cu alte cuvinte. De pild, pentru un enun cum este Prietenul merge n excursie, fiecare cuvnt e selectat de emitor dintre mai muli termeni sinonimi sau apropiai cu care, mai apoi, se combin: (1) prieten / amic / coleg etc.; (2) a merge / a se duce / a pleca etc.; (3) n excursie / drumeie / tabr etc. Poetul, n schimb, nu se limiteaz la alegerea, dintre mai multe sinonime a unui cuvnt, ci propune o serie de echivalene care trebuie descoperite de receptor. Cu ct aceste echivalene sunt mai originale, mai neateptate, se creeaz un efect poetic mai puternic. Funciunea poetic proiecteaz principiul echivalenei de pe axa seleciei, pe axa combinrii. Echivalena devine factorul constitutiv al secvenei (Jakobson, p.56). n ncercarea de a descoperi i nelege universul i pe el nsui, poetul combin ntr-un mod cu totul aparte cuvintele, conferindu-le funcii i semnificaii noi, nentlnite n vorbirea obinuit. Cu trud i migal el frmnt, cum zicea Arghezi, cuvintele mii de sptmni, le potrivete, le lefuiete i mldiaz, le articuleaz ntr-un fel propriu, lsndu-i pe ele efigia propriei personaliti. Semnificaia unui cuvnt n poezie nu depinde mecanic de nelesul din dicionar al acestuia. n dicionar cuvintele sunt neutre, incolore, inodore, lipsite de temperatur i suflet. Poetul le d via, le aprinde i nflcreaz, adevrata poezie fiind mai mult dect o comunicare, o transmitere de noiuni de la emitor la receptor; ea se constituie ntr-o adevrat mrturisire, n sens aproape religios, a sufletului celor dotai cu har care, cum frumos nota cineva, nti beau misterul care freamt n lucruri i n lume, iar apoi l toarn n poezie. Prin intermediul metaforelor i al altor figuri de stil (metonimia, sinecdoca), al ritmului, rimei, repetiiilor, al alternanelor, al contrastelor, se poate spune c locutorul elaboreaz un cod special, un sistem singular realizat ntr-un mesaj singular. Lucrul acesta nu trebuie neles n mod mecanic; n msura n care un mesaj are funcie poetic predominant, el constituie o construcie intenionat elaborat ca deviere, creat sau inventat, care adaug ceva la codul existent, este o operaie de stilizare specific, aducnd n mesaj montaje structurale neprevzute n nici unul dintre codurile preexistente (Iordan, Robu, p.68).
50

Dei dominant n poezie, funcia se manifest i n limbajul cotidian, n folosirea unor figuri de stil, n utilizarea unei anumite ordini a cuvintelor, a unui anumit ritm.
ALTE FUNCII ALE LIMBII

Numrul funciilor limbii, criteriile delimitrii lor, constituie o problem controversat a lingvisticii. Dac Bhler delimita cum am vzut mai devreme trei funcii ale limbii, iar Roman Jakobson ase, Andr Martinet vorbete despre patru asemenea funcii: o funcie central, de comunicare, de nelegere reciproc, o funcie de suport al gndirii, o alta de exprimare i o funcie estetic, ntreptruns cu funciile de comunicare i cea de expresie. n literatura de specialitate academicianul Ion Coteanu gsea vreo douzeci de funcii ale limbii i constata c, pe msur ce numrul funciilor identificate sporete, descrierea mecanismului i a efectelor lor se complic, i nu totdeauna cu folos (Coteanu, p.78). Dincolo de orice clasificri ns, funcia esenial a limbii rmne cea de comunicare, ei adugndu-i-se funciile identificate de Roman Jakobson anterior prezentate. n afara schemei Jakobson menioneaz o a aptea funcie a limbii, funcia magic, de incantaie. Aceasta se ntlnete n textele descntecelor, ale vrjilor, practicilor magice, n anumite superstiii cu origini n cultura primitiv. Referentul, o persoan a treia, absent sau inanimat devine receptor al mesajului conativ: Rsai, soare/ Frioare/, Nu peste crduri de oi, / Nici peste crduri de boi, / Ci peste ochiorii mei, / i peste statul meu, / i peste sfatul meu, / i peste mersul meu, / i peste viersul meu. / Cum i soarele de luminos i frumos, / Aa s fiu i eu sau Ap alb, pomiroas, / m spal, m f frumoas, / s li plac eu junilor / ca laptele pruncilor, / ca vinu boierilor, / s fiu ca sfntu Soare / cnd rsare, / ca i mrul plin de floare. Bazate pe credina n eficiena, n fora magic a cuvntului, descntecele, vrjile urmresc, de cele mai multe ori, ndeprtarea sau mblnzirea forelor malefice i atragerea spiritelor benefice. Tot aici menionm tab-ul lingvistic* interzicerea ntrebuinrii unor anumite cuvinte, cum ar fi, de pild, rostirea adevratului nume al vnatului, mbunarea unor animale periculoase, a unor spirite aductoare de
Termenul provine din polinezianul Tabu < ta sacru, sfinit + bu foarte. 51
*

nenorociri, prin conferirea de nume ct mai frumoase (a se vedea i subcapitolul Cauzele schimbrilor de sens). Ielele, de pild, n mitologia popular romneasc, un fel de spirite femeieti, frumoase i seductoare, dar i capricioase, rele i rzbuntoare, cu puteri nefaste asupra oamenilor pe care-i ademenesc n timp ce cnt i danseaz goale, cu prul despletit, n nopile cu lun, sunt numite uneori Zne sau Rusalii. Numele lor sunt ns mult mai numeroase, deoarece credina popular impune ca ele s nu fie chemate dup adevratul lor nume, ci cu un alt termen, convenional, care dup ce devine cunoscut tuturor trebuie abandonat i nlocuit. Astfel, Ielele apar i sub numele de Nemilostive, Drgaice, Nagode, Irodie, Dnse, Iude, Fetele lui Iuda, Vlve, Vntoase, Vnturi, Fetele Vntoaselor (ultimele datorate i credinei c ele ar strni vnturile, semn de multe ori al nenorocirilor spontane i inexplicabile) .a. Alteori, pentru ca puterea lor s nu fie covritoare, poporul le d nume frumoase, de laud ori de alint, spre a le ndupleca la bine. Printre acestea Milostive, Miestre, Domnie, Bune, Fete Frumoase, Frumuele, Fetele Cmpului, Fetele Codrului, Harnice, Sfinte Mari, oimane .a.*. Macedoromnii le numesc Albe, Dzne, Muate, cehii Jupnese de ap sau Zne, polonezii Dumnezeie. Tabu lingvistic l constituie, n unele comuniti tribale, chiar rostirea numelui efului de trib de ctre membrii acestuia sau a numelui soului de ctre soie. Rostirea acestor nume socotite sacre nu este ngduit, fiind considerat o form de atentat la autoritatea i prestigiul celor care le poart. Funcia profilactic are rolul de a proteja informaia transmis, cnd canalul conducta fizic pe care o parcurge mesajul e afectat de bruiaj, de diverse zgomote. Ea se manifest prin rostirea cu voce mai puternic a mesajului, prin silabisirea cuvintelor, prin transformri de natur fonetic, pentru ca informaia s se pstreze intact (cum ar fi rostirea, n convorbirile telefonice, a formei regionale epte n loc de apte, spre a evita confuzia cu ase). Funcia ludic a limbajului e vizibil n jocurile de cuvinte, n calambururi. Ea se exercit prin specularea cu efect umoristic a ambiguitii unui context, a similitudinii unor cuvinte sau grupuri de cuvinte cu sensuri diferite.
Tudor Pamfile, Mitologie romneasc, Ed. Grai i suflet Cultura naional, Bucureti, 2000, p. 191. 52
*

Numeroasele semnificaii ale cuvntului drept, de pild, antonim al mai multor termeni sunt speculate n jocul de vorbe Ce nu-i drept i nu-i pcat? Piciorul stng. Funcia e ntlnit att n limbajul cotidian, ct i n literatur. Iat, spre ilustrare, cteva versuri dintr-un volum relativ recent aprut, semnat Grete Tartler: Ce se vede galben, oare? / Ce s fie? Pui prin soare!/ Pui prin soare? Nu te cred! / Pui prinsoare? (Pariu) sau Ce-nseamn ham pe limba cinelui? / Ia s m-aez, s vd, pe limba lui, / i zise musca i-i fcu de cap / i-a neles c ham nseamn hap (Lingvistic)*.
MANIFESTAREA FUNCIILOR LIMBII

Vorbind despre funciile limbii, Roman Jakobson sublinia c e greu de gsit un mesaj verbal care s ndeplineasc o singur funcie. Diversitatea mesajelor nu rezid n monopolul uneia dintre aceste multiple funciuni, ci n ordinea ierarhic diferit a funciunilor. Structura verbal a unui mesaj depinde, n primul rnd, de funciunea predominant (Jakobson, p. 50). Astfel, ntr-o poezie liric domin funcia emotiv, ntr-un discurs politic sau ntr-o reclam comercial cea conativ, ntr-un text tiinific funcia referenial, ntr-un manual de gramatic funcia metalingvistic, funcia poetic se manifest mai cu seam n beletristic, funcia fatic se realizeaz ndeosebi n comunicarea oral, mai puin n cea scris. Funciile limbii nu se manifest izolat unele fa de altele. Pe lng funcia dominant ntr-un mesaj se manifest, concomitent, nc una sau cteva funcii. ntr-un text tiinific ce ine de domeniul lingvisticii, de pild, funcia metalingvistic se mpletete cu cea referenial (limba este, ea nsi, referent); ntr-un descntec funcia magic se mbin cu funcia conativ (Ieii i pierii / ca roua de soare, / ca stupu-n crare...), crora li se adaug, de multe ori, funcia poetic. n beletristic funciei poetice i se adaug cea emotiv (n cazul speciilor lirice), conativ (ntlnit n ode, imnuri), funcia referenial (n genul epic). Fiecare dintre funciile limbii se manifest, deci, ntr-un discurs, prin trsturi care i sunt proprii, ntre ele existnd ns numeroase interferene.
*

Grete Tartler, Rsul ocrotit de lege, Ed. Cartea Romneasc, Bucureti, 53

1999.

BIBLIOGRAFIE Ion Coja, Funciile limbii, n Tratat de lingvistic general, sub red. Al.Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucureti, 1972, p. 15-19. Ion Coteanu, Stilistica funcional a limbii romne. Stil, stilistic, limbaj, Ed. Academiei, Bucureti, 1973, p.68-79. Constantin Dominte, Funciunile i caracteristicile definitorii ale limbajului, n Lingvistic general, coord. Zamfira Mihail, Ed. Fundaiei Romnia de Mine, Bucureti, 2003, p. 83-103. Nicolae Drganu, Istoria sintaxei, Institutul de Lingvistic Romn, Bucureti, 1945, p.204-207. Traian Herseni, Funciile sociale ale limbii, n Sociologia limbii, Editura tiinific, Bucureti, 1975, p. 112-144. Iorgu Iordan, Vladimir Robu, Limba romn contemporan, Editura Didactic i Pedagogic, Bucureti, 1978, p. 66-69. Roman Jakobson, Funciile limbii, n Crestomaie de lingvistic general, ed. ngrijit de Ion Coteanu, Ed. Fundaiei Romnia de Mine, Bucureti, 1998, p.50-57. Andr Martinet, Elemente de lingvistic general, Ed. tiinific, Bucureti, 1970, p. 24-37. CHESTIONAR

1. Care sunt funciile limbajului n concepia lui Andr Martinet ? 2. Dar n concepia lui Roman Jakobson ? 3. Definii funcia emotiv i artai prin ce mijloace se exercit. 4. Pe care dintre factorii constitutivi ai actului de comunicare verbal se centreaz funcia conativ i prin ce mijloace se exercit ? 5. Dar funcia referenial ? 6. Care dintre funciile limbii apar, n plus, la Roman Jakobson, fa de cele delimitate de Karl Bhler ? 7. Definii aceste funcii i caracterizai-le. 8. Ce se nelege prin tabu lingvistic ? Exemplificai. 9. Menionai i caracterizai succint i alte funcii ale limbii. 10. Cum se manifest funciile limbii ?

54

DIHOTOMIILE* SAUSSURIENE

Lingvistica modern pornete de la concepia nou, revoluionar despre limb a lui Ferdinand de Saussure. Dac cineva trebuie numit fondator al lingvisticii moderne, acesta nu poate fi altul dect marele om de tiin elveian, Ferdinand de Saussure (...). Se pot distinge n prezent multe coli lingvistice, dar toate au fost influenate direct sau indirect (i n msuri diferite) de Cursul lui Saussure (Lyons, p.51). n acest Curs de lingvistic general aprut n 1916, este relevat caracterul de sistem al limbii i sunt stabilite cteva dihotomii (distincii conceptuale sau antinomii) devenite clasice, preluate de reprezentani ai colii sociologice, structuraliste, de lingviti de diverse orientri. Aceste dihotomii sunt: 1. limb-vorbire; 2. sincronie-diacronie; 3. sintagmatic-paradigmatic; 4. semnificat-semnificant; 5. form-substan; 6. lingvistic intern-lingvistic extern. Ne vom opri, n cele ce urmeaz, la modul n care Saussure prezint aceste distincii i vom meniona unele abordri ale lor n lingvistica postsaussurian.
LIMB-VORBIRE

Prima dintre dihotomiile prezentate de Saussure n Cursul de lingvistic general este limb-vorbire. Acestea reprezint dou aspecte fundamentale ale limbajului, conglomerat multiform i heteroclit ce ine, n egal msur, de domeniul individual i de cel social. Limba, cod format dintr-un sistem de semne, principalul instrument al comunicrii, reprezint aspectul social al limbajului,
Termenul provine din gr. dicho n dou, tome (tomein) a tia, a disocia. 55
*

elementul lui esenial. nsuirile limbii pot fi corect interpretate numai pornindu-se de la natura semiotic a elementelor ei. Instituie social de o factur aparte, limba i este exterioar, impus individului, care nu o poate crea sau modifica, ci i se supune numai. Alctuit dintr-un sistem lexical i unul gramatical existente virtual n contiina tuturor vorbitorilor unei colectiviti fr a fi, ns, complet la nici unul dintre ei , perfect numai vorbit de ntreaga mas, limba exist numai n virtutea unui fel de contract ncheiat ntre membrii comunitii. Ea este un produs nregistrat pasiv de ctre vorbitor, un ansamblu de convenii necesare, reprezentnd modelele dup care se realizeaz comunicarea. Limba e un sistem complex de semne cel mai important unde nu este esenial dect unirea dintre sens i imaginea acustic i unde cele dou pri ale semnului sunt n egal msur psihice (Saussure, p.40). Limbajul se intersecteaz ns cu diverse domenii: psihic, fizic, fiziologic, social. Fiind eterogen, multiform, el nu poate fi obiect de studiu al unei singure tiine lingvistica , ci i al psihologiei, fiziologiei, antropologiei etc. Limba, n schimb, este omogen. Ea e un tot n sine i un principiu de clasificare, un obiect de natur concret, un ntreg bine organizat, uor de delimitat de alte fapte umane. De ndat ce i dm primul loc ntre faptele de limbaj, introducem o ordine natural ntr-un ansamblu care nu se preteaz la nici o alt clasificare. Saussure a considerat c doar limba poate constitui datorit organizrii ei unitare obiectul de studiu al lingvisticii. Vorbirea reprezint aspectul individual, psiho-fiziologic al limbajului, actul prin care o persoan se servete de limb pentru a-i exprima ideile. Vorbirea este un act individual de voin i de inteligen, n care putem distinge: 1 combinaiile prin care subiectul vorbitor utilizeaz codul limbii pentru a-i exprima gndirea personal; 2 mecanismul psihofizic care i ngduie s exteriorizeze aceste combinaii (Saussure, p.40). Saussure exagereaz afirmnd c nu exist nimic colectiv n vorbire, c manifestrile ei sunt individuale i momentane. Or, individuale i momentane sunt ideile de exprimat care se transmit ns prin intermediul elementelor i regulilor limbii. Scopul vorbirii este social, iar materialele folosite de ea aparin ntregii comuniti lingvistice.
56

Prin separarea limbii de vorbire sunt separate aspectele social i individual, esenial i accesoriu, accidental ale limbajului. Dei opuse una alteia, limba i vorbirea sunt strns legate ntre ele i n permanent interaciune: vorbirea preced limba, e necesar pentru instituirea ei, i determin evoluia; limba, la rndul ei, e un instrument i un produs al vorbirii, fiind necesar pentru ca vorbirea s poat fi neleas. Caracterul primordial al limbii apare la o serie de lingviti postsaussurieni, muli dintre ei reprezentani ai unor coli structuraliste. n opinia lui Andr Martinet distincia saussurian limb-vorbire este util, ns poate duce la pericolul de a se crede c vorbirea are o organizare independent de limb, aa nct am putea, de pild, s concepem o lingvistic a vorbirii, pe lng lingvistica limbii. Vorbirea concretizeaz organizarea limbii; numai prin cercetarea vorbirii i a comportamentului pe care ea l determin la asculttori, putem ajunge la cunoaterea limbii (Martinet, p.46). n lingvistica transformaionalist din a doua jumtate a secolului al XX-lea dihotomia reapare sub forma c o m p e t e n p e r f o r m a n , primului concept corespunzndu-i, n mare, termenul saussurian de limb, iar celui de-al doilea termenul de vorbire. Prin c o m p e t e n se neleg regulile necesare pentru a vorbi corect o limb, iar prin p e r f o r m a n ntrebuinarea concret a limbii, transformarea, manifestarea competenei n acte concrete de vorbire. Pentru Otto Jespersen exist numai vorbirea, activitate individual, dar, n acelai timp, i deprindere social nscut n societate i determinat de ea. Limba reprezint o generalizare a vorbirii, pluralul acesteia. Dac Jespersen opune dihotomiei saussuriene un punct de vedere unitar, monist, la ali lingviti dihotomia se transform n trihotomie. Printre acetia, Eugeniu Coeriu, care propune distincia sistem-norm-vorbire. Sistemul (limba) e definit ca un ansamblu de opoziii funcionale, norma sistem de realizri obligatorii acceptate de vorbitori e un element intermediar ntre limb i vorbire ce cuprinde vorbirea minus variantele individuale i ocazionale ale acesteia, iar vorbirea e realizarea concret-individual a normei, actele lingvistice concrete, nregistrate n momentul producerii lor. Dac Saussure lua limba drept msur a tuturor celorlalte manifestri de limbaj, Coeriu propune s lum vorbirea ca msur i limba nsi s-o gsim n vorbire (Lingvistica integral, p.14).
57

SINCRONIE-DIACRONIE

O alt distincie ridicat la rangul de principiu general, fundamental de ctre Saussure este cea care delimiteaz lingvistica descriptiv, static, de lingvistica istoric, evolutiv. Pe prima dintre ele, menit s studieze raporturile logice i psihologice care leag termenii ntr-un sistem, renumitul genevez o numea lingvistic sincronic, iar pe cea de-a doua, care cerceteaz termenii ce se substituie, fr a forma ns un sistem lingvistic diacronic. Termenul sincronie desemneaz o stare a limbii, iar diacronia o faz de evoluie. Faptele de limb sincronice sunt situate de Saussure pe axa orizontal, a C simultaneitii sau a concomitenei, a coexistenei, unde orice intervenie a timpului este exclus. Faptele de limb diacronice sunt aezate pe axa vertical a succesiunii, pe care nu putem lua n A B consideraie, n acelai timp, dect un lucru, dar pe care sunt situate toate lucrurile de pe axa simultaneitii, cu schimbrile lor. Axa simultaneitii cuprinde elemente lingvistice care coexist, D iar cea a succesiunii surprinde dezvoltarea, n timp, a acestor elemente. Dac nainte de Saussure lingvistica modern era preocupat ndeosebi de cercetrile diacronice, de reconstituirea, prin comparare, a istoriei limbilor, nvatul genevez aaz n prim-plan studiul sincronic al limbii, singurul care permite relevarea caracterului de sistem al acesteia. Opoziia dintre sincronie i diacronie este categoric: fenomenul sincronic nu are nimic comun cu cel diacronic; unul este un raport ntre elementele simultane, cellalt este substituirea, n timp, a unui element printr-un altul, n fapt un eveniment (Saussure, p.106). Plasat n perspectiv diacronic, lingvistul vede nu limba, ci elementele care o modific. La fel cum ntr-o partid de ah important este starea jocului ntr-un anumit moment i nu succesiunea mutrilor anterioare acesteia, tot aa, ntr-o limb important este starea i nu evoluia, evenimentele care au precedat-o. Succesiunea faptelor de limb este inexistent pentru subiecii vorbitori, aflai n faa unei stri. Lingvistul care dorete s neleag acea stare trebuie s fac abstracie de ceea ce a
58

produs-o, s ignore diacronia, cci n contiina subiecilor vorbitori nu se poate intra dect suprimnd trecutul (Saussure, p.99). Opiniile lui Saussure cu privire la sincronie i diacronie au fost continuate i dezvoltate de reprezentani ai colii geneveze (Ch. Bally), ai structuralismului danez, ai celui englez, interesai nu de istoria limbii, ci de a-i descrie sistemul ntr-un anumit moment (de regul, n prezent). Ali lingviti au sesizat unele exagerri ale lui Saussure. Otto Jespersen, de pild, nc din 1916 (anul apariiei Cursului de lingvistic general) se pronuna mpotriva conceptului de stare a limbii, subliniind c n permanen limba este n curs de schimbare, de transformare. Opunnd categoric sincronia diacroniei, Saussure afirm c modificrile din limb sunt izolate i nu pot afecta sistemul n ansamblu, ci ating numai unele elemente ale lui. Lingvistul genevez exagereaz i cnd afirm c aspectul sincronic primeaz asupra celui diacronic, deoarece pentru masa de vorbitori el este adevrata i singura realitate (p.105) i c numai din perspectiva vorbitorilor poate fi identificat sistemul limbii, plasarea n perspectiv istoric mpiedicnd accesul la cunoaterea acestuia. Criticnd istorismul excesiv al reprezentanilor colii neogramatice, Saussure cade n cealalt extrem, afirmnd c sistemul de relaii al unei limbi este static, imuabil i nu poate fi studiat diacronic. coala structuralist de la Praga, A. Meillet .a. au extins noiunea de sistem i la istoria limbii i au artat c sincronia i diacronia nu se opun categoric, ci se afl ntr-o relaie dialectic. Limba afirma Eugeniu Coeriu ntr-o formulare memorabil funcioneaz sincronic i se constituie diacronic. Dar aceti termeni nu sunt antinomici, nici contradictorii, pentru c facerea se realizeaz n vederea funcionrii (Coeriu, Sincronie, diacronie i istorie, p. 238).
SINTAGMATIC-PARADIGMATIC (RAPORTURI SINTAGMATICE-RAPORTURI ASOCIATIVE)

Referindu-se la modul de funcionare a limbii, Saussure distingea dou tipuri de raporturi ntre unitile lingvistice: raporturi sintagmatice i raporturi asociative. Acestea corespund cu dou forme ale activitii noastre mentale, amndou indispensabile vieii limbii. n vorbire cuvintele contracteaz ntre ele raporturi care se bazeaz pe caracterul linear al limbii, ce exclude posibilitatea rostirii, n acelai timp, a dou elemente. n lanul vorbirii elementele lingvistice se
59

aeaz unele dup altele i se combin pe o imaginar ax orizontal numit de Roman Jakobson a x a c o m b i n a i i l o r formnd sintagme. O sintagm se compune din dou sau mai multe uniti consecutive: ex. prefixul re- i verbul lire n derivatul relire, substantivul la vie i adjectivul humaine n sintagma la vie humaine, propoziiile Sil fait beau temps i nous sortirons n fraza Sil fait beau temps, nous sortirons. Saussure numete astfel de raporturi raporturi sintagmatice i face meniunea c ntr-o sintagm un termen nu-i dobndete valoarea dect pentru c el este opus celui ce-l preced sau celuia ce-l urmeaz, sau amndurora (Saussure, p.135). n afara vorbirii cuvintele care au ceva n comun se asociaz n memorie, formnd grupuri pe criterii foarte variate: de pild omenie se poate asocia cu numeroase alte derivate ale cuvntului om (omenire, neom, supraom, omenos, omenete, a omeni .a.) ca membre ale aceleiai familii lexicale; se poate asocia cu prietenie, venicie, mgrie, vitejie, domnie, prostie ca substantive derivate cu acelai sufix; cu ospitalitate, buntate, cinste, generozitate ca aparinnd aceleiai sfere semantice; pe criterii fonetice (rim) poate intra n relaie cu farfurie, glgie, draperie, farmacie .a. Un cuvnt oarecare, nota Saussure, poate totdeauna evoca ceea ce este susceptibil s-i fie asociat ntr-un fel sau altul. n timp ce o sintagm antreneaz imediat ideea unei ordini succesive i a unui numr determinat de elemente, termenii unei familii asociative nu se prezint nici n numr definit i nici ntr-o ordine determinat (Saussure, p.137-138). Asemenea raporturi al cror sediu se afl n creier sunt numite de ctre Saussure raporturi asociative (n limbaj postsaussurian raporturi paradigmatice). Axa raporturilor asociative e reprezentat ca o linie vertical pe care, n serii sau asociaii mentale, se aeaz toate elementele i unitile unui sistem lingvistic din care selectm ns anumii termeni pentru a ne construi enunurile (sintagmele). Roman Jakobson o numete, de aceea, a x a s e l e c i e i. Deoarece se bazeaz pe cel puin doi termeni efectiv prezeni, relaia sintagmatic este totdeauna in praesentia. De cealalt parte, relaia asociativ unete termeni in absentia. Louis Hjelmslev a preluat ideea saussurian a celor dou axe, considernd-o pe prima ax a unor raporturi de tip copulativ i... i... (elementele i unitile limbii coexist pe ea), iar pe cea de-a doua ax a raporturilor de tip disjunctiv sau... sau... (prezent este un membru al paradigmei sau altul).
60

SEMNIFICAT-SEMNIFICANT

n capitolul consacrat Naturii semnului lingvistic Saussure condamn iniial o mai veche tez (acceptat ns de unii dintre contemporanii si) potrivit creia limba ar fi o nomenclatur, adic o simpl list de nume ce corespund lucrurilor. Dac teza ar fi adevrat, ideile ar putea pre-exista cuvintelor. Ideile i conceptele nu pot s existe ns (deci nici s pre-existe) n afara relaiei cu semnele care le exprim: ... fr ajutorul semnelor am fi incapabili s distingem dou idei n mod clar i constant. Luat n sine, gndirea este ca o nebuloas n care nimic nu este delimitat n mod necesar. Nu exist idei prestabilite i nimic nu e distinct nainte de apariia limbii (Saussure, p.126). Teza nu ne spune dac numele e de natur sonor sau psihic i ne las s presupunem c unirea unui obiect cu un nume ar fi o operaie foarte simpl, ceea ce opineaz Saussure nu este adevrat. Semnul lingvistic entitate psihic cu dou fee nu unete un lucru cu un cuvnt, ci un concept cu o imagine acustic. Aceasta din urm nu e sunetul material, ci o amprent psihic a acestui sunet, reprezentarea pe care ne-o d mrturia simurilor noastre. n locul termenului concept Saussure propune termenul semnificat (cel care este semnificat), iar n loc de imagine acustic semnificant (cel care semnific). Unitatea dintre semnificant i semnificat definete semnul lingvistic. Opoziia saussurian a fost extins de L. Hjelmslev de la semnul lingvistic la sistemul lingvistic n ansamblu: limba are dou planuri, un plan al expresiei (ce corespunde semnificantului) i un plan al coninutului (corespunztor semnificatului).
FORM-SUBSTAN

Diferenele de structur semantic dintre limbi au fost explicate de ctre Saussure i discipolii si n termenii distinciei form-substan. Substana sensului (sau substana planului coninutului) se refer la ideile, emoiile, sentimentele de exprimat care sunt aceleai pentru toi indivizii, indiferent de limba pe care o vorbesc. Forma vocabularului (sau forma planului coninutului) vizeaz organizarea lingvistic diferit a aceleiai substane comune, n diverse limbi.
61

n procesul de nvare a limbilor strine s-a constatat, de mai multe ori, c unele limbi fac distincii inexistente n altele, c aceeai substan a coninutului capt forme variate de la o limb la alta. Astfel, dac n limba francez se face distincia ntre pied i jambe, n spaniol ntre pie i pierna, n romn se utilizeaz un singur cuvnt, picior, att pentru ntregul membru inferior, ct i pentru partea de la glezn n jos. n englez partea piciorului de la glezn n jos este denumit foot, iar restul piciorului leg; n rus termenului romnesc gt i corespund dou cuvinte: eja i gorlo, primul desemnnd partea exterioar, cel de-al doilea partea interioar a gtului. Spaniola are cuvinte diferite pentru a denumi urechea intern odo i urechea extern oreja. Alteori unui singur termen dintr-o alt limb i corespund n romn dou sau mai multe cuvinte. Astfel, substantivul zjat din rus are, n romn, semnificaia ginere, dar i pe cea de cumnat, aceasta din urm folosit ns numai pentru a-l desemna pe soul surorii sau al cumnatei. Cuvntul cumnat poate fi tradus n rus ns i prin alte trei cuvinte, fiecare dintre ele cu o alt semnificaie: urin fratele soiei, dever fratele soului i svojak soul surorii soiei. n rus nu exist, deci, un cuvnt cu semnificaia romnescului cumnat. Multe limbi fac distincia inexistent n romn ntre nepoii de bunici masculin englez grandson, spaniol nieto, rus vnuk i nepoii de frate sau de sor englez nephew, spaniol sobrino, rus plemjannik. Limbile au propriile structuri semantice. Dac sensurile dintr-o limb sunt n perfect coresponden cu cele dintr-o alt limb se spune c idiomurile sunt izomorfe semantic (au structur identic). Raportul dintre substan i form se reflect i n procesul de comunicare, n cadrul propoziiilor, al frazelor. De multe ori constatm c acelai coninut e altfel organizat n dou limbi diferite. Compararea a dou enunuri din romn i francez limbi nrudite evideniaz de multe ori deosebiri ce in de domeniul formei, neleas ca mod de organizare a coninutului. Substana coninutului este identic n rom. Nu tiu unde mi voi petrece vacana i n fr. Je ne sais pas o je passerai mes vacances. Aceeai comunicare este altfel organizat ns n fiecare dintre limbi. Remarcm n primul rnd prezena obligatorie n francez a subiectului exprimat prin pronumele personal je att n propoziia principal, ct i n subordonat; n romn pronumele eu poate fi ntrebuinat facultativ numai n prima dintre propoziii: Eu nu tiu... . Forma negativ a verbului este redat, n romn, printr-o singur negaie, iar n francez printr-o negaie dubl: ne sais pas. Forma de
62

viitor al celui de-al doilea verb-predicat din romn este construit cu ajutorul auxiliarului a vrea plus infinitivul prezent al verbului de conjugat, iar n francez forma corespunztoare este obinut prin adugarea la forma de infinitiv a verbului passer a desinenei -ai. Substantivul-complement direct din limba romn este utilizat la singular, iar cel din francez prezint o form de plural. Remarcm, de asemenea, n francez prezena adjectivului pronominal posesiv mes, plasat naintea substantivului. Valoarea posesiv este redat, n romn, de pronumele n dativ mi. Ca i planul coninutului, planul expresiei prezint i el dou aspecte: forma expresiei i substana expresiei. Substana expresiei este reprezentat de materia sonor, de sunete, iar forma expresiei de foneme. Dac n dou limbi se poate constata existena unor fenomene comune de substan, organizarea formal a acestora poate fi diferit. De pild i n romn i n englez se ntlnesc consoane nazale dentale (ca rom. [n] din band sau engl. [n] din sundries [sndriz] fleacuri, diverse), dar i consoane nazale velare (ca [] din rom. ating sau engl. reading [ri:di] citire, lectur, cultur). Proprietile care disting sunetul [n] de sunetul [] n romn sunt nerelevante, cci indiferent dac rostim cu [n] sau cu [] cuvintele band sau ating, sensul perceput este acelai. Asemenea sunete care difer ntre ele numai prin proprieti nedistinctive sunt variante ale aceluiai fonem ([n] i [] sunt, deci, variante ale fonemului n, care reprezint o ntreag clas de sunete). n limba englez ns rostirea dental a lui n n thin [in] ne trimite la semnificaia subire, slab, iar rostirea cu n velar n cuvntul thing [i] la lucru, obiect. Sunetele [n] i [], ndeplinind funcii distinctive, sunt uniti de expresie non-echivalente. Ele nu mai reprezint aici variante ale aceluiai fonem, ci dou foneme diferite. Aceeai substan a expresiei este, deci, organizat formal diferit n limbile comparate: fonemul /n/ n romn i dou foneme distincte, /n/ i // n englez. Limba englez face, de asemenea, distincia ntre vocala anterioar de deschidere medie [e] i vocala anterioar deschis []: formele man [mn] i men [men] difereniaz singularul i pluralul substantivului om. n limba romn ns gradul de deschidere al vocalei anterioare nu funcioneaz ca trstur care s disting ntre ele semne lingvistice sau valori morfologice diferite ale acestora.
63

LINGVISTIC INTERNLINGVISTIC EXTERN

Distincia lingvistic internlingvistic extern (elemente interneelemente externe ale limbii) e realizat de Saussure cu intenia de a delimita ct mai exact obiectul de studiu al lingvisticii, de a-i stabili locul printre celelalte tiine. Lingvistica trebuie s studieze limba n sine i pentru sine, ca sistem de semne care nu cunoate dect propria sa ordine. Relevarea caracterului de sistem al limbii i a mecanismului ei de funcionare in de lingvistica intern. Lingvisticii externe i revine sarcina de a studia relaiile dintre limb i celelalte fenomene sociale i transformrile suferite de limb ca urmare a acestor legturi. n opinia lui Saussure relaiile dintre limb i etnologie, dintre istoria unei limbi i dezvoltarea culturii i civilizaiei, dintre limb i istoria politic (influena cuceririlor, rolul politicii lingvistice a statelor, contactul ntre limbi), raporturile limbii cu diferite instituii (coal, biseric, administraie, justiie, armat .a.), extinderea geografic i fracionarea dialectal in, toate, de lingvistica extern. Dei interesante, toate aceste date nu sunt indispensabile unui lingvist. Considerm c studiul fenomenelor lingvistice externe este foarte fructuos; dar este greit s spunem c fr ele nu putem cunoate organismul lingvistic interior (Saussure, p.46). Dihotomia lingvistic internlingvistic extern e ilustrat de Saussure printr-o inspirat i celebr comparaie a limbii cu jocul de ah. Istoria ahului, faptul c acesta a trecut din Persia n Europa sau materialul din care sunt fcute piesele sunt elemente externe care nu influeneaz, nicicum, regulile jocului. Dac se mrete ns ori se micoreaz numrul pieselor, dac o regul e nclcat, eliminat, desfurarea jocului este afectat. Tot ceea ce ine de sistem sau reguli, tot ceea ce schimb mai mult sau mai puin sistemul este de natur intern. Lingvistica deci, trebuie s urmreasc elementele interne ale limbii, faptele ce afecteaz sistemul i mecanismul lui de funcionare. Fr a nega importana lingvisticii externe, Saussure o neglijeaz, insistnd numai pe cercetarea sistemului n sine. Or, cercetarea limbii ca sistem semiotic nu poate fi total separat de cercetarea ei ca fenomen social. Aceast exagerare a lui Saussure a fost continuat de o parte a discipolilor si. Printre ei, N.S. Trubekoi, unul dintre ntemeietorii
64

Cercului Lingvistic de la Praga, Louis Hjelmslev, fondatorul unei noi teorii a limbii glossematica. Ali lingviti, dimpotriv, s-au ndreptat ndeosebi ctre ceea ce Saussure numea lingvistic extern. Amintim aici numele lui Edward Sapir, cunoscut cercettor al limbilor indienilor din America, ntemeietor al etnolingvisticii. Cele dou modaliti de abordare a limbii se completeaz ns una pe cealalt, limba fiind un sistem de semne aflat, cum nota E. Coeriu, ntr-o complex reea de relaii cu fapte i tradiii de natur extralingvistic (Introducere n lingvistic, p. 58).
BIBLIOGRAFIE Nadia Anghelescu, Limb i vorbire, n Tratat de lingvistic general, Ed. Academiei, Bucureti, 1971, p.202-208. Eugeniu Coeriu, Sincronie, diacronie i istorie, Ed. Enciclopedic, Bucureti, 1977. Eugeniu Coeriu, Introducere n lingvistic, Ed. Echinox, Cluj-Napoca, 1995, p.17-22, 28-29, 55-73. Constantin Dominte, Dihotomii (distincii) conceptuale, n Lingvistic general, coord. Zamfira Mihail, Ed. Fundaiei Romnia de Mine, Bucureti, 2003, p.104-130. Alexandru Graur, Lucia Wald, Scurt istorie a lingvisticii, Ed. Didactic i Pedagogic, Bucureti, 1977, p.166-179, 196-198, 206-208, 252-253. Emil Ionescu, Manual de lingvistic general, Ed. ALL, Bucureti, 1992, p.66-73, 78-81, 83-87. Lingvistica integral. Interviu cu Eugeniu Coeriu realizat de Nicolae Saramandu, Ed. Fundaiei Culturale Romne, Bucureti, 1996. John Lyons, Introducere n lingvistica teoretic, Ed. tiinific, Bucureti, 1995, p.51-67, 69, 70-98, 476-487. G. Mihil, Raportul dintre sincronie i diacronie, n Tratat de lingvistic general, p.349-366. Georges Mounin, Istoria lingvisticii, Ed. Paideia, Bucureti, 1999, p.178-180, 239-243, 250-251, 288-291. Teodora Popa-Tomescu, Sistem i structur, n Tratat de lingvistic general, p.202-208. Ferdinand de Saussure, Curs de lingvistic general, Ed. Polirom, Iai, 1998, p.35-47, 85-89, 97-113, 126-127, 135-138. Emanuel Vasiliu, Introducere n teoria limbii, Ed. Academiei, Bucureti, 1992, p.9-12, 22-24, 49-55, 96-99. 65

CHESTIONAR 1. Ce nelegea Ferdinand de Saussure prin limb i prin vorbire? 2. Care este, n opinia nvatului genevez, obiectul de studiu al lingvisticii (limbajul/limba/vorbirea)? Cum i argumenteaz Saussure alegerea? 3. Artai n ce const utilitatea distinciei sincronie-diacronie. 4. Cum interpretai afirmaia lui Eugeniu Coeriu: Limba funcioneaz sincronic i se constituie diacronic? 5. Ce se nelege prin raporturi sintagmatice? Exemplificai. 6. Dar prin raporturi asociative? Exemplificai. 7. Comentai, succint, caracterul bilateral al semnului lingvistic. 8. Exemplificai cum aceeai substan a coninutului poate cpta forme diferite n limbi diferite. 9. Ce se nelege prin forma i substana expresiei? 10. Ce nelegea Saussure prin elemente de lingvistic intern i prin elemente de lingvistic extern?

66

SEMNUL LINGVISTIC

SCURT ISTORIC AL SEMIOTICII

Semnul (lat. signum indice, marc distinctiv) este un element concret ce ine locul (n mentalitatea unui individ sau a unei colectiviti umane) unui obiect i care simbolizeaz, amintete, comunic ceva. Culoarea roie i cea verde a semaforului sunt semne care ne opresc sau ne permit trecerea, o verighet e un semn al logodnei sau al cstoriei, semnul exprim apartenena la o mulime, nodul de la batist ne amintete c trebuie s facem ceva ce ne-am propus. Interpretarea cuvintelor ca semne a fost dezbtut pe larg n Cursul de lingvistic general al lui Ferdinand de Saussure. Cunoscutul lingvist elveian propunea chiar constituirea unei tiine generale a semnelor semiologia care s cuprind i lingvistica. Spre deosebire de alte sisteme semiotice, limba este accesibil tuturor vorbitorilor, ea reprezentnd mijlocul universal de exprimare i transmitere a ideilor i sentimentelor (Vraciu, p.62). Semnele folosite n domeniul matematicii, al fizicii sau chimiei sunt noiuni abstracte, logice, reci, impersonale, incapabile s emoioneze, s transmit sentimente; muzica, dansul, pictura redau emoii, sentimente, fr a le putea numi, limbajul lor nefiind, uneori, la ndemna tuturor, ci numai a celor iniiai n domeniul respectiv. Strns legat de gndire, profund implicat n viaa societii, limba reprezint cel mai important sistem de semne. Independent de Saussure, dar contemporan cu el, filosoful american Charles Sanders Peirce se gndea, de asemenea, la constituirea unei teorii generale a semnelor de diferite tipuri semiotica (engl. semiotics). Fr a se fi ocupat n mod special de semnele lingvistice, Peirce propunea o minuioas clasificare a semnelor extralingvistice, reductibil la trei mari clase: 1) indicii (singular: indiciu), fenomene naturale crora societatea le d interpretare ca semne (de ex.: fremtarea frunzelor unui arbore semn c bate vntul); 2) iconuri (singular: icon), semne instituite de oameni, printr-o similitudine structural cu obiectele reprezentate prin astfel de semne (de ex.: o hart n raport cu teritoriul cartografiat); 3) simboluri, semne de asemenea instituite de oameni, dar fr o legtur de
67

determinare a acestora prin obiectele reprezentate de ele (de ex.: o stem sau un drapel n raport cu un stat). Dac am raporta cuvintele, ca semne verbale complexe, la aceast clasificare, ar trebui s ncadrm cuvintele noionale printre simboluri, numai interjeciilor concedndu-le un oarecare caracter indicial, i onomatopeelor un oarecare caracter iconic. Saussure clasifica totalitatea semnelor posibile n numai dou clase de semne: 1) simboluri, n cazul crora el vedea un rudiment de legtur natural cu obiectul simbolizat (de ex.: balana ca simbol al justiiei), 2) semne propriu-zise, fr legtur de determinare ntre acestea i ceea ce ele semnific, aici ncadrndu-se cuvintele ca semne. Dup cum se constat, Peirce i Saussure aveau puncte de vedere diametral opuse n privina simbolurilor. n prima jumtate a secolului al XX-lea, semioticienii au reprezentat semioza (actul de semnificare) sub forma unui triunghi devenit celebru, cunoscut ca triunghiul semiotic ce reprezint, reduse la o schem foarte elementar, raporturile, mult dezbtute odinioar, dintre realitate (referent) gndire (concept) limb (simbol fonic): concept

simbol

referent

Anticiparea ndeprtat a acestui triunghi o gsim la Sf. Augustin (Aurelius Augustinus, secolul al IV-lea, d.Hr.), care n lucrarea De dialectica arat c un cuvnt (lat. uerbum) este alctuit din dictio (aproximativ: complex sonor) i din dicibile (aproximativ: concept), formnd un ansamblu ca denumire a unui res (lucru, adic referentul semioticienilor moderni). Simbolul (sau, n termeni saussurieni, semnul) nu este legat direct de referent, ci prin intermediul conceptului, al gndirii, al faptului de contiin. Tocmai acest fapt este reprezentat n triunghiul semiotic prin linia ntrerupt, de la baza triunghiului, ntre simbol i referent, respectiv prin linia continu, dei frnt, care merge de la referent la concept i de la acesta la simbol. Este o relaie care, n scolastica medieval, interesat i ea de semnele verbale, era sintetizat n expresia latineasc vox significat res mediantibus
68

conceptibus (vocea complexul sonor semnific lucrurile prin mijlocirea conceptelor). Unul dintre teoreticienii semioticii moderne, filosoful american Charles Morris, mprea domeniul de ansamblu al semioticii generale, ca tiin a semnelor, n trei subdiviziuni: 1) sintaxa (domeniul relaiilor dintre semne i semne); 2) semantica (domeniul relaiilor dintre semne i refereni); 3) pragmatica (domeniul relaiei dintre semne i cei care le folosesc).
ACCEPIILE SEMNULUI LINGVISTIC

Accepia unilateral (monoplan). Semnul se reduce n accepia curent la complexul sonor prin care se reflect noiunea: grupul de sunete ce alctuiete cuvntul copac, constituie un semn al nelesului de copac. Cuvintele sunt semne, n aceast accepie, numai prin latura lor de expresie, nu i prin nelesul pe care-l au. Accepia bilateral (biplan). Semnul lingvistic este o entitate psihic cu dou fee, o combinare ntre concept i imaginea acustic (Saussure, p.86). Latura de neles, conceptul, este numit de Saussure signifi (semnificat), iar latura acustic signifiant (semnificant). Semnul este reprezentat de reunirea acestor dou laturi: cuvntul copac are, deci, o latur de expresie reprezentat de complexul sonor copac i una de coninut plant peren lemnoas, format din rdcin, tulpin i o coroan ramificat. Accepia relaional se refer numai la relaia dintre semnificant i semnificat i se ntlnete la cei ce utilizeaz, n cercetarea limbii, procedee logice sau matematice. Notnd semnificantul cu x, semnificatul cu y, relaia dintre ele cu R, un semn se poate reda prin formula xRy x este n relaie cu y. Promotorii acestei accepii formale de interpretare a naturii semnului fac abstracie de laturile acestuia, interpretndu-l numai ca o coresponden ntre expresie i coninut. Trebuie s observm c primele dou accepii reprezint, totodat, dou ipostaze, distincte, dar complementare, ale semnului lingvistic (sau verbal): n prima ipostaz, semnul se manifest ca semnal, n vorbire, iar n cea de-a doua ca semn propriu-zis, ca unitate lingvistic aparinnd limbii (adic sistemului, din concepia saussurian). Cea mai mic unitate lingvistic dotat cu caracter de semn, n accepia din urm, este nu cuvntul, ci morfemul.
69

CARACTERISTICILE SEMNULUI LINGVISTIC CARACTERUL ARBITRAR AL SEMNULUI LINGVISTIC

Istoria opiniilor referitoare la limbajul uman consemneaz preri diferite despre existena sau inexistena unei legturi ntre complexul sonor i conceptul pe care acesta l reprezint. Problema a fost larg dezbtut de gnditorii greci reprezentani ai teoriei physei, adepi ai existenei unei legturi naturale ntre cuvnt i obiectul la care acesta se refer (Platon, de pild, nclina ctre aceast concepie) sau ai teoriei thesei (Democrit, Aristotel), care neag o astfel de legtur. Mult mai trziu, ctre sfritul primului mileniu, aceeai disput se ducea ntre colile eline reprezentate de anomaliti (care afirmau c exist o legtur natural cuvnt-obiect) i analogiti (care infirmau o asemenea legtur). Argumente puternice i numeroase vin, n lingvistica actual, s pledeze n favoarea celei de-a doua orientri: nimic din coninutul noiunii nu impune ca ea s fie exprimat printr-un anumit complex sonor i nu prin altul. Ideea era limpede formulat de Saussure: Legtura ce unete semnificantul de semnificat este arbitrar sau, pentru c nelegem prin semn ntregul ce rezult din asocierea unui semnificant cu un semnificat, putem spune, mai simplu, c semnul lingvistic este arbitrar (Saussure, p.87). Ideea de soeur, exemplifica Saussure, nu este prin nici un raport interior legat de grupul de sunete s--r, ce-i servete drept semnificant; orice alt grup de sunete ar putea avea aceeai semnificaie. Nu exist, deci, o legtur natural ntre secvena de sunete ce denumete un obiect i obiectul respectiv, nu exist o determinare de tip cauzal ntre coninut i expresie (i nici invers). Cel mai bun argument invocat n acest sens este faptul c acelai obiect este altfel denumit n limbi diferite (uneori chiar nrudite): rom. ap, fr. eau, rus. voda, engl. water; rom. cas, fr. maison, rus. dom, engl. house. Dac ntre obiect i semn ar fi o legtur natural, ar trebui ca aceluiai obiect s-i corespund, n toate limbile, acelai semn, ceea ce e clar c nu se ntmpl. Un alt argument n favoarea inexistenei vreunei legturi naturale ntre semnificant i semnificat l constituie existena sinonimelor: aceluiai coninut i corespund expresii diferite: rom. oculist i oftalmolog, epic i narativ, engl. banner i flag steag, fr. bois i fort pdure, rus. termometr i gradusnik termometru.
70

Aceleai complexe sonore intr, pe de alt parte, n relaie cu sensuri diferite, constituind semne diferite: cuvntul pion, n romn nume al unei piese de ah, este, n rus, nume al unei flori, al bujorului; pir n romn plant erbacee peren din familia gramineelor, n rus osp, chef; tot n limba romn total, ntreg, ansamblu i alte cteva valori adverbiale ori adjectivale, iar n englez tot copila, phrel sau, ca verb, a aduna; pot n romn form de indicativ prezent a verbului a putea, iar n englez oal, crati, ceainic, persoan important, premiu, ctig, sau, ca verb, a mpuca, a conserva, a rsdi; rana, n romn leziune, plag sau durere sufleteasc, n italian broasc. i existena omonimelor constituie o dovad a caracterului arbitrar al semnului lingvistic: aceluiai semnificant i corespund semnificate diferite: rom. vin substantiv i verb, corn excrescen osoas la rumegtoare, instrument muzical de suflat, produs de panificaie, arbust .a.; engl. tip (substantiv) vrf, capt, baci, sfat, idee, informaie secret, pont, atingere, lovitur uoar, rsturnare, loc de aruncat gunoaie, sau, ca verb, a rsturna, a da baci, a lovi, a atinge. Semnele lingvistice nu sunt, deci, determinate de esena lucrurilor unui sunet sau grup de sunete le pot corespunde orice sensuri. Semnificantul este nemotivat, arbitrar n raport cu semnificatul cu care nu are nici o legtur natural. n opinia lui E. Benveniste semnificantul i semnificatul se presupun reciproc, relaia dintre ele fiind necesar. Arbitrar este raportul dintre semnificant i obiectul desemnat.
CARACTERUL LINIAR AL SEMNULUI LINGVISTIC

Aceast trstur a fost pus n eviden de ctre Saussure i are n vedere unidimensionalitatea semnelor lingvistice. nscriindu-se pe axa timpului, semnele limbii se desfoar succesiv, ntr-o singur direcie, fiind percepute vizual (dac limbajul este transpus n scris) sau auditiv (dac semnele sunt rostite). Semnul cas, de pild, se realizeaz prin succesiunea fonemelor c-a-s-. Fiind de natur auditiv, semnificantul se desfoar numai n timp i are caracteristicile pe care le mprumut de la acesta: a) el reprezint o ntindere i b) aceast ntindere este msurabil ntr-o singur dimensiune: este o linie (Saussure, p.88). Prin transpunerea cuvintelor unei limbi n codul grafic al acesteia, aspectul liniar capt concretee: iruri de litere, cuvinte, ideograme. Liniaritatea semnului vizeaz numai liniaritatea semnificantului.
71

n ceea ce privete cea de-a doua latur a semnului lingvistic, semnificatul, aceasta se caracterizeaz prin perceperea, prin actualizarea sa simultan, neliniar. Semnificatul termenului brdac, de pild, este perceput dintr-o dat: vas mic de pmnt sau de lemn, cu toart, folosit pentru but. n cazul cuvintelor derivate sau compuse perceperea semnificatului este parial liniar: nelesul cuvntului nemaiauzit cum nu s-a mai auzit, nemaipomenit este perceput dintr-o dat, momentan, neliniar. n acelai timp, nelesul global al semnului este format dintr-un ir de alte semne: ne-mai-auz-i-t, semnificaia global fiind segmentat, realizat liniar, printr-o succesiune de morfeme. Asimetria dintre caracterul liniar al semnificantului i cel simultan al semnificatului se reduce, deci, n cazul cuvintelor cu o structur analizabil n morfeme. Liniaritatea (unidimensionalitatea) este o caracteristic a semnului lingvistic, arat Saussure, cci exist i alte sisteme de semne cum ar fi cele maritime care se desfoar pe mai multe dimensiuni.
TRSTURA INFORMAIONAL A SEMNULUI LINGVISTIC

Cuvintele sunt semne ce servesc la comunicarea unor mesaje, la transmiterea de informaii prin intermediul unor semnale acustice sau grafice. Procesul informaional presupune codarea, de ctre un emitor, a semnelor nzestrate cu coninut i expresie n semnale scrise sau orale, unilaterale i liniare, care, la rndul lor, sunt decodate de ctre un receptor n semnele corespunztoare (T.L.G. p.184).
IMUTABILITATEA I MUTABILITATEA SEMNULUI LINGVISTIC

Semnul lingvistic nu poate s fie schimbat de vorbitorii unei limbi conform propriei lor dorine, cu toate c el este convenional. Dac s-ar ntmpla acest lucru, complexele sonore n-ar mai putea s funcioneze, ntr-o colectivitate, ca semne ale obiectelor pe care le denumesc. Vorbitorii sunt, deci, cu toii, obligai pentru a se face nelei i pentru a nelege ce spun alii s foloseasc aceleai semne, cu aceleai nelesuri. Semnificantul este imutabil n raport cu voina individului, adic acesta nu are libertatea de a interveni i a-l schimba cnd i cum dorete. Chiar marele Cezar August, devenit unic stpnitor al Imperiului Roman, recunotea scrie filosoful englez John Locke c nu poate s creeze un nou cuvnt latin, c nu poate hotr el ce sens s fie
72

atribuit de ctre supuii si unui sunet sau grup de sunete. Tu, Caesar, civitatem dare potes homini, verbo non potes! Tu, Cezar, i poi da omului o form de guvernmnt, dar un cuvnt nu poi (s-i impui)!, l parafrazeaz Locke pe istoricul roman Suetoniu. Nu numai c individul, chiar dac ar vrea, ar fi incapabil s modifice n vreun fel alegerea fcut, dar nici mcar grupul social nu i-ar putea exercita suveranitatea asupra vreunui cuvnt; colectivitatea este legat de limba ca atare. Oamenii nu-i pot alege semnele prin care s denumeasc obiectele, cci limba este o motenire de la generaiile precedente. Stadiul limbii la un moment dat este ntotdeauna produsul factorilor istorici, care explic de ce semnul este imuabil, adic, de ce el rezist oricrei nlocuiri arbitrare (Saussure, p.90). Tradiia constrnge, deci, vorbitorii s numeasc lucrurile ntr-un anume fel, s se supun unor norme, unor reguli ale limbii respective. nclcarea acestora ar face imposibil procesul de comunicare. n opinia lui Saussure semnele rezist n timp i sunt relativ stabile, datorit mai multor factori. Unul dintre acetia este caracterul arbitrar al semnului: nu exist nici un motiv s nlocuim un complex sonor cu un altul (bun cu nub, de pild), s preferm sor lui soeur sau lui sister. Un alt factor este reprezentat de faptul c sistemul lingvistic este un mecanism deosebit de complex. ncercrile specialitilor de a reforma acest sistem n ansamblu sunt sortite eecului. Imutabilitatea semnelor este dat i de faptul c ele sunt n numr deosebit de mare. Dac un sistem de scriere (format dintr-un numr limitat de litere) se poate nlocui cu un altul, nu acelai lucru se poate ntmpla cu limba, ale crei elemente sunt nenumrate. n sfrit, semnele rezist n timp i datorit faptului c limba este o instituie cu totul aparte, care i implic, permanent, pe toi vorbitorii i care sufer, continuu, influena tuturor. De aceea, aceast instituie se preteaz cel mai puin la iniiative i o revoluie n interiorul ei este, practic, imposibil (Saussure, p.92). Cu toate acestea, n actele lingvistice individuale i poate face simit prezena o poriune de invenie personal, dar invenia nu poate depi anumite limite i trebuie s fie acceptat de mediul n care se produce (Coeriu, p.66). Pentru ca inovaiile abateri de la norm, iniial s se rspndeasc i s fie, cu timpul, incluse n sistemul limbii, trebuie ca ele s respecte normele sistemului, s fie acceptate i utilizate de ctre ceilali vorbitori. Astfel, ceea ce la un moment dat este considerat o abatere n folosirea unui cuvnt poate s devin, peste un anumit timp, printr-o frecvent ntrebuinare i o larg rspndire, norm. Semnificantul devine, astfel, mutabil.
73

Prin mutabilitatea semnului lingvistic Saussure nelege schimbarea, n timp, a raportului dintre semnificant i semnificat. Verbul necre, exemplific lingvistul genevez, nsemna, n latin, a omor. n francez cuvntul a devenit noyer a neca. S-au schimbat, dup cum se vede, att complexul sonor, ct i conceptul; legtura dintre idee i semn a slbit i a avut loc o deplasare n raportul lor. n romn, cuvntul miel (din lat. misellus, diminutiv al lui miser srac), folosit astzi cu sensul de om de nimic, ticlos, nemernic, avea, odinioar, sensul de om de rnd, srac, nevoia. Asemenea schimbri sunt puse pe seama caracterului arbitrar al semnului lingvistic. Fr a aprofunda fenomenul mutabilitii (cauzele ei nu sunt dezbtute), Saussure arat c ea este inevitabil deoarece, n timp, semnele sunt supuse unui proces mai rapid sau mai lent de alterare.
FUNCIILE SEMNULUI LINGVISTIC

Funcia de cunoatere a realitii. Procesul de cunoatere a realitii se poate realiza pe cale senzorial (prin intermediul celor cinci simuri) i pe cale logic, raional (n afara contactului fizic, material, cu realitatea de cunoscut). Semnul lingvistic face posibil saltul de la cunoaterea senzorial la cea raional, de la primul la cel de-al doilea sistem de semnalizare. Reflexul condiionat, n cadrul cruia unele obiecte sunt semnale pentru alte obiecte (un bec aprins devine, pentru un cine, semn al prezenei crnii), constituie mecanismul primului sistem de semnalizare, ntlnit att la om, ct i la animale. Acest sistem nu are, n limb, o form proprie de expresie. De la el, prin generalizare i abstractizare, se ajunge la noiune, care nu trimite doar la un obiect concret, ci la o clas ntreag de obiecte. Noiunea se leag de un semnal diferit de ea nsi i de obiectele reflectate i reprezentat de complexul sonor, mpreun cu care formeaz cel de-al doilea sistem de semnalizare, a crui unitate fundamental o constituie cuvntul (Graur, p.43-44). La om, semnalizarea se realizeaz prin conexiunea celor dou sisteme, al doilea avnd rolul conductor n ntreaga via psihic. Limbajul formeaz cel de-al doilea sistem de semnalizare i de fapt este un excitant condiionat, dar foarte sintetic i general (Miclu, 1977, p.87). Semnele lingvistice, afirm E. Coeriu, organizeaz formal cunoaterea noastr asupra realitii, deoarece ele nu sunt elemente pur mostrative [designative], ci simbolice i generalizatoare, adic nu desemneaz indivizi, experiene izolate, ci semnific genuri, clase, ori concepte generale elaborate de raiune. Este un fapt incontestabil
74

c pn i unitile particulare sunt desemnate n limbi cu ajutorul universaliilor (adic numele cu care ne referim la indivizi sunt nume de clase: numim un obiect particular cas, cu un nume care este cel al clasei respective), fapt pentru care, n actele concrete de vorbire, efectum n mod constant o operaie logic, aceea de a afirma implicit includerea unui individ n genul su (Coeriu, p.51). Funcia de difereniere n cadrul sistemului se realizeaz prin fonemele i morfemele din care este alctuit semnul. De exemplu, fonemul l din lac deosebete acest cuvnt de cuvinte cum sunt: rac, sac, dac, bac, fac, tac, oac .a. Unitile semnificative minimale dotate cu neles morfemele au, i ele, funcie difereniatoare. Morfemul -se din cuvntul supravieuise stabilete, de pild, diferene fa de alte forme gramaticale ale cuvntului: supravieui-a, supravieui-, supravieui-ete, fa de alte cuvinte din aceeai familie: supravieui-re, supravieui-tor. Prefixul supradifereniaz cuvntul de vieuise sau de con-vieuise. Funcia de difereniere a semnului lingvistic se realizeaz pe plan sintagmatic, pe axa orizontal, a combinaiilor, pe care cuvintele sunt n relaii contrastive (n exemplul citesc revista cele dou cuvinte nu se identific, ntre ele fiind relaii de contrast). n plan paradigmatic, pe axa vertical, a asociaiilor mentale, dac ncercm s nlocuim, n exemplul dat, revista cu ziarul sau cartea se constat c fiecare dintre aceste uniti ce aparin aceluiai cmp semantic sunt uniti distincte, care se opun una alteia. Funcia de transmitere a informaiei. Performanele obinute de omenire pe multiple planuri sunt roade ale eforturilor depuse de aceasta de-a lungul istoriei. Ele n-ar fi fost posibile dac n-ar fi existat cuvintele, semnele lingvistice, care s transmit prin viu grai sau n scris, de la o generaie la alta, de la un individ la altul, idei, informaii. Pentru ca o informaie (mesaj) s poat fi transmis, ea trebuie s fie codificat. Acest proces se realizeaz, cel mai ades, prin intermediul limbii, care este un cod, un ansamblu de semne cu o organizare proprie, ce funcioneaz dup anumite reguli. Persoana care codific informaia i transmite mesajul are rol de emitor, iar cea care primete semnalele i le decodific are rol de receptor. Aceste roluri se schimb n procesul comunicrii, emitorul devenind receptor i invers. Semnele utilizate n transmiterea informaiei trebuie s fie cunoscute att emitorului, ct i receptorului. Factorilor constitutivi ai actelor de vorbire sus-menionai (emitor, receptor, mesaj, cod), Roman Jakobson le adaug i
75

contextul (referentul), pe care destinatarul s-l poat pricepe i care s fie verbal sau s poat fi verbalizat i contactul legtura dintre cei doi, care le d posibilitatea s stabileasc i s menin comunicarea (Jakobson, p.50).
MOTIVAREA ANUMITOR SEMNE LINGVISTICE

Dup cum remarca Saussure, principiul arbitrarului semnului lingvistic nu ne mpiedic s delimitm ntr-o limb ceea ce este n mod radical arbitrar, adic nemotivat, de ceea ce nu este astfel dect n mod relativ. Numai o parte din semne este absolut arbitrar; la altele intervine un fenomen ce ne ngduie s recunoatem grade de arbitrar, fr s-l suprimm: semnul poate fi relativ motivat (Saussure, p.142). Nu exist limb n care nimic s nu fie motivat; de asemenea, a concepe una n care totul s fie motivat este imposibil prin definiie. ntre cele dou limite extreme maximum de organizare i minimum de arbitrar gsim toate varietile posibile. Diversele idiomuri cuprind ntotdeauna elemente din cele dou ordini radical arbitrare i relativ motivate , dar n proporii foarte variabile, continua Saussure. Sunt motivate acele semne a cror form se poate explica prin raportarea la coninutul pe care-l denumesc. Motivarea poate fi de dou tipuri: absolut i relativ. Motivarea absolut (extern) cuprinde cuvinte care, prin sunetele lor componente, sugereaz nelesul. n aceast categorie intr onomatopeele, interjeciile, cuvintele cu simbolism fonetic. Onomatopeele sunt cuvinte care imit, prin elementele lor sonore, sunete i zgomote din natur (cotcodac!, chi-chi!, scr!, pac!, tronc!). n reproducerea sunetelor emise de psri sau animale, de pild, se constat mari asemnri sau chiar identiti ntre limbi ce aparin unor familii diferite i care, altminteri, prezint mari deosebiri sub aspect fonetic: cucu! (rom.), ku-ku! (rus.), coucou! (fr.), cuckoo! (engl.), cuccu! (it.); miau! (rom.), mjau! (rus.), miaou! (fr.), mew! (engl.), miao! (it.). Comparaiile pun ns n eviden, alteori, i diferene mai mici sau mai mari ntre limbi: rom. cucurigu!, rus. kukareku!, fr. cocorico!, engl. cock-a-doodle-doo!, sp. quiquiriqui!; rom. ham-ham!, rus. gavgav!, fr. ouah-ouah!, engl. bow-wow!, sp. guau-guau!, it. bau-bau!. Dac reproducerea onomatopeelor ar fi fcut cu exactitate, asemenea cuvinte ar trebui s fie identice n toate limbile. Redarea este ns aproximativ i ine seama de specificul fonetic al diferitelor limbi. S-a dovedit c fiina uman nu reproduce niciodat exact aceste
76

zgomote i aceste sunete: n aa-numita reproducere exist totdeauna un aspect simbolic i convenional, sau ceva aparinnd unei comuniti lingvistice, lucru care ne arat c sunetele naturale sunt nu att reproduse, ct mai degrab interpretate convenional i n mod diferit, n funcie de diversele comuniti lingvistice (Coeriu, p.23). De-a lungul timpului onomatopeele sunt supuse asemeni celorlalte cuvinte unor transformri care pot merge chiar pn la pierderea caracterului imitativ iniial. Cuvntul onomatopeic latinesc pipio porumbel a devenit, n francez, pigeon, pierznd legtura cu sunetele imitate. Interjec iile exprim senzaii, sentimente, stri sufleteti: ah!, halal!, uf!, brr!. O interjecie cum este, de pild, ah! din limba romn este ntlnit n numeroase alte limbi: francez, rus, englez, italian. Interjeciilor, considerate, la o prim privire, expresii spontane ale realitii, dictate ca s spunem aa de ctre natur (Saussure, p.88) li se poate, ns, contesta legtura natural ntre semnificant i semnificat, aa cum rezult din comparaia interjeciei ae! din francez cu corespondentul ei din german, au! sau a interjeciei uvy! din rus cu echivalentul ei romnesc vai!, pcat!. Cuvintele cu simbolism fonetic au n componena lor unele sunete ce amintesc de caracteristicile obiectului: a vji, a sughia, a cotcodci, a scri, a pleosci. Asemenea cuvinte sunt mai numeroase i mai des utilizate n limb dect interjeciile i onomatopeele. Despre simbolism fonetic se vorbete i cnd numai unul-dou sunete marcheaz o semnificaie: consoana r, despre care Platon afirma c red ideea de micare, c sugereaz curgerea, sau grupul fl cu aceeai valoare i-ar motiva i explica, astfel, prezena ntr-o serie de limbi n cuvinte cum sunt: ru, rios, rheo, reka, river, stream; fluviu, fleuve, fluire, fluid, to flow .a. Motivarea relativ (intern) vizeaz cuvinte derivate, compuse, a cror form se poate explica prin raportare la alte semne. Tot aici sunt incluse denumiri ale unor obiecte ce au la baz o figur de stil. Procedeele utilizate n formarea unor asemenea cuvinte variaz de la o limb la alta, n funcie de structura limbii respective, dar i de particularitile obiectului denumit care i-au impresionat mai mult pe vorbitori. R.A. Budagov citeaz, n acest sens, cuvntul podsnenik ghiocel format din pod sub i sneg zpad. Dac vorbitorii rui au fixat n denumirea plantei condiiile i timpul apariiei acesteia, francezii au remarcat i consemnat c floarea strpunge zpada: perceneige. n german floarea e comparat cu un clopoel de
77

zpad: Schneeglckhen, iar n englez cu o pictur de zpad: snowdrop (Budagov, p.82). Tot forma florii (de ghioc) este cea care le-a reinut atenia i vorbitorilor de romn. Motivare relativ au: Cuvintele derivate de la alte cuvinte cu ajutorul prefixelor sau sufixelor: rom. re-tri, ne-adevr, ultra-modern, pre-col-ar, brbt-esc, ro-ior, geam-giu, real-ism; engl.: re-write a re-scrie, un-able incapabil, eat-able comestibil, joy-ous bucuros. Uneori prefixele i sufixele au fost, la origine, cuvinte independente: prefixul romnesc n- provine dintr-o prepoziie: a n-mna a pune n mn; sufixul englezesc -body ntlnit n formarea unor pronume cum sunt somebody cineva (some vreun), everybody oricine (every fiecare) exist i la ora actual n limb, independent, cu sensul de corp, trup. Unele cuvinte sunt extrem de productive, dnd natere, prin derivare, la numeroase alte formaiuni ce amintesc de termenul de la care s-a pornit: a reface, a preface, a desface, facere, fctur, refacere, desfctur, binefacere, binefctor, rufctor, prefcut (-), sunt cuvinte relativ motivate, ce trimit, prin structura lor, la verbul a face. Cuvintele compuse amintesc i ele, prin structura lor, de alte cuvinte: rom. bunvoin, untdelemn, nemaivzut, du-te-vino, cine-lup, engl. ant-eater furnicar, spy-glass ochean, far-away ndeprtat, rightwing de dreapta, brother-in-law cumnat. Motivate sunt i compusele din abrevieri: Pronosport (pronostic la sport), Agerpres (Agenia Romn de Pres), C.F.R. (Cile Ferate Romne). Frecvent utilizat n sanscrit i greaca veche, compunerea este un procedeu foarte des ntlnit actualmente n limbi cum sunt: germana, maghiara, rusa .a. Cuvintele compuse sunt, uneori, de dimensiuni impresionante: germ. Aktienbrauereidirektorswitwe vduv a unui director de braserie pe aciuni, Donaudampfschiffahrtgesellschaftskapitnswitwenrentenauszahlungstag ziua de plat a pensiei vduvei cpitanului societii fluviale dunrene. Dac elementele ce alctuiesc cuvintele compuse floare sau soare, gur sau leu sunt arbitrare, nemotivate, derivatele metaforice floarea-soarelui (care indic permanenta orientare a plantei dup soare), gura-leului (reflectare a unei asemnri formale ntre floare i gura animalului) devin semne motivate. Pierderea motivrii. Unele cuvinte, motivate n limbile din care sunt preluate, devin neanalizabile n limbile care le mprumut. Astfel, cuvintele romneti nemotivate elev, garderob, tirbuon, mprumutate din francez, sunt, n aceast limb, motivate: primul provine de la
78

lever (a crete, a educa), cel de-al doilea este un cuvnt compus garde-robe (n traducere literal pstreaz rochia), iar al treilea este compus din tire-bouchon (trage dopul). La fel, cuvntul prosop (din greac) este, la origine, un cuvnt motivat compus din pros pentru i opsis fa; elementele componente nu sunt sesizate de vorbitorii romni i, ca atare, cuvntul este, n romn, nemotivat. Remotivarea. Nevoia motivrii cuvintelor genereaz, uneori, false legturi etimologice. Astfel, formele unor cuvinte mai puin cunoscute i nelese, mai rar ntrebuinate, se modific, influenate de termeni cunoscui, asemntori ca form i sens. Acest fenomen al reinterpretrii, n limba popular, a unor cuvinte nenelese, cu ajutorul cuvintelor nelese, al reducerii cuvntului necunoscut la unul cunoscut (Budagov, p.90) poart numele de etimologie popular . Astfel, cuvintele de origine francez remuneraie, policlinic, hipodrom sunt puse n legtur cu numr, boal, drum i dau natere unor termeni cum sunt: renumeraie, boliclinic, hipodrum. Termeni cum sunt detratant n loc de detartrant, sau detratare n loc de detartrare, legate de verbul a trata, temerar utilizat cu sens de temtor, pus n legtur cu verbul a se teme constituie alte cteva exemple de cuvinte considerate motivate, integrate n familii de care, de fapt, sunt total strine. Etimologia popular conduce, uneori, la modificarea formei cuvintelor: filigran, devine, prin raportare la gram, filigram; verbul a asambla i derivatele sale, asamblare, asamblat .a., puse n legtur cu ansamblu capt formele a ansambla, ansamblare, ansamblat; cuvntul de origine maghiar ferstru, considerat derivat de la fier (cuvnt latinesc), e rostit i scris greit fierstru. Alteori, etimologia popular conduce att la schimbarea formei, ct i a sensului cuvintelor: astfel, crdie tovrie (derivat de la turcesul karda tovar), s-a transformat sub influena lui crd n crdie, utilizat, peiorativ, cu sensul de gac, clic (Graur, p.136). Sunt situaii n care unele cuvinte, modificate n limba popular, revin sub o form nou, schimbat n limba literar. Astfel, substantivul svidetel martor din limba rus contemporan este pus n legtur cu verbul videt a vedea. n rusa veche, ns, forma corect a cuvntului era svedatel, legat de vedaet tie. Cum videt era un cuvnt foarte des ntrebuinat, forma svidetel a prut mai accesibil dect forma corect, crturreasc, i a ptruns n limba literar, lund locul termenului iniial.
79

Spre deosebire de cuvintele nemotivate, cele motivate, n general, au meritul de a se reine mai uor. Pornind de la un numr relativ mic de rdcini, prin derivare, prin compunere, se pot forma cu uurin cuvinte noi, care se integreaz n familii lexicale, accentundu-se, astfel, caracterul sistematic al vocabularului. Cu toate c eliminarea nemotivrii este imposibil, se constat sporirea numrului de elemente motivate din limb (T.L.G. p.196).
BIBLIOGRAFIE Augustin, De dialectica, Ed. Humanitas, Bucureti, 1991, p. 49-79, 146-192. R.A. Budagov, Introducere n tiina limbii, Ed. tiinific, Bucureti, 1961, p. 79-97, 148-167. Eugeniu Coeriu, Introducere n lingvistic, Ed. Echinox, Cluj-Napoca, 1995, p. 21-23, 50-51, 56-57, 65, 94-95, 120-123. Umberto Eco, Tratat de semiotic general, Ed. tiinific i Enciclopedic, Bucureti, 1982. Al. Graur, (coord.), Introducere n lingvistic , Ed. tiin ific, Bucureti, 1972, p. 42-49. Al. Graur, Sorin Stati, Lucia Wald, red., Tratat de lingvistic general, (T.L.G.) Ed. Academiei, Bucureti, 1971, p. 181-185, 190-196. Emil Ionescu, Manual de lingvistic general, Ed. ALL, Bucureti, 1992, p. 73-81. Roman Jakobson, Funciile limbii, n vol. Crestomaie de lingvistic general, ediie ngrijit de acad. Ion Coteanu, Ed. Fundaiei Romnia de Mine, Bucureti, 1998, p. 50-57. Paul Miclu, Le signe linguistique, Ed. Klincksieck, Paris, Edition de lAcadmie, Bucureti, 1970. Paul Miclu, Semiotic lingvistic, Ed. Facla, Timioara, 1977. Ch. S. Peirce, Semnificaie i aciune, Ed. Humanitas, Bucureti, 1990, p. 268-331. F. de Saussure, Curs de lingvistic general, Ed. Polirom, Iai, 1998, p. 85-96, 132-143. Adam Schaff, Introducere n semantic, Ed. tiinific, Bucureti, 1966, p. 194-227. Emanuel Vasiliu, Introducere n teoria limbii, Ed. Academiei Romne, Bucureti, 1992, p. 14-26. Ariton Vraciu, Lingvistic general i comparat , Ed. Didactic i Pedagogic, Bucureti, 1980, p. 61-65. Lucia Wald, red., Antologie de texte de lingvistic structural, Tipografia Universitii Bucureti, 1977, p. 154-169. 80

CHESTIONAR 1. Ce este semiotica i care sunt subdiviziunile ei? 2. Care sunt accepiile semnului lingvistic? Caracterizai accepia bilateral (biplan). 3. Ce se nelege prin arbitrarul semnului lingvistic? 4. Dar prin liniaritatea semnificantului? 5. Imutabilitatea i mutabilitatea semnului lingvistic. 6. Care sunt funciile semnului lingvistic? Prezentai, la alegere, una dintre aceste funcii. 7. Motivarea absolut (extern) a anumitor semne lingvistice, cu exemplificri. 8. Motivarea relativ (intern) a anumitor semne lingvistice, cu exemplificri. 9. Ce este etimologia popular? Exemple. 10. Ce se nelege prin pierderea motivrii? Exemplificai.

81

SCHIMBRILE N LIMB N PERSPECTIV DIACRONIC. CONTACTUL NTRE LIMBI

n cadrul analizei diacronice a limbilor se ncearc identificarea acelor elemente i procese care permit s se rspund la ntrebarea esenial a lingvisticii: cum se schimb limbile. Acest demers presupune s se aib n vedere faptul c limba este att un sistem, ct i un fapt social. Dintotdeauna colectivitile umane au intrat n relaie unele cu altele, iar aceste contacte se fac prin intermediul limbii. Cercetrile au demonstrat c nu exist limb izolat, ferit de atingerea cu alte limbi.
CONTACTUL DINTRE LIMBI

Nevoile de comunicare au obligat dintotdeauna o colectivitate la contact cu vorbitorii altui idiom (denumire generic pentru limb, dialect, grai). Contactul dintre limbi se vdete a fi rezultatul unor fenomene extralingvistice: convieuire vremelnic sau de durat pe acelai teritoriu a vorbitorilor unor idiomuri diferite, amestec de populaii, relaii culturale, economice sau politice ale unor populaii aflate pe teritorii diferite. Rezultatele la nivel lingvistic ale unor astfel de contacte interumane depind de nsuirea unei alte limbi dect cea matern. Aceasta i este definiia contactului lingvistic: dou sau mai multe limbi se consider a fi n contact dac sunt folosite alternativ de unele i aceleai persoane. Termenul contact lingvistic a fost propus iniial de Andr Martinet i a nlocuit o mulime de termeni folosii anterior, care erau ambigui, dintre care cel mai rspndit fusese termenul amestec de limbi (mlange). Termenul de contact are i el dou conotaii, nseamn att atingere, ct i legtur, relaie, prin urmare contactul poate fi pasager, cu implicaii lingvistice de suprafa, sau poate denumi un proces de durat. Dei foarte folosit, termenul contact poate crea totui ambiguiti, deoarece nu este un termen propriu-zis lingvistic (face parte din terminologia sociologiei i este polisemantic, fiind echivalent cu bilingvism, interferen, mprumut).
82

Tipurile de contacte sunt cele care condiioneaz bilingvismul i prin aceasta amploarea interferenei. Ele sunt clasificate n perspectiva duratei ca: I. 1. pasagere sau accidentale; 2. de foarte lung durat sau permanente. Contactele pot fi: II. 1. externe (interlingvistice, inclusiv enclave aloglote); 2. interne (intralingvistice, interregionale). III.1. directe (interumane; vorbitorii folosesc i limba interlocutorului, alta dect limba lor matern); 2. mijlocite (limbile AB interacioneaz prin intermediul unei a treia limbi, ceea ce conduce la mprumuturi prin filier). IV.1. imediate (sau nemijlocite) de tip oral; 2. la distan (prin intermediul scrisului, al nvmntului sau al mass-media). V.1. populare (n ceea ce privete nivelul socio-cultural); 2. culturale: a. ntre o limb clasic alias moart i limbi vii; b. ntre limbi aflate la mare distan. Necesitatea unei asemenea clasificri a contactului se justific prin faptul c fenomenul precede propriu-zis interaciunea dintre limbi; fr un contact stabilit pe o cale sau alta din multele posibile, limbile (chiar dac ar fi nrudite sau similare tipologic) nu vor interaciona, adic nu vor interfera. Interferena este mijlocit preponderent, dac nu exclusiv, prin bilingvism. Einar Haugen a artat c una dintre axiomele lingvistice este c, oriunde s-ar manifesta influena unei limbi asupra alteia, aceasta se realizeaz prin indivizi.
BILINGVISMUL

Bilingvismul este capacitatea unui individ sau a indivizilor unei colectiviti de a utiliza n comunicare dou sisteme lingvistice diferite (dou idiomuri), altfel spus practica folosirii alternative a dou limbi se numete bilingvism, iar persoana respectiv este considerat bilingv. Bilingvismul este de dou categorii: a. bilingvismul vorbitorilor obinuii, n care achiziionarea limbii alogene (strine, de alt origine) se face de obicei n forme neorganizate, involuntar, n condiii de mediu etnic i lingvistic eterogen; b. bilingvismul vorbitorilor culi, numit i diglosie, se refer la achiziionarea celei de a doua limbi n mod contient, prin studiu. Bilingvismul vorbitorilor cultivai este un fenomen specific unei minoriti i de aceea duce la contact superficial ntre dou limbi. Bilingvismul colectiv, n mas, al vorbitorilor obinuii, este cunoscut mai cu seam din epocile vechi ale istoriei, cnd unele popoare i-au ntins stpnirea asupra altora, de exemplu limba latin s-a impus n
83

ntreg Imperiul Roman. i n perioade mai apropiate s-au petrecut fenomene de bilingvism n mas, de exemplu, n perioada totalitarismului, n fosta URSS limba rus a fost impus tuturor popoarelor din aceast parte a lumii (prin administraie, nvmnt, mass-media etc., cf. IV. 2. i contacte nemijlocite). Bilingvismul colectiv are drept urmare schimbarea fizionomiei limbii materne. Transformrile pe care le sufer limba depind de structura tipologic a limbilor de contact. O categorie subiacent o constituie bilingvismul enclavelor lingvistice, n care limba matern este asediat de limba oficial. Aceasta, deoarece limba matern a vorbitorilor din enclav se specializeaz ca mijloc de comunicare n relaiile familiale i sufer o puternic influen din partea idiomului oficial. Contactul dintre limbi are drept consecine: procese de interferen i fenomene de influen (mprumut). Procesul declanat de contact: ntlnirea, intersectarea, ncruciarea, combinarea ntre dou limbi este numit interferen. Termenul face parte din terminologia lingvistic propagat de Cercul lingvistic de la Praga care, dup 1926, s-a ocupat de problematica contactului dintre limbi. Interferenele sunt mutaiile dintr-o limb sub influena unui agent exterior, de natur tot lingvistic, dintr-o alt limb. Viziunea modern a procesului de interferen, n ipoteza c toate limbile catalogate de pe harta lumii i-au ncheiat perioada de formare (sunt formate de mult), sunt bine individualizate i nu ar mai fi posibile suprapuneri pe acelai teritoriu al unor idiomuri diverse, va trebui s fac n viitor un bilan al rezultatelor procesului. Din punct de vedere epistemologic (care se refer la procesul cunoaterii) i metodologic se constat c limbile se interfereaz ntre ele numai n calitate de sisteme sau subsisteme cu structurile lor irepetabile (pentru c orice limb este un unicat), care au rolul unor filtre de control, ceea ce permite, frneaz sau interzice influenele aloglote. B.P. Hasdeu a analizat nc n 1881 (n Principie de lingvistic) procesul de interferen interlingvistic i stabilind diferenele dintre amestecul limbilor (numit amestec primar) i ncruciarea limbilor (numit amestec secundar) a caracterizat aspectele lui definitorii. Prin interferena, denumit de el amestec primar, creia i acorda o nsemntate genealogic, el nelegea procesul care a acionat n perioada de formare a limbilor, cnd dou vocabulare i dou gramatici se reduc prin cernerea afinitii elective, ntr-un lexic i ntr-o gramatic unice fonetica, morfologia, sintaxa, ideologia (semantica), totul se combin ntr-un plan nou, totul se schimb mai mult sau mai puin. Amestecul primar se ramific n toate direciile n limb, astfel
84

c n majoritatea cazurilor el nu poate fi detaat fr a distruge ntreaga economie (sistemul) limbii. n timp ce amestecul secundar, ncruciarea sau influena, n principiu accidental, acioneaz abia dup formarea limbilor, limitndu-se la mprumutul lexical. Ca i n alte domenii ale lingvisticii, i n teoria interferenelor B.P. Hasdeu este un precursor; ceea ce particularizeaz expunerea sa este terminologia diferit de cea actual, sensul demonstraiei sale fiind ns n consens cu concepiile de astzi, sau mcar cu unele dintre ele. Pentru c trebuie s fim prevenii, lingvitii nu sunt de obicei n consens n ceea ce privete teoriile lingvistice. Permanenta cutare a Adevrului asigur, de altfel, i perenitatea cercetrii! De aceea, este recomandabil lectura, n afara cursului, a lucrrilor speciale consacrate problematicii n discuie. Dintre factorii de care depind dimensiunile, direcia i natura interferenelor interlingvistice vom cita pe cei mai importani: 1. durata i continuitatea contactului; 2. starea social-politic a celor dou colectiviti care intr n contact; 3. situaia economic a colectivitii primare fa de cealalt; 4. tolerana sau discriminarea naional, rasial sau religioas; 5. coeziunea colectivitilor aflate n contact, respectiv dispersia lor; 6. raportul numeric dintre ele; 7. gradul de concentrare n teritoriu a fiecrei colectiviti; 8. intensitatea legturilor unei comuniti minoritare (diaspor) cu trunchiul etnolingvistic din care s-a desprins; 9. existena unor activiti social-politice i cultural-instructive n limba matern; 10. predominarea, superioritatea economic, social-politic, cultural, artistic, tehnico-tiinific a unei colectiviti asupra alteia; 11. Particularitile psihice i de mentalitate, fa de mprumut (predispoziie sau refuz) ale colectivitii; 12. Dominaia monolingvismului ntr-o ar sau a plurilingvismului; multitudinea limbilor necesitnd o limb de contact, de intercomunicare ntre alogloi (vorbitori de limbi diferite), aceasta fiind de obicei limba oficial sau a majoritii (cf. I. Lobiuc). Ansamblul acestor factori constituie ceea ce U. Weinreich numete ambiana social-cultural a contactului lingvistic, fr a crei analiz cercetrile asupra interferenelor ntre limbi risc s rmn n aer. Pentru situaii contemporane de contacte, altfel spus de interferene, ntre o limb autohton i limbile imigranilor se mai evoc factori interni, ce in de tipul noilor achiziii lingvistice (terminologice mai ales), dar i de reorientarea social i cultural,
85

schimbarea ocupaiilor i profesiilor, cstoriile mixte etc. ns achiziiile din limbajul diasporei (comunitate etnic alogen) doar n mod excepional pot avea rspndire n limbajul vorbitorilor din ara de origine (cf. dialectul ssesc din Transilvania vs. limba german standard). Interferena poate fi analizat n perspectiva a dou coordonate: a) a timpului n care se desfoar, deoarece durata procesului este o variabil; b) a rezultatelor intruziunii, care poate fi cuantificat n msura n care atinge sistemul doar al uneia dintre limbi sau al ambelor. Pentru c orice mbogire sau srcire a unui sistem atrage n mod necesar reorganizarea opoziiilor existente anterior, distinctive, ale sistemului. Prin urmare, orice element dintr-o alt limb determin reorganizri (tacite sau spectaculoase) n sistemul care-l primete. Contactul lingvistic se poate stabili ntre orice fel de limbi, total diferite ca structur sau asemntoare, legate sau nelegate genetic, n funcie de relaiile colectivitilor umane. Gradul de interferen este ns direct influenat de factorii lingvistici: a) structura idiomurilor respective i b) originea idiomurilor respective. Astfel dou limbi nrudite genetic se vor influena reciproc mult mai puternic dect dou limbi nenrudite genetic sau tipologic. Factorul timp. Din punctul de vedere al timpului cnd se desfoar interferena delimitm mai multe categorii: 1. interferene al cror proces s-a ncheiat i n istoria limbilor se studiaz rezultatele lor (este cazul interferenelor care au condus la naterea unor limbi noi: limbi romanice, slave, germanice etc.); avem n vedere interferenele care aparin: a. substratului b. superstratului 2. interferene ale cror consecine pot fi identificate parial n mprumut i aparin adstratului. 3. interferene n curs de desfurare, manifestate prin bilingvism mai mult sau mai puin generalizat i studiate de ctre sociolingvistic.
SUBSTRAT

Substratul este unul dintre rezultatele procesului de interferen lingvistic datorat amestecului de durat a dou sau mai multe colectiviti, dintre care una era autohton pe teritoriul devenit comun, iar cealalt s-a aezat mai trziu. S-au creat astfel premise ca limba strin s intre n uzul general cotidian, ceea ce duce la bilingvism extins. Perioada de bilingvism se soldeaz, n anumite situaii, cu
86

eliminarea uneia dintre limbi. Eliminare sau nfrngere nseamn n fapt renunarea la folosirea acelei limbi. Dac limba eliminat a fost cea a autohtonilor, ea formeaz substratul limbii care continu s fie folosit (limba A se perpetueaz prin limba B). Eliminarea unei limbi nu se face brusc, ci de la vorbitor la vorbitor are loc o extindere de folosire a uneia dintre limbi n detrimentul celeilalte.
B

B B

B A B

Aceast imagine are urmtoarea semnificaie: limba B a fost nvat de ctre unii vorbitori ai limbii A care au transmis-o, la rndul lor, n familie, generaiilor succesive ct i concetenilor sau, un numr din ce n ce mai mare de locuitori au nvat direct, de-a lungul generaiilor, limba B de la vorbitorii ei, prin urmare trebuie s avem n vedere ambele canale de rspndire a unei limbi strine. n condiii de continu generalizare a folosirii limbii B, cu deosebire n relaiile dintre vorbitorii celor dou limbi, au loc ns ptrunderi masive de elemente i din limba A n structura limbii B, deoarece prin convieuire este normal s aib loc treceri dintr-un cod ntr-altul, n ambele direcii. Cnd, dup cteva generaii, limba A i-a restrns aria de folosire att la toate nivelele sociale, ct i n spaiu, ajungnd mijloc de comunicare numai n familie sau n zone restrnse, iar apoi a fost abandonat, limba B, victorioas, cumula n structura ei multe aspecte pe care vorbitorii autohtoni le-au perpetuat. n primul rnd, n cel mai conservator compartiment, fonetica, modul de a pronuna limba strin de ctre localnici a sfrit prin a imprima limbii B perpetuate trsturi distinctive, dup cum n limba B au ptruns multe cuvinte din limba A. n noua faz a limbii B, pe care o notm drept faza B, structura limbii B apare puternic contaminat cu elemente ale limbii A, elemente care constituie substratul, n timp ce limba B perpetuat reprezint stratul (structura) limbii noi. Pentru a exemplifica un asemenea proces, reconstituim cteva aspecte ale formrii limbii romne. Limba traco-dac, vorbit de autohtonii din zona romanitii orientale, din sud-estul Europei (avem n vedere nu numai teritoriul din nordul Dunrii, ci i o arie larg suddunrean) a nceput s fie abandonat nc din perioada cnd aceast zon s-a aflat n graniele Imperiului roman. Romanizarea a fost intens datorit prestigiului politico-cultural i economic al lumii romane. Populaia a avut un interes acut de a se integra n aceast lume roman civilizat i nu a avut o alt alternativ cultural sau lingvistic (Fischer,
87

p. 11). Pe de alt parte, limba latin dispunea de dou atu-uri: era limba oficial a Imperiului, opunndu-se astfel idiomurilor barbare (neliterare i neunitare) i era una dintre cele dou limbi ale cretinismului (cealalt fiind limba greac) (Ibidem). Or, se tie c populaia din acest teritoriu romanizat fusese cretinat de ctre cretinii din alte zone ale Imperiului aflai n rndurile armatei sau fcnd parte din grupurile care o nsoeau (negustori, meseriai etc.) i de ctre Apostolii Andrei i Filip care au avut o activitate misionar n prile Sciiei (deci i prin Dobrogea). Mrturii istorice din primele secole atest att martiri care au murit pentru religia cretin, ct i organizri ecleziastice. Din ce n ce mai mult oamenii de tiin recunosc rolul primordial al cretinismului n meninerea i extinderea romanitii. Aa dup cum foarte sugestiv a formulat recent concluziile sale prof. I. Fischer, cele dou limbi latine (cea a romanilor i cea a autohtonilor) ncep s devin una singur, i romanizarea se dezvolt cu dinamica ei proprie, devenind ireversibil (populaia nu avea o alternativ la care s se ntoarc, limba autohton nu mai era capabil s fac fa cerinelor unei viei civilizate). Chiar i dup prsirea Provinciei de ctre Aurelian, o parte a populaiei romane a rmas pe loc, dup cum i autohtonii romanizai au continuat s folosesc structura noii limbi achiziionate, limba latin n gur traco-dac, adic vorbit de ctre autohtoni. Limba latin nsuit de ctre autohtoni era latina vorbit, numit convenional latina vulgar i considerat limb comun de civilizaie. Folosirea ei a fost extins att prin migrri de populaie n afara perimetrului romanizat, ct i prin aculturaia triburilor nvecinate (Ibidem). Ea constituia, n varianta B, singurul mijloc de comunicare generalizat, folosit de grupurile chiar dispersate de populaie romanizat, nct migraiile popoarelor, cu deosebire ale celor din sec. VI-VII, nu i-au modificat structura. Aceasta ar fi imaginea schematizat a relaiilor ntre dou limbi aflate n relaii de strat-substrat. A B B
limba traco-dac (substrat) limba latin (strat) limba latin protoromn (faza de tranziie spre o limb neolatin)

Sistemul limbii care se extinde ca uz (limba B) nu rmne neatins, ci primete o serie de elemente din limba nlocuit; ele formeaz substratul limbii B (n faza istoric) = B. De exemplu:
88

locuitorii Daciei au nvat latinete i i-au prsit limba strmoeasc, astfel nct latina a nvins n cele din urm complet; elementele autohtone traco-dace formeaz substratul limbii romne. n Galia, unde latina de asemenea a nvins, substratul este format din relicte celtice. Substratul se manifest mai ales n fonetic i contribuie n bun msur la formarea specificului noii limbi rezultate n urma acestui amestec, prin sunete noi. De exemplu, n limba romn sunetul , un anumit fel de a pronuna sunetele i un anumit fel de a le accentua caracterizeaz aceast limb neolatin. Transmiterea se face prin nvare, specificul nu este ereditar i nu depinde de ras. Substratul exercit influen n toate compartimentele limbii, chiar n cele considerate nchise, ca morfologia i fonetica. Aceasta deoarece aciunea lui se sprijin pe punctele slabe ale sistemului numite, de E. Coeriu, de incompletitudine. Limbile antice, perpetuate doar prin elemente de substrat pstrate n limbi moderne, continu s fie puin cunoscute, deoarece de obicei lipsesc sursele directe de atestare a lor. Astfel, pentru delimitarea elementelor traco-dace din limba romn se folosete metoda comparativ istoric i se recurge la compararea cu limba albanez. G.I. Ascoli, lingvistul care a lansat conceptul de substrat, l-a caracterizat astfel: coninutul lingvistic al noiunii de substrat se dezvluie doar n opoziia acesteia fa de noiunile nrudire i mprumut. Tot ceea ce, n cadrul sistemului unei limbi, provine din sistemul iniial (sau a aprut datorit legilor interne de evoluie) reprezint elementul propriu, originar. Ceea ce a fost preluat din exterior, este mprumutat, strin. Or, elementele de substrat nu pot fi numite proprii pentru c ele nu in de sistemul primar, dar ele nu pot fi considerate nici strine, adic mprumutate, pentru c nu provin din exterior; substratul reprezint ceea ce un anumit mediu de vorbitori a reinut din sistemul anterior al limbii vorbite dup ce a trecut la o nou limb, cu un nou sistem. Substratul ptrunde n sistemul care se perpetueaz, profund i intim. El cuprinde toate laturile structurale ale limbii, iar intimitatea i profunzimea apropie relaiile de substrat de relaiile de nrudire. i substratul i nrudirea presupun legturi etnogenetice, adic caracteristice formrii unui popor. Substratul este legat de trecerea de la o limb la alta i constituie un proces complex i dificil. Acest proces include, ca o etap intermediar, o perioad ndelungat de bilingvism generalizat, colectiv. Iar un bilingvism durabil creeaz condiii pentru amestecul i interpenetraia de larg anvergur a celor dou sisteme. Specificul lingvistic al substratului poate fi elucidat numai pe terenul bilingvismului.
89

Cercetrile privind substraturile limbilor europene au stabilit c ele se datoreaz contactului direct oral. Roman Jakobson a analizat situaia substratului din fiecare limb romanic (substratul italic, ligur, retic, celtic, iberic, ilir i traco-dac); latina, limb dominant, a crei structur s-a perpetuat, reflect asimilarea limbilor respective realizat prin contacte directe, orale.
SUPERSTRAT

Dar n istorie au fost cazuri n care limba nvins (eliminat) nu a fost cea a populaiei autohtone, ci a populaiei ptrunse ulterior (prin mari deplasri migraii, prin cucerire sau prin ocupaie militar etc.) pe un teritoriu dat. Acetia, vorbitori ai limbii C, adopt treptat limba poporului pe care l-au gsit aezat n acel teritoriu i care are cel mai adesea superioritate cultural, nlesnind la rndul lor apariia unor tendine noi. Limba C a disprut, dar ea a lsat urme n limba B care a devenit, astfel, B. Urmele lsate de limba disprut C asupra limbii btinae B au fost denumite superstrat, cu un termen introdus de W.von Wartburg. Aici putem continua exemplul citat mai sus din istoria formrii limbii romne. n sec. VI-VII pe teritoriul Romniei de astzi au ptruns, venind dinspre nord-est i urmndu-i drumul spre sud-estul Europei, ajungnd pn la Salonic, triburile slave. Ca orice popor migrator, au venit n eaua cailor, civilizaia lor fiind mai puin evoluat dect cea a btinailor. Prin urmare, dei popor cuceritor, slavii au fost asimilai, n zona rii noastre, de ctre btinaii romanizai, slavii nvnd limba acestora. La rndul lor, ei au transmis elemente din propria lor limb, care au fost asimilate de ctre limba romn, al crei proces de formare s-a ncheiat, astfel, n sec.VII-VIII la fel, de altfel, ca al majoritii limbilor europene. Contribuia limbii slave la desvrirea formrii limbii romne formeaz superstratul, care a transmis protoromnei elemente din toate domeniile limbii, fr s influeneze ns structura latin. Imaginea grafic a raportului strat-superstrat este aceasta: B
limba latin-protoromn (strat)

B
limba romn

limba slav (superstrat)

90

Prin urmare, limba romn este limba latin vorbit nentrerupt n spaiul daco-moesian, al Dardaniei i n sudul Panoniei (ap. A. Rosetti). Conceptul se justific prin numeroase exemple: limba slavilor, la contactul cu populaia romanic din Dacia, a disprut, dar a lsat urme n limba romn. Limba francilor a lsat urme asupra latinei din Galia, dup cderea Imperiului Roman. Mai menionm superstratul normand, vechi francez, pentru limba englez sau cel turanic pentru limba bulgar (slav). Substratul i superstratul ca procese pe care bilingvismul le convertete n rezultate s-au produs n perioada glotogenezei, a formrii limbilor. Din punctul de vedere al limbii care iese nvingtoare = stratul, substratul i superstratul ar fi egale, ambele reprezentnd introducerea din afar a unor elemente alogene. Totui, nu poate avea aceleai urmri faptul dac cea care renun la limba sa este minoritatea victorioas, dominatoare, acceptnd mai devreme sau mai trziu limba populaiei supuse, dar care are prestigiul culturii, sau dac majoritatea cucerit adopt limba unei minoriti cuceritoare. Din punctul de vedere al lingvistului care ncearc s reconstituie cum se schimb o limb, faptul c pentru fenomenele de superstrat participanii (limba nvingtoare i limba nvins) sunt cunoscui plaseaz rezultatele ntr-o alt categorie dect elementele de substrat n care procesul poate fi, n cel mai bun caz, doar presupus. Majoritatea lingvitilor consider c elementele de substrat determin unele modificri n sistemul unei limbi, n timp ce elementele de superstrat se manifest doar ca mprumuturi foarte vechi.
ADSTRAT

Influenele suferite de o limb dup constituirea ei ca idiom nou, distinct, formeaz adstratul. Dup prerea lui L. Deroy, adstratul este rezultatul unui simplu contact regulat i constant ntre dou limbi vecine. Dei nu particip ca substratul i superstratul la formarea unei limbi, adstratul include toate formele de manifestare ale contactului lingvistic (inclusiv de la distan) dintre limbi. Aici sunt mai evidente interferenele generate de bilingvism, deci procesul ca atare n desfurare, pe cnd substratul i superstratul, dei procese de interferen la vremea lor, astzi se prezint doar ca rezultate n limb. n ceea ce privete raportul dintre factorii extralingvistici: politici, sociali, economici, culturali i geografici, i cei strict lingvistici rolul sistemelor limbilor n contact la care ne-am referit mai sus n cazul interferenelor interlingvistice, el este complicat i
91

deseori paradoxal. Lingvitii iau n considerare diverse exemple din istoria unor limbi europene n care situaii extralingvistice mai mult sau mai puin identice au condus la rezultate diferite (Sala, p.42). n statul francez de dup Clovis (sec.VI d.Hr.), preponderena politic i social era de partea francilor. Totui, n vechea Galie limba romanic a ctigat, avnd de partea ei prestigiul cultural, n timp ce limba germanic a francilor a lsat urme slabe n limba francez. O situaie diametral opus a avut loc n sudul Dunrii, unde populaia romanic, la invazia slavilor, n sec.VI-VII, era din punct de vedere cultural superioar invadatorilor, care au cucerit ns supremaia politic i social. Populaia romanic s-a perpetuat n insule lingvistice. Iar n limbile slave sud-dunrene elementele latine i romanice s-au pstrat sub form de reminiscene. n Anglia preponderena anglo-saxonilor asupra celilor nu a fost prea mare, i totui s-a produs germanizarea limbii; urmele celtice sunt minime. Dup cucerirea Angliei de ctre normanzii ce vorbeau franceza, n ciuda preponderenei politice i sociale i a legturilor strnse cu continentul, limba celor nvini a sfrit prin a nvinge, rezultatul fiind doar mprumutarea unor termeni din francez (limba nvingtorilor). Prin urmare, n perspectiv istoric, rezultatele nu pot fi previzibile n fiecare caz n parte al limbilor aflate n contact. Ceea ce trebuie avut n vedere n cadrul acestor analize este factorul timp, adic perioada istoric n care a nceput procesul de interferen, perioad istoric reflectat att la nivelul factorilor extralingvistici, ct i al istoriei limbilor respective i care conduc la diferenierea rezultatelor. E. Coeriu a explicat aspectele diacronice ale contactului lingvistic pornind de la conceptul c limba este un sistem n micare care tinde spre un echilibru a elementelor componente i implic astfel ideea de schimbare lingvistic. Se poate observa c transformrile suferite de structura limbii se datoreaz modului cum este ea organizat; multe dintre transformrile din limb au cauzele n nsi structura ei. i ideea central a colii lingvistice de la Praga este conceperea limbii ca un sistem n micare, niciodat perfect, i n care se manifest deosebiri ntre componentele centrale i cele periferice (ceea ce determin o asimetrie). Tocmai aceast asimetrie face posibile att variaiile individuale (la nivelul vorbirii), ct i variaiile sistemului limbii de la o epoc la alta. i astfel se poate manifesta interferarea aciunilor unor structuri diferite. Pentru c limba este un systme o tout se tient, este evident c mprumutul lingvistic, oricare ar fi domeniul cruia i aparine, are o
92

anumit influen asupra limbii care l recepteaz, n ntregul ei sistem. Prin intermediul cuvintelor mprumutate ptrund n sistemul fonologic, morfologic sau derivativ elemente din alte limbi care, pentru a se transforma n elemente ale sistemului limbii receptoare, trebuie s fie adaptate fonetic i ncadrate morfologic n cadrul acelui sistem. Astfel, un fapt de evoluie, de exemplu n limba romn, poate fi explicat: a. printr-o tendin intern, atestat deja n latin sau n alte limbi romanice sau balcanice; b. prin invocarea unei influene externe. Unele evoluii interne pot s fie ntrite n urma contactului dintre limbi. Exist o serie de fenomene lingvistice (de exemplu apariia unor sensuri noi la unele cuvinte sau a unor derivate), care pot fi considerate rezultate att ale contactului ntre limbi, ct i ale dezvoltrii unor tendine interne. Dificultatea de a atribui anumite fapte lingvistice unor influene strine sau/i unei evoluii proprii a determinat apelul la un concept nou, lansat de Meillet, cel de convergen. El difereniaz astfel de situaii fa de cele datorate interferenei. De exemplu, derivate cu sufixe de origine francez pe terenul limbii romne (n cazul cuvintelor cu familie numeroas): derivate cu sufixul -mnt, care este motenit n cuvinte ca acopermnt sau este de natur neologic, n forma -ment, n cuvinte derivate cum ar fi comandament sau mprumutul cuvntului omonim din limba francez. Se prefer explicaia multipl. Referitor la substrat, invocat drept singur cauz a evoluiei divergente a limbilor, au aprut rezerve pe msur ce metodele de analiz au progresat i a aprut probant ideea c o structur lingvistic poart n ea nsi o parte dintre cauzele care contribuie la propria sa rennoire (A.Martinet). Diminuarea importanei acordate substratului se bazeaz pe dou principii metodologice: principiul explicaiei interne i principiul explicaiei generale. n explicarea unor evoluii fonetice sau morfologice este preferabil apelul la tendine generale de evoluie dect la explicaii speciale, pentru fiecare caz n parte (Sala, p.47). De asemenea, modificarea n sistem trebuie s se produc n sens pozitiv. Altfel spus, simpla pierdere a unei categorii (sens negativ), (de exemplu a unei opoziii fonologice, a unei categorii gramaticale sau a unei distincii semantice) nu este suficient pentru a dovedi o aciune modificatoare a unei limbi asupra alteia. Aceasta deoarece simplificarea unui sistem se poate datora i slbirii tradiiei sau normei lingvistice. O distincie foarte important ntre cele trei situaii ale bilingvismului este faptul c substratul afecteaz orice parte a gramaticii, n timp ce superstratul i adstratul influeneaz doar
93

vocabularul, derivarea i topica. O analiz a adstratului n toate limbile romanice precizeaz c doar adstratul grec a avut un rol deosebit. n ceea ce privete rolul superstratului, W.von Wartburg a analizat influena superstratului germanic n nordul Italiei i estul Galiei, care a condus la fragmentarea lingvistic a galoromaniei i iberoromaniei, precum i la mprirea dialectal a Italiei. De exemplu, n limba francez tipurile de transformare atribuite superstratului germanic sunt: pstrarea prelungit a declinrii bicazuale; tendina antepunerii adjectivului atributiv (mai ales la numele de culori n franceza veche); folosirea obligatorie a pronumelui personal n flexiunea verbal (aceasta nu numai n francez, ci i n retoroman i n dialectele galoitalice), topica SVO (subiect-verb-obiect) n franceza veche i retoroman; neutralizarea opoziiei de aspect, perfectivimperfectiv, n franceza veche. W.von Wartburg a susinut c superstratul germanic a dus la formarea limbilor romanice occidentale, dup cum superstratul slav caracterizeaz limba romn. Rezultatele contactului trebuie s aib n vedere justa clasificare a faptelor de limb. De exemplu, numeralele sunt considerate de muli lingviti fapte de vocabular, dar numeralele compuse ntre 11-19 sunt distribuite la formarea cuvintelor. De asemenea, adverbele i interjeciile sunt ncadrate la morfologie, dar muli le consider fapte de vocabular sau de sintax. Pentru caracterizarea just a rezultatelor contactului lingvistic este necesar, de asemenea, distincia dintre: a. fapte de inventar; b. fapte de distribuie. Marius Sala (Limbi n contact, p. 51-56) a alctuit pentru prima dat un tablou sinoptic al situaiilor posibile de contacte, pe care l avem n vedere n urmtorul model sintetic comentat. S urmrim rezultatele contactelor interlingvistice: a. ntre idiomuri romanice; b. ntre idiomuri romanice i neromanice. De asemenea, s le urmrim la acelai nivel al limbii: standard sau dialectal. Sunt notate cu S = limbaj standard, D = limbaj dialectal, R = idiom romanic, NR = idiom neromanic. Surprindem urmtoarele combinaii posibile:
a-1 SR SR = a-2 SR DR = a-3 DR SR = 94 ntre idiomuri romanice standard; franceza-romna/italiana-retoromana. Influen la nivelul lexicului, dar i n sintax i fonetic. limb oficial dialect romanic; romna-dialectul friulan / catalana-dialectul aragonez / italiana-dialectul istroromn. Influen la nivelul lexicului. din dialect n limb oficial; dialectul castilian spaniol. Influen la nivelul lexicului.

a-4 DR DR = b-1 SR SNR =

b-2 SNR SR =

b-3 SRDNR =

b-4 SNRDR =

b-5 DRDNR =

b-6 DNRDR = b-7 DRSNR = b-8 DNRSR =

n zon de grani lingvistic, contact direct / ntre dialectele spaniole-portugheze, apar dialecte mixte; rezultatele sunt profunde i afecteaz sistemul fonologic. influena limbilor francez, italian, spaniol etc. asupra altor limbi europene germana, engleza sau unor limbi africane. Influen la nivelul lexicului. Cazul Romaniei pierdute, teritorii din sud-estul Europei pe care s-a vorbit o limb romanic, din care au rmas doar urme n lexicul i toponimia idiomurilor neromanice. cazurile de substrat sau superstrat al limbilor romanice; afecteaz structura limbii romanice. Influena limbilor englez, german, arab, olandez etc. limbi romanice. Influen la nivelul lexicului. limba romanic dialect neromanic din limbile respective; romna dialectele maghiar, ssesc i al vabilor, bulgar, ucrainean etc.; franceza dialectul german din Alsacia sau Belgia; italian dialectul german din nordul Italiei sau din Elveia. Influen la nivelul lexicului. limb neromanic dialect romanic; germana dialecte italiene sau dialectul francez din Alsacia; engleza dialectul francez din Canada. Influen la nivelul lexicului. (Greu de stabilit diferene fa de b-3). contacte de confluen geografic; dialecte italiene dialecte germane; graiuri daco-romne dialecte maghiare, germane sau slave; condiiile de bilingvism prelungit conduc la modificri la nivelul sistemului fonologic i a lexicului. (Greu de stabilit diferene fa de b-6). dialecte neromanice din Romnia graiurile limbii romne. Modificri la nivelul sistemului fonologic i a lexicului. grai daco-romn limba maghiar standard, limba german standard etc. vorbite n Romnia. Influen la nivelul lexicului. dialect ssesc .a. limb romn standard. Influen la nivelul lexicului.

Ideea cauzalitii multiple (agreat de tot mai muli lingviti) invoc factorii externi numai cnd nu se poate gsi o soluie prin criterii interne. Cercetrile extinse din ultimele decenii permit s se afirme astzi c, n general, n domeniul romanic nu s-au produs modificri ale
95

structurii idiomurilor romanice sub influena altor limbi. Nici romna vorbit n R. Moldova nu i-a modificat structura romanic a sistemului su sub presiunea limbii ruse. i n cazul spaniolei americane (ai crei vorbitori sunt perfect bilingvi) elementele mprumutate din limba englez sunt periferice n structura fonologic i morfologic, i mai numeroase doar n domeniul vocabularului. mprumutarea unor cuvinte care nu se adapteaz la sistemul fonologic i / sau morfologic al limbii receptoare au sfrit prin a introduce elemente noi de inventar fonologic: fonemul /h/ n romn din slav i n francez din german; // n spaniola din Mexic sau // n iudeo-spaniol.
INTERFEREN I CONVERGEN

Termenul de interferen, folosit n fizic i n psihologie, ce exprim influena ntre dou procese, dou micri etc. a fost preluat cu acelai sens i n lingvistic. Interferena este caracterizat prin schimbrile sub influena unor factori lingvistici din alt limb, n timp ce schimbrile interne ale fiecrei limbi aflate n contact, evoluia proprie a fost denumit convergen (Sala, p.47). Opoziia ntre limb ca sistem nchegat, stabil, i vorbire actualizare aproximativ a acestui sistem, nu ne permite s vorbim de interferen ntre dou limbi (langue). Interferena este caracteristic pentru mesaj, dar nu pentru cod. Pe de alt parte, ca i n fizic i n psihologie, i n lingvistic interferena are sens dublu sub un alt aspect, i anume este n acelai timp un proces, dar i rezultatul acestui proces. Interferena-proces are loc n actul vorbirii; interferena-rezultat-consecin poate fi demonstrat printr-o expresie atestat, scris i poate fi considerat ca un fapt de limb. Aceasta poate prea n contradicie cu afirmaia c limba este strin de interferene. De aceea, pentru a folosi corect termenul de interferen-rezultat trebuie s apelm la consideraii sociolingvistice. Cnd un grup de vorbitori vorbesc limba A i folosesc n mod regulat elemente din limba B, care sunt prin originea lor dintr-o limb non-A, putem considera c este vorba de o interferen n actul de vorbire. U. Weinreich considera c interferena lingvistic se produce n primul rnd n vorbire i abia apoi n limb. Numai n vorbire ea apare n expresiile bilingvului, ca rezultat al faptului c el stpnete n mod individual i o a doua limb. n schimb, n limb nu se ntlnesc fenomene interesante care s confirme folosirea aparent frecvent n vorbirea unui bilingv, dar care nu rmne mult timp sub influena bilingvismului. Aceasta pentru c un mprumut din limba Y, folosit de
96

un vorbitor al limbii X, numai pentru c l-a auzit de mai multe ori, din punct de vedere descriptiv nu poate fi considerat ca fcnd parte propriu-zis din limba X. Problemele de interferen sunt tratate n mod foarte diferit n lingvistic. Pe baza concepiei lui F. de Saussure referitoare la lingvistica intern, opus lingvisticii externe, mprumutul nu este un fenomen acceptat direct n limb: cuvntul mprumutat nu apare n aceast postur dect dup ce a fost introdus n noul sistem, pentru c el nu exist dect prin opoziie cu alte cuvinte, care sunt anterioare lui n sistemul limbii respective. Dar, pe de alt parte, fiecare mbogire i fiecare srcire a sistemului conduce la reorganizarea tuturor vechilor opoziii distinctive ale sistemului. Deci, interferena se raporteaz sub acest aspect i la lingvistica intern. Lingvistica american a fcut un efort pentru a depi problema mprumutului n scopul de a-l putea considera fapt de interferen. E. Sapir i L. Bloomfield au lansat ideea rolului limbilor cu prestigiu cultural i social mai ridicat n procesul de interferen. E. Sapir a demonstrat c limbi de mare propagare cultural (greaca veche, latina, chineza) pot mprumuta un numr considerabil de lexeme altor limbi, fr a primi nimic n schimb. Dar principalele probleme referitoare la interferen considerm c sunt cele care i propun s studieze efectul i dimensiunile la care poate ajunge aceasta. Limbile se influeneaz una pe alta, dar valurile de interferen produse de cele dou surse diferite ajung s se anuleze una pe alta la nivelul exterior al limbii (adic nivelul lexical i fonematic). Dac aceste valuri penetreaz ns pn la nucleul morfologiei, interferena este deja destul de tare i ea modific structura limbii care o recepioneaz. n perioada de interferen ntre dou structuri lingvistice n contact nu exist totui limite pentru mprumut n ceea ce privete vocabularul, sunt de acord toi lingvitii. n ceea ce privete interferena morfologic, ea se exprim prin limbi mixte, n care morfologia este foarte redus, adic acolo unde multe din particularitile care distingeau dou sau mai multe limbi s-au pierdut (Vendryes, p.309). Diversele forme de interferen sunt supuse unor presiuni diferite n funcie de diferitele niveluri (fonologic, morfologic sau sintactic). Ele pot fi considerate ns toate ca o consecin a adaptrii lexemelor strine. E.Haugen este cel care a sugerat ipoteza c, de fapt, interferena lexical este cea care antreneaz toate celelalte categorii de interferen.
97

Cei mai muli lingviti se opun acum termenului de mprumut (borrowing) considerat ca o supersimplificare a problemei i care ar mistifica mecanismul structural de interferen. Pentru a analiza formele acestui proces este necesar s prsim principiul unitii fundamentale ntre form i coninut (foneme i semanteme), definite n interiorul fiecrei limbi, prin opoziia cu alte foneme i semanteme ale celeilalte limbi. Dar n analiz trebuie s avem n vedere cele trei forme principale distincte de interferen: fonetic, gramatical i lexical. n accepia lui A.Martinet, nu trebuie s ne ateptm la recunoaterea unitii primei articulaii dintre limba A i limba B pentru a admite existena interferenei pe planul celei de a doua articulaii. Acest lingvist insist asupra existenei interferenei gramaticale, opunndu-se astfel celor care consider c dou sisteme gramaticale nu pot s se influeneze unul pe altul dect superficial. n ceea ce privete interferena lingvistic ntre limbile sud-est europene, atragem atenia c este un caz particular, care se refer n acelai timp la mai mult de dou limbi. Acest aspect complic relaiile reciproce ntre limbile care vin n contact. Este aproape imposibil de demonstrat limba surs de interferen i limba int de interferen, cci raporturile lingvistice n acest spaiu cnd avem de-a face cu Uniuni lingvistice (v. supra p.59) nu sunt numai bilaterale. Exist totui fenomene tipice, pentru care se poate stabili sursa, de exemplu, articolul postpus, sincretismul dativului cu genitivul, formele de viitor se gsesc n latina vulgar sau n greaca medie. Reduplicarea pronumelui, tendin cunoscut n limbile romanice, de asemenea i are originea n latina vulgar. n acelai timp ns, se consider c este dificil s demonstrm balcanisme de origine slav. Dac ne preocup nu att sursa unui fenomen, ci direciile n care el s-a rspndit n mai multe limbi, exist posibilitatea s gsim intermediarul ntr-o a treia limb, de exemplu, influena turc asupra limbii romne s-a datorat, de multe ori, intermediarului bulgar. Acest stadiu specific de interferen se datorete faptului c pe un teritoriu relativ restrns au existat contacte strnse ntre populaii cu limbi foarte diferite. Teritoriul care a reprezentat centrul de propagare a valurilor de interferen este considerat a fi cuprins limbile albanez, bulgar i romn, n timp ce limbile greac, srb, croat i turc sunt periferice. Dar aceast afirmaie este evident cnd avem n vedere limbile standard luate n totalitatea lor i nu dialectele vorbite n aceste teritorii. Pentru c dialectele greceti din nord, din Epir i Macedonia,
98

aparin cu siguran acestui nucleu prin analitismul lor mult mai evoluat n raport cu greaca comun i permeabilitatea mai accentuat pentru elementele slave, albaneze etc.; la fel dialectele srbei de est posed n mai mare msur particulariti datorate interferenei balcanice dect limba srb i croat n general. Particularitatea principal a interferenei ntre limbile balcanice este faptul c ea a atins nivelul fundamental al structurii lingvistice. Prin aceasta s-a fcut proba c de fapt interferena ntre limbi depete straturile superficiale. Diasistem. Cercetarea structuralist a interferenei lingvistice a impus folosirea unui concept nou, anume diasistem, care unific uniti comune a dou sisteme. U.Weinreich consider c lingvistica structural are nevoie de noiunea de sistem cu un nivel superior sistemelor omogene i abstracte ale unei limbi. Diasistemul face evident rezultatul faptului c dou sisteme, avnd similitudini pariale, pot fi analizate, deoarece el constituie de fapt un aspect diferit de suma a dou sisteme. Diasistemul este o realitate vie pentru vorbitorii bilingvi. Existena interferenei sugereaz c individul bilingv posed cunotine superioare unui singur sistem, fr ns a ajunge s dispun n mod complet de dou sisteme lingvistice. n acest sens este nevoie pentru lingvist s poat folosi parametri de analiz ai unui asemenea sistem care este mai larg, apt s nglobeze cele dou constituente. i acest concept este cel de hipersistem, propus de K.Pike, care constituie locul n care se produce amestecul lingvistic: unitile comune sugereaz existena unui sistem complex. n scopul de a analiza rezultatele interferenei St.Ullman a sugerat existena chiar a unui al treilea sistem (de fapt, similar hipersistemului) n care sunt amestecate elemente distinctive ale limbii materne i ale limbii strine. Acesta ar fi un diasistem complex.
BIBLIOGRAFIE Gr. Brncu, Cercetri asupre fondului traco-dac al limbii romne, Biblioteca Thracologica, VII, Bucureti, 1995. Marcel Cohen, Pour une sociologie du langage, Ed. Albin Michel, Paris, 1956, p. 271-306. Eugeniu Coeriu, Introducere n lingvistic, Ed. Echinox, Cluj-Napoca, 1995. I. Lobiuc, Contactele dintre limbi, vol.I, Ed. Universitii Al.I.Cuza, Iai, 1998, p. 220. 99

Marius Sala, Limbi n contact, Ed. Enciclopedic, Bucureti, 1997. Tratat de lingvistic general (T.L.G.), sub redacia Al. Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucure ti,1971, p.520-540. J. Vendryes, Le langage. Introduction linguistique lhistoire, Paris, 1968. W. von Wartburg, Problmes et mthodes de la linguistique, Paris, PUF, 1963. CHESTIONAR 1. Ce se nelege prin contact lingvistic? 2. Care sunt tipurile de contacte lingvistice? 3. Ce nseamn bilingvism? 4. Numii civa factori ai ambianei social-culturale a contactului lingvistic. 5. Caracterizai conceptul de substrat. 6. Caracterizai conceptul de superstrat. 7. Care este specificul mprumutului ce formeaz adstratul? 8. n problema raportului dintre factorii extralingvistici i cei lingvistici n cadrul interferenelor, dai exemple de situaii istorice similare care au condus la rezultate diferite n istoria limbilor. 9. Caracterizai o situaie posibil de contact lingvistic din tabloul sinoptic. 10. Caracterizai trsturile definitorii ale interferenei. 11. Definii conceptul de convergen.

100

LINGVISTICA SPAIAL. RAMIFICAIILE SAU UNITILE TERITORIALE ALE LIMBII

Studierea limbii a nceput prin intermediul studiului textelor i interesul s-a ndreptat spre limbile clasice sanscrita, greaca, latina, , care erau ns limbi moarte. Studiul limbii n aceast perspectiv este denumit filologie interpretarea textelor sau cum o denumete Martinet, cea mai dificil dintre arte: arta de a citi. Filologul voia s cunoasc semnificaia a ceea ce este conservat prin scris. Aceasta este cea mai veche dintre tiine, dar este i slujitoarea altor tiine, pentru c cercetarea unui text se face n scopuri diferite de ctre lingviti, istorici ai dreptului, ai religiei, literaturii, filosofiei etc. Limbile vii, vorbite, au fost neglijate pn la mijlocul secolului al XIX-lea, considerndu-se c ele reprezint forme corupte ale limbii ideale. Folosirea metodei comparativ-istorice (se fcea comparaia ntre limbi nu numai n perspectiv static, deci sincronic, ci s-a ncercat reconstituirea formei anterioare, fazei indoeuropene) s-a bazat, de asemenea, integral pe texte. August Schleicher a prezentat descriptiv i istoric o limb popular neliterar lituaniana urmrit pe teren, n formele ei vorbite (Mounin, p.133). El a fost unul dintre primii lingviti care a analizat limba n perspectiva evoluiei i a diversificrii, bazndu-se pe studiul fenomenelor din limbile vii. Or, acestea corespund unor limbi vorbite pe un anumit teritoriu, prin urmare studiul limbii naionale nseamn studiul limbii vorbite ntr-o unitate teritorial, limb comun a unui popor.
101

LIMB / DIALECT / SUBDIALECT (GRAI)

Limbii i se subordoneaz dialectul, care reprezint aspectul particular (regional) a limbii unui popor, caracterizat printr-un minimum de trsturi specifice. Subsumat dialectului este subdialectul (graiul), care la rndul lui reprezint aspectul particular (local) al limbii unui popor, caracterizat printr-un minimum de trsturi specifice. Diferenierile se datoresc, deci, spaiului mai mult sau mai puin extins pe care se folosete dialectul (graiul) respectiv, fenomenul caracteriznd procesul de diversificare a limbii. La ntrebarea dac dialectul este o form incipient a unei limbi comune sau o form derivat (prin diversificare), unii lingviti au optat pentru prima formul, iar alii pentru cealalt. Aceste rspunsuri sunt n legtur i cu problema, nc nerezolvat, a lingvisticii comparate, i anume, dac toate limbile globului au derivat dintr-o singur limb comun originar (protolimb) (teoria monogenezei) sau, din contr, diversele tipuri de limbi au aprut n diferite zone ale globului, independent unele de altele (teoria poligenezei). Dup prerea celor mai renumii lingviti ai secolului nostru, aceast problem va rmne, totui, fr o soluie definitiv. Pentru c elementele comune, corespondenele care se ntlnesc n toate limbile, n ciuda marilor diferene, atest faptul c ele se datoresc unei activiti similare a gndirii raionale umane. Deoarece cursul nostru se adreseaz studenilor care studiaz i limbi romanice, exemplificarea va fi din acest domeniu. Pentru fazele istorice ale limbilor, transformarea unei limbi clasice n limb naional a avut loc de-a lungul mai multor secole, n condiiile formrii statelor. Astfel, latina st la baza limbilor romanice, limba slav comun la baza limbilor slave moderne etc. n ceea ce privete limbile romanice, n rspndirea teritorial, Iorgu Iordan enumer zece entiti: romna, dalmata, italiana, retoromana, sarda, occitana, franceza, catalana, spaniola i portugheza. Teritoriul din Europa locuit de popoarele care vorbesc aceste limbi se numete Romania (teritoriu romanic) cu un termen din limba latin creat n ultimul secol de existen a imperiului roman (< lat. romanicus).
102

Exist mai multe clasificri ale limbilor romanice: 1. n funcie de gradul de fidelitate fa de tradiia latin (din acest punct de vedere franceza este cea mai puin romanic dintre toate continuatoarele limbii latine); 2. pe baza unitilor geografice. Carlo Tagliavini consider c exist patru grupuri: a. romanica balcanic (romna); b. romanica italic (dalmata, italiana, sarda i retoromana); c. romanica galic (franceza i provensala); d. romanica iberic (catalana, spaniola i portugheza); 3. o clasificare bazat pe criterii lingvistice, care au n vedere asemnrile i deosebirile de natur structural, mai ales de morfologie, dintre limbile romanice. Pe baza acestor criterii se consider c exist un grup oriental (romna i dalmata) i unul occidental (italiana, sarda, retoromana, franceza, provensala, catalana, spaniola i portugheza). Prin evoluia vorbirii, toate aceste limbi, dei sunt limbi comune n cadrul teritoriului pe care sunt folosite, prezint deosebiri de la o regiune la alta, n cadrul lor exist varieti regionale i locale (dialecte i graiuri). Ne propunem s urmrim diversificarea teritorial a principalelor limbi romanice. Limba romn are patru dialecte: 1. dacoromn, vorbit n Romnia, Republica Moldova, de-a lungul Dunrii, n partea de sud, n Bulgaria, Serbia i n zonele limitrofe graniei cu Ungaria i Ucraina; de asemenea, n toate continentele n cadrul colectivitilor de diaspor romneasc; 2. aromn sau macedoromn, vorbit n sudul Dunrii de colectivitile aromne din Grecia, Bulgaria, R. Macedonia, Serbia, Albania, precum i pe teritoriul Romniei; de asemenea, n toate continentele n cadrul colectivitilor aromneti de diaspor; 3. meglenoromn, vorbit n sudul Bulgariei, n R. Macedonia i pe teritoriul Romniei; 4. istroromn, vorbit n Peninsula Istria din nordul Mrii Adriatice. Limba italian grupeaz, din punct de vedere lingvistic, dialectele astfel: a. Nordice (numite i galo-italice): 1. genovez; 2. piemontez; 3. lombard; 4. emilian (n zona Bologna, Ferrara); 5. venet (veneian), cu subdiviziunile padovan i veronez. Apeninii despart aceste dialecte de cele centrale.
103

Rspndirea dialectelor aromn (macedoromn) i meglenoromn n Peninsula Balcanic (dup Matilda Caragiu Marioeanu, Compendiu de dialectologie romn (nord- i sud- dunrean), Bucureti, 1975, harta 35, cu unele completri).

b. Centrale: 1. toscan (florentin, folosit de Dante, Petrarca, Boccacio); 2. marchizan; 3. umbric; 4. roman; 5. corsican. c. Meridionale: 1. abruzzez; 2. napolitan; 3. apulian; 4. calabrez; 5. sicilian. Limba francez este vorbit pe ntreg teritoriul Franei, ale crei granie le depete n Belgia i n ducatul Luxemburg. De asemenea, este limb oficial n Canada, n Elveia; constituie limb alternativ n Algeria, Maroc i Tunis, de asemenea n Haiti i n Antilele Mici. n Frana sunt difereniate opt dialecte: 1. poitevin (n Poitou); 2. normand; 3. picard; 4. vallon; 5. loren; 6. champenois; 7. burgundic; 8. francien (n le-de-France).
104

Aria actual a dialectului istroromn (dup S. Pucariu, Limba romn, harta 20, cu unele modificri i completri) (satele istroromne sunt reprezentate printr-un punct iar numele lor sunt subliniate) (*)

Limba occitan este vorbit n jumtatea de sud a Franei, grania dintre ea i francez trece de la vest, de la Oceanul Atlantic, de-a lungul fluviului Gironde, apoi urmeaz o linie paralel cu Dordogne (pn la Libourn), continund spre nord-est pe lng Angoulme, spre nord pn la Rochefoucault, orientndu-se spre est, n departamentul Vienne, de-a lungul rurilor Indre-Allier, cobornd spre sud-est pn la St. Etienne, de-a lungul fluviului Ron, apoi spre est, de-a lungul rului Isre pn la grania cu Italia.
105

Limbi i dialecte n Italia (dup C. Merlo, Lingue e dialetti dItalia, Milano, 1937, p. 4) 106

Teritoriul lingvistic occitan (dup G.B. Pellegrini, Appunti di Grammatica storica del Provenzale, Pisa, 1958)

Dialectele occitane sunt: 1. gascon; 2. languedoc; 3. limousin; 4. auvergnat; 5. provensal; 6. valdens. n inuturile elveiene se vorbesc graiuri franco-provensale. Limba catalan este mprit n dialectul nordic, vorbit n Catalonia, i dialectul sudic vorbit n Valencia. Limba spaniol este vorbit att n Spania i Insulele Canare, ct i n statele din America de Sud (Columbia, Venezuela, Peru, Ecuador, Chile, Paraguay, Uruguay, Argentina), i America Central, unde este foarte unitar (n Mexic, Cuba, Porto-Rico i Republica Dominican). Evreii spanioli din rile sud-est europene, din Maroc i din Israel folosesc limba spaniol-sefard.
107

Limbi i dialecte n Peninsula Iberic (dup W.J. Entwistle, The Spanish Language together with Portuguese, Catalan and Basque, Londra, 1936).

n Spania sunt difereniate patru dialecte: 1. asturic-leonez; 2. castilian; 3. aragonez; 4. andaluzian nainte de secolul al XIX-lea expresia vorbit, popular, a fost considerat un aspect corupt; latina vulgar, popular, era considerat forma decadent a limbii latine scrise. Dispreul fa de formele limbii vorbite, dialectale, se explic istoric prin faptul c n timpul Evului Mediu, instituiile laice i ecleziastice au dus o lupt nentrerupt pentru unificarea ntr-o limb unitar, comun, a aspectelor locale dispersate i nenormate care luau locul latinei. Lingvitii i-au dat seama apoi c dialectele au conservat totui stadii fonetice vechi, forme morfologice i cuvinte care dispruser ntre timp din limba comun, oficial. De aceea, studiul dialectelor i al graiurilor a devenit foarte important pentru istoria oricrei limbi. Limba este un fenomen social i mijloc de comunicare, deci raporturile dintre formele dialectale (ale graiurilor) i limba cultivat, normat se formeaz i se remprospteaz nentrerupt i n zilele noastre prin schimburi constante ntre deprinderile dialectale ale vorbi108

torilor, pe de o parte, i limba (naional) standard, vorbit i scris, pe de alt parte. i n mediul urban persist deprinderi dialectale. Diferenele dintre limb/dialect se evideniaz pe diferite trepte de subordonare. Un dialect al unei limbi, n anumite mprejurri istorice, se poate ndeprta de limba comun datorit unor presiuni extralingvistice, dar i unor factori lingvistici i poate deveni, la rndul lui, o alt limb. Criteriile de stabilire a statutului limb/dialect au un caracter social-politic, apartenena populaiei la un grup etnic, teritorial, n funcie de unitatea sau diversitatea aspectelor limbii comune i a tradiiilor culturale. Singure argumentele lingvistice nu sunt concludente pentru distincia limb/dialect. Aceeai limb poate fi vorbit n state diferite, de exemplu limba francez din Canada sau dialectul canadian al limbii franceze, fr a fi considerat o entitate separat, ca limb canadian. Permeabilitatea limb/dialect/grai se face prin instrucie (coal i lectur) i mass-media; tendina este de unificare n limba comun standard. Studiul dialectelor (care se face n cadrul disciplinei lingvistice numit dialectologie) se bazeaz pe metodele: a. descriptiv (monografii dialectale care au n vedere limba vorbit dintr-o zon mai mult sau mai puin extins, descris parial din punct de vedere fonetic, morfologic, lexical i sintactic sau n toate aspectele sale). b. a geografiei lingvistice. Metoda geografiei lingvistice const n nregistrarea punctual pe hri, n dreptul localitilor cercetate, a fiecrui rspuns (cu specific fonetic, morfologic, lexical sau sintactic) la anchetele directe sau indirecte. Pe suprafaa hrii rspunsurile identice configureaz arii dialectale. Aceast metod a revoluionat perspectiva asupra istoriei limbilor. Ea a fost folosit de lingvistul german Georg Wenker, care a trimis tuturor nvtorilor din Renania, n 1876, un chestionar cu 40 de fraze (cam 300 de cuvinte) pentru ca acetia s le traduc n graiul local, adic s rspund n scris cum se pronun fraza n expresia local, vorbit. El a primit cca 44.000 de rspunsuri, pe care le-a notat pe hri, localiznd fiecare expresie acolo unde se folosete. ns aceste hri nu le-a putut tipri n timpul vieii sale. n 1877 i B.P. Hasdeu a trimis n toate satele din Romnia un Chestionar lingvistic cu ntrebri referitoare la modul n care se pronun unele cuvinte n vorbirea local sau la cuvintele locale care se folosesc pentru concepte generale. El a primit mii de rspunsuri care se pstreaz n 18 mape la Biblioteca Academiei i reprezint un tezaur inestimabil pentru studiul istoriei limbii romne.
109

n anii 1900-1902, Jules Gilliron, profesor la Sorbona, a considerat c este necesar vizitarea de ctre aceeai persoan a tuturor localitilor, pentru a nregistra de o manier unitar vorbirea din diferitele zone ale Franei. Pentru ancheta pe teren el a folosit pe Edmond Edmont, care a nregistrat rspunsurile, iar n anii 1902-1910 a fost tiprit lAtlas linguistique de la France. n fiecare localitate au fost nregistrate cuvinte care aparin numai vocabularului ranilor din acea localitate, cuvinte din vocabularul ranilor care aparin unei zone mai largi i 100 de fraze simple, pentru depistarea particularitilor morfologice i sintactice. Aplicarea metodei geografiei lingvistice a condus spre concluzia c nu exist dialecte pure i c graniele sunt de fapt arii de tranziie de la o vorbire la alta. Limba romn a fost prima limb, dup cea francez, care a beneficiat de o cercetare organizat, dup aceleai principii ale geografiei lingvistice, de ctre Sextil Pucariu i Sever Pop de la Universitatea din Cluj, care au tiprit Atlasul lingvistic romn. Hrile au importan pentru reconstituirea difuzrii elementelor lingvistice. Pentru c numai prin difuzare inovaia unui vorbitor ptrunde n vorbirea unui grup, la nivelul unui grai/dialect i apoi n limba comun, standard. Teoriile lingvistice care se refer la aceast reconstituire sunt: a. teoria tradiional a filiaiei, a arborelui genealogic, care presupune c transmiterea inovaiei se face numai ntre limbi nrudite; b. teoria valurilor, Wellentheorie, care consider c trsturile lingvistice se rspndesc de la un vecin la altul, indiferent de originea lor; aceast teorie aparine lui Johannes Schmidt, datnd din 1872. Se vorbete astfel de nrudire genetic (a) i ncadrare tipologic (b). a. limba englez este o limb germanic, cu tot numrul mare de cuvinte i de elemente de formare a cuvintelor romanice i latine, pentru c prezint o evoluie continu de la vechea englez pn n stadiul actual; b. dar din punct de vedere tipologic, att morfologic, ct i sintactic, limba englez prezint mai multe similitudini (corespondene) cu franceza modern dect cu vechea englez. Pe baza hrilor se poate observa foarte clar cum dintr-un punct (dintr-o localitate) oarecare o noutate lingvistic (pronunie, form morfologic, trstur sintactic, cuvnt) se rspndete n funcie de curente politice, comerciale sau culturale. n Evul Mediu, n Apus, centrele ecleziastice au impus teritoriilor subordonate normele
110

lingvistice (pentru c eparhia/parohia reprezenta o unitate), apoi centrele politice, capitalele au exercitat n continuare influena normativ. De obicei, ns, prestigiul cultural a prevalat asupra celui politic. Astfel, graiul toscan, din Florena, folosit de Dante n opera sa, a devenit limba literar italian i nu graiul vorbit la Roma. Zonele limitrofe dintre graiuri/dialecte depind de multe ori de cauze geografice. Un lan de muni constituie o barier natural ntre graiuri, n timp ce o vale, tiat de un fluviu, formeaz de-a lungul ei o unitate. Periferia, n spaiu, a unui grai (deprtat de centru) este mai conservatoare dect centrul nsui. Modul de difuzare a unei tendine lingvistice se poate petrece: a. printr-un avans pe un front larg (ca o pat de ulei ntr-o mas de ap); b. printr-o micare ce poate fi asemnat trupelor aeropurtate, adic difuzarea se face n localitile importante, de-a lungul cilor de comunicaie i abia ntr-o a doua etap tendinele lingvistice se extind i n spaiile intermediare. Pe baza hrilor se pot studia straturile succesive de influene. Se folosete n acest caz metoda geologiei lingvistice, care permite stabilirea unei cronologii relative a vechimii elementelor (fonetice, morfologice sau lexicale) dintr-o limb. Astfel, pentru dialectolog tradiiile orale extralingvistice reprezint ceea ce este textul pentru specialitii din domeniul studiului limbii literare.
CHESTIONAR 1. Care este diferena dintre filologie i lingvistic? 2. Cnd a nceput cercetarea limbilor vii ? Dar a dialectelor? 3. Ce nseamn dialect / Ce nseamn grai? 4. Exemplificai definiia citnd dialectele unei limbi romanice pe care o studiai. 5. Care sunt criteriile de stabilire a statutului limb/dialect? 6. Care sunt criteriile de clasificare a limbilor romanice? 7. Ce se nelege prin limba latin vulgar?

111

GEOGRAFIA LINGVISTIC. METOD I DOMENIU

Geografia lingvistic, ntemeiat de J. Gilliron, const n studierea variantelor teritoriale ale limbii cu ajutorul hrilor lingvistice. Geografia lingvistic este considerat att o metod, ct i un domeniu al lingvisticii, fie c nelegem prin acest termen studiul ramificaiilor teritoriale ale limbii cu ajutorul hrilor lingvistice, fie c includem i alctuirea nsi a hrilor i atlaselor lingvistice. Dintre metodele lingvistice moderne de cercetare a limbilor vorbite, care conduc la stabilirea ariilor de rspndire a fenomenelor, geografia lingvistic se bazeaz pe culegerea nemijlocit a expresiei orale, pe baza anchetei directe pe teren sau indirecte, prin intermediul corespondenei. Atlas linguistique de la France de J. Gilliron a aprut n perioada 1902-1910, iar Sprach- und Sachatlas Italiens und der Sdschweiz, datorat lui K.Jaberg i J.Jud, ntre 1928-1940. Atlasul lingvistic romn, iniiat de ctre Sextil Pucariu, realizat de ctre Sever Pop i Emil Petrovici, a aprut: ALR I, 1939-1942, iar ALR II, 1956-1986 i publicarea continu. A aprut, de asemenea, Chestionarul ALR (Cluj, 1988). Tipurile de atlase romneti se diversific prin publicarea, n ultimele decenii, a Noului atlas lingvistic romn pe regiuni. Lingvitii bulgari au realizat Blgarski dialekten atlas, n 4 volume, 1964-1984, la care se altur 2 atlase de autor, de I. Ivanov i Ranghel Bokov (1972, respectiv 1986). Pentru spaiul sud-est european comparaia se va putea baza i pe datele nregistrate de Vseobii lingvistieskij atlas slavjanskych jazykov (Atlasul lingvistic general al limbilor slave).
PRINCIPIILE DE INTERPRETARE A HRII LINGVISTICE

Cteva dintre principiile fundamentale de interpretare a hrilor conduc la o nelegere temeinic a structurii i dinamicii ariilor dialectale (zon n care se folosete aceeai form dialectal). Primele dou principii aparin lui J.Gilliron, ele se refer la migraia cuvintelor i lupta dintre cuvinte: 1) Cuvintele migreaz la nivelul vorbirii din regiune (zon) n regiune. Lingvistul romn I.A.Candrea a stabilit c migraia se face prin: a) iradiere; b) infiltraie; c) revrsare i d) suprapunere.
112

Limba francez. Ariile succesive ale evoluiei lui ei > oi, ap. W. von Wartburg, Problmes ei mthodes de la linquistique, Paris, 1963, p.47. 1. oi n sec.al X-lea; 2. oi ntre 1100 i 1150; 3. oi ntre 1140 i 1175; 4. oi ntre 1175 i 1200; 5. oi dup 1195.

Iradierea are loc n jurul unui centru de inovaie. Infiltrarea se produce n spaii apropiate zonei unde se folosete un lucru sau are loc un fenomen. Un fapt de limb migrat mai nti timid, prin infiltrarea sau iradiaie, se poate apoi rspndi masiv, prin revrsare, inundnd zone ntinse. De obicei rezultatul unei migraii este i suprapunerea de particulariti lingvistice. 2) n legtur cu lupta dintre elementele lexicale, trebuie s reinem mai nti ideea mbolnvirii unor cuvinte, din cauze multiple: omonimia, polisemia, scurtimea cuvntului (corpul lui redus), ceea ce conduce la ieirea lor din uz.
113

Configurarea unor arii dialectale. Equa, caballa i iumentum iap n galloromanic (dup A. Dauzat) LINGVISTICA AREAL

M.Bartoli, creatorul lingvisticii spaiale, a pus accentul pe stabilirea cronologiei faptelor lingvistice, plecnd de la dispoziia ariilor dialectale. De aceea, metoda sa se numete i lingvistic areal. Autorul a avut n vedere ntregul teritoriu romanic i a stabilit alte cinci principii sau norme de interpretare a hrilor (pe lng cele ale lui Gilliron).
114

Ariile lingvistice. M. Bartoli a difereniat urmtoarele tipuri de arii: 1) aria izolat; 2) aria lateral; 3) aria major; 4) aria ulterioar i 5) aria disprut. 1) Dintre dou faze lingvistice, cea izolat este mai veche. Ariile izolate ar fi, deci, mai arhaice dect celelalte. 2) Faza din aria lateral este mai arhaic dect cea din ariile centrale, de unde a pornit iradierea sau migraia termenului. 3) Faza din aria mai mare (aria major) este mai veche dect cea din aria minor. 4) Uneori aspectele lingvistice din ariile mai noi sunt mai arhaice dect cele din ariile mai vechi. 5) Faza mai puin rezistent, ce tinde s dispar, este mai veche, pentru c aceste particulariti, chiar dac se pstreaz pe arii mici, sunt adevrai martori de eroziune cu ajutorul crora se poate reconstitui o ntreag zon. Aceste adevrate amprente digitale ale istoriei limbii au pentru dialectologi o valoare excepional, ele dovedind c trecutul nu moare niciodat n ntregime. Firete, principiile de mai sus sunt n curs de verificare dac pot avea un caracter universal. Un atlas lingvistic al unor idiomuri vorbite n America de Nord, altele dect engleza (sub tipar), va putea fi ntrebuinat n cercetrile comparate. Realizarea acestor importante instrumente de lucru care sunt atlasele a fcut evident valoarea graiurilor ca martori ai istoriei fiecrei limbi. Pn la validarea geografiei lingvistice se considera c doar mrturiile scrise prezint dovezi despre aspecte ale limbii din secolele trecute. Dar cercetrile pe baza cronologiei relative a succesiunii etapelor de evoluie a unei limbi a cptat un fundament indeniabil prin Atlasele lingvistice. Ele pun n eviden valoarea probatorie a faptelor culese din vorbirea cotidian pentru atestarea ariilor lexicale. Prin aceasta s-a lrgit orizontul cercettorului, limitat altdat doar la documente sau la o eventual reconstituire de forme vechi. Graie hrii lingvistice este posibil i studiul comparativ al ariilor dialectale. mbinat cu metoda comparativ-istoric, s-a dezvoltat i geologia lingvistic, metod ce stabilete stratigrafia faptelor dialectale, vrsta straturilor lingvistice, evoluia lor etc. Harta este o reprezentare sincronic a vorbirii individuale de pe un teritoriu dat. Aceast seciune orizontal n limbaj, la un moment dat, surprinde elemente pe cale de dispariie (de obicei sunt cuvinte rare), altele care abia ncep s fie folosite (acestea, de asemenea, pot fi rare) i stratul terminologic cel mai rspndit, care cuprinde fenomene n perioada de maxim folosire i rspndire. Cercetarea stratigrafic,
115

pe baza metodei geologiei lingvistice, se poate ntreprinde att pentru fiecare limb n parte, ct i pentru termeni de aceeai origine rspndii n limbi diferite. Astfel, n lucrarea noastr Terminologia portului popular romnesc n perspectiv etnolingvistic sud-est european am stabilit concordanele din limbile sud-est europene, pe baza atlaselor lingvistice. Considerm c procednd astfel, adic realiznd monografii comparative pentru ct mai multe cmpuri onomasiologice, n viitor se vor putea stabili elementele lingvistice comune acestor limbi. De asemenea, considerm c ariile de rspndire ale unor cuvinte sunt indicii preioase pentru stabilirea unei etimologii corecte i pentru surprinderea zonelor de contact (prin suprapunerea, cumulat, a datelor din ct mai multe hri lingvistice). Geografiei lingvistice i s-au adus i unele obiecii. Cele mai multe au n vedere limitele atlaselor lingvistice; geografia lingvistic nu permite studierea tuturor particularitilor ariilor dialectale; nu se poate studia, de exemplu, dect o parte din tezaurul lexical al unui dialect; aceast cercetare privete mai ales lexicul obiectiv, ceea ce face ca numeroase cuvinte cu valoare afectiv s nu fie luate n discuie: studiul sintaxei nu se poate face dect ntr-o mic msur, dac se pleac numai de la atlasele lingvistice; exist i unele riscuri de formulare a concluziilor, deoarece cercettorul este obligat s opereze numai cu idiolecte (dialectul vorbit de individ); geografia lingvistic a pus prea mult accentul pe varietate, pe faptele lingvistice luate separat, ceea ce a dus la o imagine atomistic a limbii etc. Dar, completarea atlaselor cu monografii, glosare i culegeri de texte dialectale, nltur aceste obiecii. De asemenea, alturarea unor metode interdisciplinare, aa cum este etnolingvistica, presupune extinderea cercetrii istorice de la un cuvnt la un grup de cuvinte, componente ale unei terminologii (ceea ce realizeaz onomasiologia) n paralel cu examenul realiei (adic al obiectului lumii materiale) care se supune propriei istorii i evoluii. Studierea ntregului cmp de denumiri pentru o anumit noiune d posibilitatea s se ntrevad cauza schimbrilor, iar folosind metoda etnolingvistic i pe baza geologiei lingvistice se pot recunoate criteriile pe care s-au ntemeiat vorbitorii n actul denumirii i se poate descifra evoluia semantic. Firete, aceast metodologie complex va putea fi aplicat cu deplin succes cnd va exista Atlasul lingvistic al Europei (ALE) care este n faz de redactare final sau Atlasul lingvistic al limbilor romanice, la care au nceput lucrrile.
116

BIBLIOGRAFIE Iorgu Iordan, Maria Manoliu, Introducere n lingvistica romanic, Ed. Didactic i Pedagogic, Bucureti, 1965, p.45-65. Tratat de lingvistic general, sub redacia Al. Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucureti, 1971, p. 101-120, 414-431. G. Mounin, Istoria lingvisticii, traducere i postfa Constantin Dominte, Ed. Paideia, Bucureti, 1999, p. 133-137. Ileana Oancea, Romanitate i istorie, Ed. Vest, Timioara, 1993, p. 7-37. Carlo Tagliavini, Originile limbilor neolatine, Ed. Stiinific, Bucureti, 1977, p. 279-387. CHESTIONAR 1. Caracterizai metoda geografiei lingvistice. 2. Care este cel dinti Atlas lingvistic? 3. Enumerai cteva Atlase ale limbilor din Europa. 4. Cum se difuzeaz o inovaie lingvistic? 5. Care sunt principiile de interpretare a hrii lingvistice?

117

LIMBA N CADRUL SOCIAL. DIFERENIEREA I UNIFICAREA LIMBILOR

n orice epoc, i orict am urca n timp, limba apare ntotdeauna ca o motenire a epocii precedente. Nici o societate nu cunoate i nu a cunoscut limba dect ca pe un produs motenit de la generaiile precedente, preluat ca atare. Singurul obiect real al lingvisticii este expresia normal a unui idiom deja constituit. Dar a spune c limba este o motenire nu explic nimic dac nu mergem mai departe i nu plasm limba n cadrul su social. Trebuie s privim problema aa cum se pune ea i pentru celelalte instituii sociale. Cum se transmit acestea? Vom vedea c pentru fiecare dintre ele exist un echilibru diferit ntre tradiia impus i aciunea liber a societii.
FACTORII DE EVOLUIE A LIMBII

Revenind la limb ne vom ntreba de ce factorul istoric al transmiterii o domin n ntregime i exclude orice schimbare general subit. Evoluia limbajului (langage) n genere, cea a diverselor limbi n particular, poate fi explicat prin anumite elemente care in de vorbitori: mod de via i de clim; relaii sociale interumane; mod comun de a gndi pe diferite trepte de civilizaie (aceeai mentalitate); tipuri de reglementri sociale. Dar faptele lingvistice au i propria lor evoluie, chiar dac sunt n legtur cu alte fapte, ritmurile de evoluie fiind diferite, trebuie avut n vedere complexitatea circumstanelor. n compartimentarea uman este natural c limbajul a avut o soart analog n ceea ce privete varietatea/diversitatea sa pe mari spaii geografice, deoarece el este mobil i antrenat ntr-o micare general de evoluie. Nu exist motive s se considere c toate limbile au parcurs aceleai stadii, pentru c efecte similare pentru satisfacerea nevoii de nelegere (comunicare) pot fi obinute prin mijloace lingvistice diferite.
118

De exemplu, din punct de vedere fonetic exist sunete produse nu prin emisiunea de aer din plmni, ci prin declicul aerului n gur, pe care toate limbile l uziteaz, dar care nu are valoare fonematic. n unele limbi din Africa, acest declic reprezint consoane ale sistemului fonetic respectiv. Aceasta nu nseamn c toate limbile vor fi trecut prin aceast faz a folosirii declicului n procesul de comunicare. Unele limbi din Asia (vietnameza, thailandeza) au ntregul tezaur lexical format din cuvinte monosilabice. Dar se observ astzi tendina n aceste limbi, ca sub accent s se grupeze mai multe cuvinte monosilabice ntr-o emisiune mai lung. Dup cum, invers, n limba englez se observ predispoziia pentru scurtarea din ce n ce mai mult a cuvintelor, care devin, astfel, monosilabice. Prin urmare, nu se poate stabili o legtur ntre monosilabism i un tip de societate i nici nu se poate afirma c stadiul de monosilabism a fost obligatoriu pentru limbile lumii. Ideea c n unele mprejurri climatul sau modul de via n zone ale globului cu clim diferit au avut efecte lingvistice diferite (n special asupra fonetismului) este acceptat de majoritatea lingvitilor. De exemplu, n rile cu clim foarte rece din Nordul Extrem se deschide mai puin gura la pronunarea sunetelor, care din acest motiv difer de sunetele din zonele temperate. La fel n rile din zonele ecuatoriale, deertice (majoritatea arabe, dar nu numai), unele sunete se realizeaz prin expirarea aerului i nu prin inspirarea lui. Limbile, dei depinznd de societate, au o evoluie proprie, n condiii interne de echilibru i de dezechilibru ale transformrilor fonetice. De exemplu, slbirea consoanelor ntre dou vocale nu poate fi pus n legtur cu vreun eveniment istoric. ncercarea de a determina o corelaie ntre caracterele fonologice ale limbilor de tip arhaic (sistemul fonologic al acestor limbi i structura societii care o vorbete) a fost pn acum imposibil de stabilit. n istoria limbii greceti a aprut la un moment dat sunetul [] care, dup o lung perioad de existen atestat n texte, a disprut din vorbire, prin urmare, nu se va putea presupune o cronologie a limbii n raport cu acest fonem (sau cu oarecare manifestare fonetic, morfologic sau sintactic). Antoine Meillet a expus concepia sa despre raportul dintre formele lingvistice i unele forme ale gndirii i chiar ale structurii sociale. Se tie c opoziia ntre genul animat (masculin, feminin) / inanimat (neutru) a fost un aspect fundamental n lumea indoeuropean. Dispariia acestei opoziii a limbii indo-europene precede
119

schimbarea mentalitilor. Pentru romani, ea nu mai avea nici un rol i opoziia gramatical masculin/feminin nu mai are legtur cu noiunile, n limba latin. Determinnd cderea n desuetudine a neutrului, romanii (latinii) s-au debarasat de o categorie gramatical care de mult nu mai avea nici o semnificaie. ns repartiia substantivului ntre masculin i feminin, care nu mai are nici un sens n majoritatea situaiilor, a persistat, i dihotomia masculin-feminin nu pare s dispar din limbile moderne, cu toate c este superflu. Opoziia masculin-feminin s-a transformat n instrument gramatical. S-a discutat mult dispariia pasivului (formei verbale pasive) n limbile romanice. Dar ceea ce a disprut a fost forma, nu categoria, de exemplu, limba francez are trei maniere (modaliti) de a exprima ceea ce n limba latin era concentrat ntr-o singur form: dicitur/on dit, cela se dit, il est dit. Un ansamblu lingvistic a fost folosit pe un teritoriu mai mult sau mai puin ntins, n decursul unei lungi perioade de timp, pn ce a devenit limb a unui stat, limb a nvmntului, de cultur sau limb internaional, n acelai timp cu poporul ce a devenit o naiune (ntr-un stat sau mai multe). Istoria fiecrei limbi n aceast perspectiv trebuie s in seama de conexiunile evenimentelor propriu-zise lingvistice, dar i de conexiunile lingvistice cu evenimente extralingvistice. A. Meillet discut diferenierea i unificarea limbilor i ajunge la concluzia c creaia i extensiunea limbilor comune sunt produsul unitii de civilizaie pe arii mai mult sau mai puin vaste. Ceea ce nseamn o recunoatere a caracterului eminamente social al dezvoltrii limbilor. Comunitile sociale cu nume propriu sunt foarte diferit constituite n general. Ne referim la ele n perspectiva limbii pe care o vorbesc, denumindu-le popoare. Un popor este o reuniune de oameni, locuind acelai teritoriu, vorbind aceeai limb, avnd aceeai istorie i aceleai obiceiuri cptate i perpetuate de-a lungul timpului. Dislocarea (mutarea) unei populaii a dus la rspndirea limbii respective n alte teritorii, dar i la fragmentarea ei. Prin ndeprtarea n spaiu pot aprea mai uor diferenieri la nivel lingvistic. Numele unei populaii arat c oamenii se simt aparinnd aceleiai colectiviti. Ei desemneaz cu acelai cuvnt propria colectivitate (etnonim) i limba pe care o vorbesc (glotonim). Lingvitii au cutat s demonstreze dezvoltarea natural a limbii, dar au trebuit s recunoasc n final c o dezvoltare natural a limbii nu exist, cci toate limbile cunoscute populare i savante dezvluie preocuparea unui a spune mai bine, mai exact, dun mieux dire, care pretutindeni a condus subiecii vorbitori s-i nsueasc modul
120

de a vorbi al celor care se exprim mai bine. De fapt, aceast tendin spre mai bine corespunde propriu-zis nevoilor de comunicare i nu unei dorine subiective. Toate transformrile n limb se fac prin intermediul vorbirii, dar cauzele transformrilor nu rezid n aceasta (adic n vorbire). Nu este dorina sau voina de expresie a indivizilor cea care a determinat, de exemplu, fenomenul de diftongare n limba francez sau mutaia consonantic n limba german. Aceste fenomene rezult din fore supraindividuale i se datoresc, n parte, i marilor evenimente istorice, cum este amestecul popoarelor. Aciunea reciproc ntre limb i vorbire (dac considerm vorbirea o re/creare individual a expresiei lingvistice) nu explic dect parial anumite aspecte ale evoluiei fonetice i morfologice. Raportul dintre limb i vorbire se relev numai n maniera n care se transmite limba. Limba este motenirea colectiv i spiritual a grupului uman, n interiorul cruia se dezvolt copilul. Spre deosebire de aptitudinile fizice i celelalte aptitudini, spirituale, pe care un copil le motenete de la prini (i de la strmoi), limba el o nva de la anturajul su, mam i ceilali membri ai familiei, doic, educatoare .a. Copilul are doar capacitatea de a crete i a se dezvolta ntr-o limb, fie c e cea a prinilor lui, fie c e o limb strin. Un copil din prini asiatici sau africani poate nva de la primele sunete, n mediul european sau american, limba locului ca i un btina. Limba este independent de aptitudinile fizice ale vorbitorilor, prin urmare, transmiterea de la o generaie la alta a limbii se face astfel nct fiecare nou generaie se dezvolt ntr-o sfer spiritual deja existent. n timp ce viaa trece direct de la mam la copil, limba parcurge o cale spiritual prin aciunea anturajului asupra copilului i a adolescentului. Aceasta explic de ce un om de orice origine poate fi integrat ntr-o colectivitate lingvistic diferit. n Imperiul Roman originea etnic a locuitorilor era dintre cele mai diferite, dar toi au ajuns s se neleag n latin. La fel, n marea colectivitate a Americii de Nord, unde aproape toate popoarele lumii sunt reprezentate n colectivitatea uman, toi vorbesc o singur limb oficial, engleza.
ASPECTE DIN ISTORIA UNOR LIMBI ROMANICE

Diversitatea de situaii i ritmul diferit al etapelor istoriei limbilor romanice evideniaz implicarea unui numr considerabil de factori care concur la aceste procese.
121

Iat cteva aspecte eseniale ale istoriei limbii romne (cf. Marius Sala, De la latin la romn). n secolul al VIII-lea .Hr. (anul 753, dup legenda fondrii Romei de ctre Romulus), limba latin era limba vorbit la Roma. n jurul acestei aezri se vorbeau alte limbi, unele nrudite cu latina limba osc , altele care nu erau indo-europene etrusca. Dup cinci secole, latina domina n ntreaga peninsul italic, iar la 133 .Hr. stpnirea roman se ntindea n jurul ntregii Mediterane. Seria de cuceriri se ncheie n anul 106 d.Hr. cu stpnirea Daciei Traiane. Imperiul constituia un stat unitar centralizat, limba latin se folosea n noile provincii, n administraie i n armat. Populaiile autohtone erau constrnse s adopte latina pentru relaiile lor cu administraia, armata i colonii romani. De exemplu, n Galia exist texte care atest c nobilii i negustorii foloseau limba latin i i ddeau copiii la coli n limba latin pentru a putea deveni apoi slujbai ai imperiului. Abandonarea de ctre populaie a propriilor limbi pentru a nva latina poart numele de romanizare. Aceast evoluie a durat mai multe secole. n Galia sunt vestigii epigrafice i literare care demonstreaz c galica (celtica) (Iulius Cezar n De bello Gallico a precizat c cele dou glotonime sunt sinonime) a supravieuit pn n secolul V. Adoptarea latinei de ctre cei nvini depindea i de statutul cultural al limbii autohtone respective. De exemplu, populaia de limb greac, dei a fcut parte din Imperiul Roman, nu a adoptat limba latin, cu toate c limba latin era limba oficial. Aceasta datorit prestigiului cultural al limbii greceti. n Dacia, romanizarea a urmat acelai drum ca i n celelalte provincii. Fa de cultura oral traco-dac, prestigiul limbii latine, limb literar cu texte literare, administrative, nregistrri comerciale i inscripii funerare, a fost incontestabil. n msura n care folosirea limbii latine se generalizeaz, diferenele dintre limba folosit de latinofonii provenii din diferitele provincii ale imperiului i cea a autohtonilor se estompeaz. Geto-dacii fceau parte din grupa tracilor, ei foloseau o limb indo-european i sunt atestai pe teritoriul de la Dunre din secolul VI .Hr. Pentru a aprecia raporturile dintre limba geto-dac i limba latin trebuie s avem n vedere ramurile limbilor indo-europene: indoiranica, italica, celtica, germanica, baltoslava, traco-daca, greaca i armeana (cf. figura alturat). Prin urmare, traco-daca este pe acelai palier cu ramura italic, nrudirea fiind intermediat. Romanizarea limbii traco-dace a condus la formarea limbii romne n secolele VII-VIII.
122

germanica baltoslava celtica italica traco-daca greaca Ramurile limbilor indoeuropene indo-iranica armeana

Limba romn este limba latin vorbit nentrerupt pe teritoriul carpato-danubiano-pontic, iar elementele preluate n latin din limba traco-dac formeaz substratul limbii romne, n timp ce din punct de vedere etnic procesul de constituire a poporului romn a presupus un amestec de populaie; poporul romn a intrat n contact i cu alte popoare care au trecut pe teritoriul lui. n Occident, ca i n zona noastr, destinul popoarelor migratoare a fost identic, ele au fost asimilate de popoarele romanice. n zonele periferice ns populaiile nou sosite au asimilat populaia romanic: de-a lungul fluviului Rhin, populaia germanic, iar n sudul Dunrii, slavii au diseminat populaia romanic. Din punct de vedere lingvistic, n limbile romanice occidentale vorbim de superstrat germanic, iar n limba german de superstrat romanic. i n limbile slave din peninsula Balcanic ntlnim un superstrat romanic, iar n limba romn superstrat slav. n ceea ce privete perioada de cnd se vorbete limba romn, stabilirea datei poate fi pus n legtur cu istoria Imperiului roman. n anul 395 imperiul s-a mprit n Imperiul roman de Rsrit, n care a predominat limba greac, i Imperiul roman de Apus, n care limba latin vorbit a evoluat spre limbile romanice. i latina dunrean, izolat de romanitatea occidental, a evoluat independent, accentund particulariti proprii. n general se consider c n sec.VII-VIII se poate fixa nceputul limbilor romanice (neolatine) att n Occident, ct i n ceea ce privete limba romn. Limba oficial n Imperiul roman de Rsrit a devenit limba greac sub Heraclius (610-641), ceea ce n-a afectat evoluia limbii romne, care demonstreaz prin structura ei c era deja format.
123

Un argument pentru istoria limbii romne l furnizeaz un text din anul 587 care povestete o ntmplare petrecut n munii Haemus (Balcani). ntr-o noapte, un grup de ostai mergeau pe o potec mpreun cu bagajele lor ncrcate pe catri. Unul dintre ostaii romani observ c bagajul camaradului din fa st gata s cad i-i strig acestuia: Torna, torna, fratre (istoricii care au scris despre acest fapt Theofilact Simocatta menioneaz c ostaul a vorbit n limba autohton a locului, iar alt istoric, Theofanes Confessor, o denumete limba matern). Fiind noapte, strigtul a speriat pe ceilali ostai, care au crezut c vin dumanii i au luat-o la fug. Atestarea acestor cuvinte n anul 587 reprezint, dup prerea majoritii lingvitilor, prima atestare a unei limbi romanice, protoromna.
LINGVISTICA LIMBII LITERARE I LINGVISTICA GRAIURILOR

Hotrrea unui Conciliu din anul 813, care recomanda explicarea cultului n limba vorbit pentru c limba latin nu mai era neleas, constituie data la care ne referim ca act de natere a limbilor naionale europene. Jurmintele de la Strasbourg (Serments de Strasbourg, din anul 842) este primul document n limba francez. Aceste date constituie prima etap dintr-o evoluie care s-a prelungit cteva secole. Procesul de consfinire a folosirii limbii naionale n toate domeniile vieii publice este considerat ncheiat, pentru limba francez, abia n 1539, cnd Franois I d o ordonan prin care legifereaz c toate hotrrile judectoreti trebuie redactate n limba francez uzual. Pe baza acestui text se constat c limba latin este complet nlocuit din uzul public. Ea continu s fie folosit n biserica romano-catolic i ca obiect de studiu (limb clasic) n coli. Prin urmare, ntre 813-1539, limba francez a cucerit treptat ntreaga via public a naiunii. Mai adugm c, n 813 se stipula obligaia ca preoii s explice textul sacru din limba latin n limba poporului ntr-un idiom local. Or, un cuvnt ca charger a ncrca era pronunat la Paris chargier, la Arras carguier, la Lyon tsardzier, la Limoges charjar, la Narbonne cargar. Abia n 1539 s-a interzis folosirea n actele oficiale att a limbii latine, ct i a formelor regionale ale limbii franceze, fiind considerate corecte i recomandate numai formele gramaticale i lexicale specifice vorbirii din le de France, adic de la Paris. Prin aceast legiferare idiomul din Capital i din mprejurimi a devenit nucleul limbii literare franceze.
124

Dintre toate limbile romanice, italiana a apelat cel mai trziu la limba sa popular pentru creaia literar, trei secole dup Frana i un secol dup Spania. n secolul al XIII-lea, situaia prea fr soluie, cci divergenele dintre formele regionale erau foarte adnci, fiecare zon de pe teritoriul italian de astzi apelnd la idiomurile locale. Prima coal poetic se manifestase n Sicilia, n secolul al XI-lea. Dar atestarea acelor texte nu s-a pstrat. Vorbitorii din Nord au preluat tradiia folosirii idiomului local n creaia artistic i la Florena, pe parcursul unei singure viei, fr nici o legiferare impus, Dante Alighieri, prin creaia sa, a realizat unificarea incontestabil ntr-o singur limb scris i naional comun a tuturor variantelor regionale (dialectelor limbii italiene). A fost o ans faptul c el s-a nscut la Florena, cci idiomul toscan era singurul accesibil tuturor vorbitorilor celorlalte dialecte. Prin urmare, vorbitorii graiurilor aveau acces la forma care a devenit ulterior supradialectal, n timp ce dialectul roman, vorbit numai de ctre locuitorii din Roma i din mprejurimi, a rmas circumscris zonal i nu a avut nici o pondere n formarea limbii literare italiene. Urmrind n paralel situaia din Germania vecin, constatm c acolo n secolele X i XI se acordau privilegii limbii latine n defavoarea limbii vorbite germane, care era exclus din literatur. n secolul al XII-lea Chanson de Roland n limba francez demonstrase capacitatea limbii vorbite de a exprima n form artistic contiina naional. Cteva decenii dup aceea epopeea Nibelungenlied (circa 1200) prelua misiunea de a reprezenta n plan artistic cea mai elocvent creaie a germanilor. Aceste dou mari epopei naionale, ca i poezia provensal, sau Minnesnger din sudul Germaniei, sunt martore ale victoriei limbilor populare asupra latinei. A doua etap a constituit-o lupta i victoria unei variante a limbii germane pentru a se impune ca limb naional. n tot cursul Evului Mediu, n Germania nu s-a putut impune o singur limb literar datorit schimbrii centrelor de reziden a Puterii, a capitalelor. n secolul al XIII-lea lrgirea sferei de circulaie a actelor emise la Meissen, unde se vorbea limba german de sus Althochdeutsch i, n genere, limba cancelariei saxone a reuit s se impun i n celelalte state germane. Apoi extraordinarul impact al operei lui Martin Luther, nceput la 1518, care traduce Biblia n aceeai limb german de sus (dei el era vorbitor i adeptul rspndirii limbii germane de jos Niederdeutsch) a asigurat, ncepnd din secolul al XVI-lea, unitatea limbii literare germane.
125

Preocuparea pentru limba scris a nsemnat ns neglijarea aspectului vorbit i popular al limbajului i a antrenat stabilirea regulilor de exprimare acionnd coercitiv. Caracterul literar dublat de caracterul normativ, nlat pe conceptul de autoritate, a determinat o perspectiv static asupra limbii. Or, depirea lingvisticii descriptive s-a putut face numai prin ceea ce a fost denumit metodologia lingvisticii graiurilor populare (a vorbirii).
BIBLIOGRAFIE Eugeniu Co eriu, Lingvistic din perspectiva spa ial i antropologic , Ed. tiina, Chiinu, 1994, p. 182. Crestomaie de lingvistic general, Ion Coteanu (ed.), Ed. Fundaiei Romnia de Mine, Bucureti, 1998, p. 68-99. A. Meillet Linguistique historique et linguistique gnrale, Paris, 2 vol., 1948-1952. Ileana Oancea, Lingvistic romanic i lingvistic general . Interferen e, Ed. Amarcord, Timioara, 1999. Marius Sala, De la latin la romn , Ed. Univers Enciclopedic, Bucureti, 1998. CHESTIONAR 1. Enumerai cteva elemente ale evoluiei limbii ce depind de cadrul social. 2. Care sunt ramurile limbilor indo-europene? 3. Cnd s-au manifestat limbile populare neolatine n creaia artistic?

126

FONETICA

VORBIREA I SCRISUL

Analiza limbajului ntr-o perioad timpurie a istoriei omului pe pmnt s-a manifestat n consemnarea prin mijloace materiale a comunicrii verbale. Semnul a fost folosit pentru a reprezenta un mesaj, n forma cea mai abreviat. Astfel, aa numitele semne de rboj conin, ntr-o linie, un cerc marcat .a. pe un material dur sau pe pielea unui animal domestic, un mesaj complet de tipul: pn aici se ntinde teritoriul care aparine comunitii sau individului X sau obiectul sau animalul este al lui X, iar pe baza semnelor de proprietate se face mprirea produselor rezultate la un moment dat etc. Dup perioada de consemnare a coninutului mesajului printr-o unic reprezentare, cu ajutorul semnelor de tip rboj, apoi prin scrierea pictografic, analiza limbii a devenit vdit i folosind criterii specifice atunci cnd s-a ajuns la o segmentare a fluxului sonor al comunicrii. Scrierea prin intermediul unor grupuri consonantice (semnele cuneiforme) dovedete c se ajunsese la o analiz competent a combinaiilor de consoane. Predominanta consonantic a limbilor semitice a favorizat acest tip de notare. n limbile indoeuropene, Liniarul B micenian este o scriere veritabil silabic. n acelai sens, este posibil ca sistemul scrierii chineze s fi fost un referent n mod fundamental morfologic nc de la constituirea sa ca sistem (Gleason, p.322) (dei ali cercettori consider c scrisul chinez a fost elaborat avnd ca punct de plecare reprezentri pictografice). Firete, din acest motiv este necesar un numr att de mare de grafeme, pentru c fiecare reprezint un morfem. Aceast manier de notare a mesajului are ns avantajul de a putea fi folosit de ctre dialecte chineze diferite i de ctre alte limbi (anamita, vietnameza, japoneza). Textul scris poate fi citit n orice parte a Chinei, n timp ce comunicarea oral ntre vorbitori din diferite arii lingvistice este imposibil fr apelul la coduri cunoscute de ambele pri care comunic. nsemnrile mesajelor orale din cele mai vechi timpuri au avut rolul de a conserva texte religioase sau nsemnri comerciale, pe suport de argil ars, foi de metal, spturi n piatr i, ulterior, scrisul pe pergament sau pe foi de papirus.
127

Ca i n limbaj, i n scriere exist codul, emitorul (autorul care a scris textul) i receptorul (cel care l-a descifrat). O adevrat analiz fonologic a fost fcut n limba fenician, prin delimitarea unui numr finit de sunete-tip, n numr de 22, i astfel s-a ajuns la folosirea n scris a unor semne arbitrare, corespunztoare sunetelor limbii. Cei care au realizat suita de semne au reuit s surprind repetiiile unor sunete n fluxul sonor al vorbirii, s aprecieze c particularitile de pronunare individual a acestor sunete se raporteaz la sunete-tip i s constate c numrul lor este finit. Alfabetul limbii feniciene nu este considerat veritabil pentru c nu reprezenta prin semne speciale vocalele. Abia vechii greci au folosit semne specifice att pentru vocale, ct i pentru consoane. Aceste semne au fost mprumutate de ctre etrusci, de la care le-au preluat, n parte modificate, latinii. Cele 23 semne grafice ale scrisului latin, vechi de peste 2700 de ani, la care s-au adugat 3 semne mprumutate de la vechii greci, formeaz alfabetul cel mai rspndit n lumea contemporan. Totui, miliarde de vorbitori folosesc alt fel de scriere pentru limbile lor: alfabete diferite, cum sunt, de exemplu, cele grecesc i slav; tipuri diferite de scriere, cum este scrierea ideografic chinezeasc sau alte moduri de consemnare a limbilor. Grafia alfabetic este la origine un calc al articulrii fonematice, care a pstrat, i sub aceast form, caracterul su discret (A. Martinet, Elm.de ling.gn., 23). Unitile discrete sunt cele a cror valoare lingvistic nu este afectat de variaiile de detaliu determinate de context sau de diverse alte circumstane. Orice sistem de scriere este constituit dintr-un ansamblu de grafeme, fiecare grafem avnd unul sau mai multe alografe (varieti ale grafemului semnului caracteritic, fr valoare difereniatoare). Sistemul scrisului n-a reprezentat niciodat sistemul fonologic n ntregime. Unele limbi au introdus, pentru adecvare, semne noi, fa de cele tradiionale latine, cum ar fi , (norvegiana), (spaniola), (engleza veche). Totui, uneori, reprezentarea scris a mesajului oral poate fi mai puin clar dect vorbirea pe care o nregistreaz. Scrisul compenseaz aceasta prin separarea cuvintelor. Scrisul este o convenie, forma literelor este arbitrar i scrisul desemneaz un sistem convenional de folosire a unor simboluri determinate corespunztoare anumitor sunete. Chiar dac forma literelor este aceeai, n cazul tiparului, convenia intervine n sistemul ortografic, adic schemele de utilizare a literelor alfabetului pentru reproducerea sunetelor specifice unei anumite limbi. Pe baza textelor scrise s-au fcut toate cercetrile asupra limbii pn la apariia
128

cercetrilor de geografie lingvistic (nregistrarea direct a vorbirii), n a doua jumtate a secolului al XIX-lea. Iar lingvitii moderni procedeaz la fel ca inventatorii primelor alfabete: ei recunosc c sunetele percepute n pronunri diferite se reduc la un numr limitat de uniti distinctive, reprezentabile prin tot attea uniti grafice. Forma scris va reprezenta totodeauna mrturia concret a limbii dintr-un loc i la un moment dat, iar sub forma alfabetului fonetic internaional (IPA, International Phonetic Alphabet) i a altor sisteme de notare grafic consemneaz rezultatele cercetrilor lingvistice. Din economie, aceleai semne ale alfabetului se folosesc pentru transcrierea fonemelor din limbi diferite.
FONETICA GENERAL I FONETICA UNEI LIMBI NATURALE

Termenul fonetic nseamn: 1. Nivel al structurii unei limbi, incluznd elementele fonice (sunete, accente, intonaie etc.) prin care aceasta se materializeaz i 2. Disciplin lingvistic al crei obiect l constituie elementele fonice produse i receptate n procesul comunicrii umane (= sunetele articulate n.n.). Fonetica studiaz ntreaga diversitate a realizrilor concrete ale elementelor fonetice dintr-o limb, independent de funcia acestora n comunicare i de nivelul structural la care apar (cuvnt, limita dintre cuvinte, propoziie etc.) (DL, p.219). Contribuia altor tiine a fost de cea mai mare importan pentru fonetic. Studierea sunetelor produse de ctre vocea uman a fost posibil prin folosirea unor informaii din fizic i a unor instrumente de laborator, ca i prin utilizarea metodei experimentale. Atunci cnd cercetarea emisiunii sonore s-a fcut n mod independent de felul n care ea este produs sau perceput, aceast parte a foneticii s-a ncadrat ntr-o ramur autonom a fizicii denumit acustica. De aceea nu ne vom opri aici asupra ei. n msura n care sunetele articulate au fost nregistrate, cuantificate i analizate cu mijloace tiinifice, ele au putut fi descrise i clasificate. Fonetica experimental a fost ntemeiat n a doua jumtate a sec. al XIX-lea de ctre abatele P.J. Rousselot i s-a dezvoltat pe msura progresului tehnic. n Anglia, Daniel Jones a afirmat i a aplicat n practic principiul dup care, n studiul limbilor, fonetica are cea mai mare importan. n funcie de perspectiva din care este efectuat studiul cea a emiterii sau cea a receptrii s-au configurat trei seciuni ale foneticii (dup ali autori, cf. DL, 219, numai primele dou): fonetica
129

articulatorie, fonetica acustic i fonetica neuroperceptiv (E. Ionescu, Manual de lingv.gen., p. 108). Fonetica acustic studiind producerea unui continuu de uniti (semnale) sonore (articulate sau nu), rezultat din funcionarea aparatului articulator, ct i fonetica neuroperceptiv, care are n vedere perceperea mesajului auditiv, convertirea lui ntr-un ir de impulsuri nervoase i recunoaterea (integrarea) mesajului (E. Ionescu, op. cit., 108), aparin altor tiine i lingvistica folosete rezultatele cercetrilor fizicii (vibraie, und sonor, armonice, frecven etc.) sau ale neurofiziologiei umane. Fonetica experimental modern a devenit o tiin eminamente util, fiind aplicat i de ctre alte discipline dect cele lingvistice (antrenamentul auzului deficitar, tratamentul defectelor de pronunie, nvarea pronunrii corecte a unei limbi strine, transpunerea mecanic a vorbirii n scriere cu ajutorul aparatelor i a scrisului n expresie sonor etc.). Iar pe baza studiilor de fiziologie a sunetului s-a constatat c percepia corect a sunetelor depinde nu numai de capacitatea fiziologic de a auzi a urechii, dar i de diferenele dintre sunete (distinciile pertinente), la care din copilrie a fost obinuit s reacioneze (B. Malmberg, Les nouvelles tendances, p.177). Aceste contribuii s-au adugat consideraiilor de lingvistic general care se bazeaz pe teoria c limba este o funcie, prin urmare fiecare vorbitor deprinde articularea ntr-un anume fel, n concordan cu sistemul limbii pe care o nva. Nu exist diferene de conformaie a aparatului fonator care s determine vorbitorii unei limbi s foloseasc anume articulaii. Limbajul uman se transmite de la generaie la generaie prin viu grai, prin urmare vorbirea este, n prima faz, o aciune de imitare. Un vorbitor poate nva pronunarea oricrui sunet al sistemului unei limbi strine; noul nscut nu are nici un fel de predispoziie pentru o anumit limb. Limba matern a copilului devine limba n care i se vorbete de ctre cei din jurul lui i nu limba nativ a mamei (care poate s nu o foloseasc n relaiile cu copilul, ci s prefere, de exemplu, folosirea limbii oficiale din localitatea n care locuiete). Astfel, copii din rasa galben sau neagr deprind limba englez la fel ca i cei din prini anglo-saxoni, iar copii albi nva s vorbeasc prima dat n limba japonez, bantu sau oricare alta. n ceea ce privete fonetica articulatorie, ea nregistreaz i descrie sunetele produse de vocea uman n momentul punerii n micare a aparatului articulator ca urmare a comenzii date de cortex (E. Ionescu, idem, 108). Varietatea rostirii sunetelor este direct proporional cu numrul vorbitorilor, de aceea n cercetare intereseaz cu deosebire valoarea lor contrastiv.
130

SUNETUL VORBIRII

Sunetul articulat este unitatea fonic produs i receptat n procesul de comunicare (DL). Clasificarea sunetelor se face de obicei dup: a) activitatea laringelui (sunete sonore sau surde); b) dup punctul de articulare a sunetului n cavitatea bucal sau n laringe i c) dup modul de articulare.
Schema articulaiilor intrabucale* (organele care nu intervin n fonaie nu sunt indicate)
fosele nazale centrul palatului postpalatale vlul palatului velare omuorul e h uvulare dosul limbii dorsale f

palatul anterior palatale anterioare dinii (de sus) alveole b a punctul limbii apicale c d

faringele g

a articulare apicodental b articulare alveolar c articulare anterioar d articulare palatal e articulare postpalatal i velar f articulare uvular g articulare faringal h articulare cu ridicarea vlului (articulare oral)

laringele

Dezvoltarea cunotinelor despre aceste mecanisme s-a fcut att prin nregistrarea vorbirii (fonograme palatograme, filmare radiografic), ct i prin metodele foneticii experimentale de la chimograf la analizori de sunet i sonograf. Cu ajutorul acestor aparate s-a putut identifica formantul, acea zon n care se concentreaz energia acustic specific diverselor sunete i, astfel, determina locus-ul consoanelor, dependent de trsturi contextuale i de tranziie a undei sonore. Oclusivele, de exemplu, pot fi identificate numai n funcie de deplasarea n sus sau n jos a formanilor vocalelor nvecinate.
Dup A. Martinet, Elmnts de linguistique gnrale, Ed. Armand Colin, Paris, 1967, p. 47. 131
*

Pentru lingvistica general este important concluzia la care au ajuns cercettorii i anume c, n fiecare limb articularea sunetelor se face ntr-un mod specific (dei ele se produc n aria acelorai locus-uri) i c este greit s se dea caracterizri de felul: sunetul x din limba englez, din cuvintele .... se pronun ca sunetul x din romn, din cuvintele.... Dei se transcriu aproximativ identic n alfabetul fonetic internaional, foneticienii atrag atenia c este o greeal a celor care nva o limb strin folosirea unor asemenea analogii. Pentru c este necesar o reorganizare a deprinderilor att de pronunare, ct i de receptare (ascultare), o distincie ntre dou sunete atunci cnd exist deprinderea corespondenei cu un sunet unic n limba matern i, invers, a le pronuna drept un sunet n limba strin, atunci cnd ele reprezint un sunet n limba matern. O bun deprindere de articulare se face prin ascultarea sunetelor strine i deprinderea de a le articula prin imitarea modului n care o fac vorbitorii limbii respective (vorbitori nativ sau foarte buni cunosctori al ei), n cadrul sistemului fonetic al limbii strine. n caz contrar, cel care deprinde o limb strin n mod autodidact va rmne cu sechele de pronunare deformat, dac va apela la sistemul de articulare din limba matern (Gleason, p.12). Cunoaterea principiilor fundamentale ale structurii unei limbi, adic rezultatele cercetrilor de lingvistic general, sunt utile din multe puncte de vedere pentru pronunarea corect a limbii strine. Adaptarea la noua limb achiziionat se face prin adoptarea unor noi deprinderi de pronunare. n perioada contemporan s-a constatat, astfel, c la populaii care au fost transferate n mas n locuri noi de vieuire, colonii au deprins trsturile de pronunare ale localnicilor care, uneori, au condus i la fenomene de aa-numit hipercorectitudine, care, n cazul de fa ar trebui ncadrate, de fapt, la hiperalienri, aa cum a denumit Th.Gartner acest fenomen (ap. W. von Wartburg). Exemplul citat de ctre Gartner se refer la pronunarea de ctre sicilieni n loc de sunetele ll a sunetelor apicale dd. n cteva sate din Sicilia au fost colonizai locuitori din nordul Italiei care pronunau, n locurile de unde veneau, att sunetele ll, ct i l simplu ntr-un mod identic, Aa c, atunci cnd au mprumutat pronunarea local, care nlocuise ll prin dd, ei au extins pronunarea cu dd i pentru l simplu. Astfel, n satele locuite de ei se pronun nu numai stidda sau stedda, n loc de stella, dar i dduna sau ddagrima, n loc de formele luna i lagrima, uzuale n zonele de unde proveneau. Atestarea acestui tip de deprinderi deschide o nou perspectiv de apreciere a fenomenelor de extindere a fenomenului de nlocuire a unor sunete prin altele n limbile naturale de-a lungul istoriei lor.
132

FONOLOGIA

Termenul are dou sensuri: 1. Nivel al structurii unei limbi incluznd elementele fonice segmentale i suprasegmentale cu funcie distinctiv i 2. Disciplin lingvistic studiind elementele fonice n perspectiva funciei acestora de a distinge semnificaii. Fonologia este o fonetic structural. Stabilirea identitii sau a non-identitii funcionale a elementelor care compun fluxul sonor se face utiliznd anumite criterii i proceduri, diferite de la o coal lingvistic la alta. Determinarea i explicarea acestora constituie obiectul fonologiei generale, n timp ce fonologia unei anumite limbi implic delimitarea i descrierea unitilor invariante ocurente din limba considerat, precum i a trsturilor distribuionale care le caracterizeaz (DL).
FONEM (INVARIANT) I ALOFONE (VARIANTE)

Fonemul este unitatea minimal a unui sistem lingvistic. Dac studierea fonemelor unei limbi se face n perspectiva sunetelor i nu a unitilor sistemului, se constat c n realitate pronunarea lor este variabil, ns variaia are loc n jurul unui nucleu stabil al pronunrii. Diferenele perceptibile sunt considerate drept variante, n comparaie cu fonemul, care este o form invariant. Diferena minimal ntre dou segmente sonore dotate cu sens este cea care afecteaz un singur fonem. Fonemul este o clas de sunete: 1) care sunt foarte asemntoare din punct de vedere fonetic (descrierea se face pe baza articulaiei); 2) care prezint distribuii caracteristice n limba sau n vorbirea respectiv. Este necesar precizarea c nu exist sunete n general, ci doar sunete specifice unei anumite limbi sau vorbiri. S-a constat c n orice limb fonemele sunt n distribuie (variaie) liber sau n distribuie complementar. n prima situaie este vorba de specificul vocii umane, produs de un aparat vocal foarte exact, dar care pronun sunetele cu variaii (de articulare, de intensitate, de nlime etc.). Aceste variaii nu sunt regulate, prin urmare diferenele aflate n variaie liber, produse de pronunare, nu sunt pertinente. Sunetele care se afl totdeauna n variaie liber nu pot fi foneme diferite.
133

Se consider c sunetele sunt n distribuie complementar atunci cnd fiecare sunet figureaz ntr-un ansamblu fix de contexte, unde nu figureaz niciodat altele. Orice sunet (sau clas de sunete) care este n distribuie complementar cu un altul, nct constituie un singur fonem, este un alofon al acelui fonem. Prin urmare, un fonem este o clas de alofone. Clas nseamn uniti omogene sub aspectul criteriului de clasificare. Gleason citeaz dou criterii pentru clasificarea alofonelor vs. foneme. Primul criteriu, asemnarea fonetic, poate fi aplicat fr referin la folosirea real a sunetelor ntr-o anume limb, prin urmare este un principiu general. Al doilea criteriu, distribuirea non-contrastiv, are sens numai ntr-o anume limb i rezultatele depind de datele de natur statistic, adic de mrimea eantionului folosit (pentru c a stabili distribuia n ntreaga limb este aproape imposibil). Observm c definiia fonemului este limitat la o singur limb, pentru c nu exist un fonem general /p/, ci exist un fonem /p/ englez, dup cum exist un fonem /p/ hindi [.a.m.d.]. Acelai fonem nu este identic [n limbi diferite], pentru c fiecare este o unitate a unei limbi anumite i este pertinent doar n acea limb (Gleason, p.209) (subl. n.). Este de reinut, pentru cei care nva o limb strin, faptul c ei trebuie s nvee s fac (att la pronunare, ct i la decodare) distincii fonologice n cea de a doua limb i s evite a face distincii care nu sunt pertinente, chiar dac n limba matern aceste distincii sunt fonologice. Deoarece unele limbi utilizeaz sunete foarte asemntoare, dar care sunt organizate n sisteme fonologice diferite. A nva s folosim diferit sunete deja cunoscute este mult mai dificil dect a nva utilizarea unor sunete complet noi. O astfel de situaie este agravat dac se dau explicaii (de exemplu pentru vorbitori de limba englez care nva limba francez) de felul: /i/ francez se pronun ca i din machine, deoarece acest i este pronunat /ij/ de majoritatea vorbitorilor de limb englez din America. Gleason subliniaz importana principiilor de lingvistic general aplicate n procesul de nvare a unei limbi strine: folosirea corect a alofonelor este indispensabil oricui dorete s se exprime ntr-o limb strin ca i vorbitorii nativi. Acest obiectiv este accesibil, cu rezerva c doar cine are caliti excepionale de mim poate s ajung la aceast competen fr s cunoasc problema fonemelor. Fonemul este conceptul cel mai important pe care un student care nva limbi strine trebuie s-l aib n vedere n pregtirea sa lingvistic. Fonemele unei limbi sunt ntr-un numr finit. Astfel A. Martinet a declarat c folosete limba francez cu 34 de foneme, dar printre
134

subiecii anchetai din zona parizian, nscui dup 1940, majoritatea folosesc un sistem de 31 de foneme. Castiliana deosebete 24 de foneme n timp ce limba spaniol vorbit n America conine deseori 22 de foneme, n loc de 24 (A. Martinet, p.19). n limba englez au fost identificate 46 de foneme. Una dintre observaiile pertinente ale lui Gleason (p.27) este cea care atrage atenia asupra faptului c lista total a fonemelor unei limbi (n cazul dat limba englez) este unic, dar distribuia vocalelor i consoanelor variaz n vorbire, altfel spus puine cuvinte sunt pronunate n acelai fel n vorbirea din diferite zone. Iat imaginea sistemelor vocalice a dou limbi, engleza i germana, ap. Constantin Dominte, Filologice, vol. I, Bucureti, Editura Universitii, 2004, p. 193, 194.

Reprezentarea simplificat a sistemului vocalic al limbii engleze

Sistemului vocalic al limbii germane

135

Inventarul consoanelor tip din limba englez este urmtorul (n transcrierea lor cu simboluri general acceptate n Alfabetul fonetic internaional): /b/ /d/ /f/ /g/ /h/ /k/ /l/ /m/ /n/ /p/ /r/ /s/ bill dill fill gill hill kill Lil mill nil pill rill sill tab Tadd taff tag tack till tam tan tap tear Tass /t/ /v/ /w/ /j/ /z/ / / // // / / // // // till ville will jet zeal thigh thy shall chill Jill tat have has cloth clothe hash rouge hatch edge tang

n limba englez fonemele // i // nu se ntlnesc niciodat ca iniial, /h/ aa cum a fost definit, nu se gsete la finala unui cuvnt, iar /w/ i /j/ de asemenea nu se ntlnesc n final. De aceea exist casetele goale n tabelul de mai sus (Gleason, p.19). Analiza fonologic i propune, prin urmare, identificarea elementelor fonice dintr-o limb i clasificarea lor dup funcii. a) Funcia principal este cea distinctiv sau opozitiv (semnul din fluxul sonor este n opoziie cu oricare alt semn); b) funcia contrastiv permite auditorului analiza enunului n uniti succesive i c) funcia expresiv ofer informaii despre locutor (de exemplu, lungirea i pronunarea ntrit, n limba francez, a lui /p/ din impossible, n enunul cet enfant est impossible, trdeaz iritarea real sau voit). Folosirea metodei constituenilor imediai (= operaii succesive de segmentare) permite fonologului s degajeze unitile minime, adic fonemele. Unii fonematicieni au considerat a fi un caracter fonematic a dou sunete lingvistice dac comutarea lor d natere la alte cuvinte. (Comutarea este procedeu de analiz a limbii constnd n urmrirea consecinelor pe care substituia [= nlocuirea ntr-un context constant] reciproc a unitilor n plan structural [al expresiei sau al coninutului], ntr-un context dat, le produce n cellalt plan).
136

Definiia fonemului este formal sau mai puin formal, dependent de orientarea teoretic a lingvitilor, care aleg criterii obiective de tipul distribuiei fonemelor n limb sau descrierea lor. coala fonologic de la Praga a introdus i punctul de vedere psihologic (sensul n limb) sau cel al realitii fizice (articularea, analiza undelor sonore), prin care fonemul se manifest concret. Definiiile formulate de Emil Ionescu pot fi considerate exemplare: Dou sau mai multe uniti de expresie nonechivalente i utilizate ca uniti minimale n vorbire se numesc foneme. Dou sau mai multe uniti de expresie echivalente i utilizate ca uniti minimale n vorbire se numesc alofonele unui fonem (op.cit., p. 119). Jakobson a urmrit s identifice legile generale ale structurii unui sistem fonetic.
BIBLIOGRAFIE DL = Dicionar de tiine ale limbii (autori: Angela Bidu-Vrnceanu, Cristina Clrau, Liliana Ionescu-Ruxndoiu, Mihaela Manca, Gabriela Pan Dindelegan), Bucureti, Ed. Nemira, 2001. H.A. Gleason, Introduction la linguistique, Paris, Ed. Larousse, 1969. Emil Ionescu, Manual de lingvistic general, Bucureti, Ed. All, 2001. Bertil Malmberg, Les nouvelles tendances de la linguistique, Paris, PUF, 1966. Emanuel Vasiliu, Fonologia unei limbii romne, Bucureti, Ed. Academiei, 1965. CHESTIONAR 1. Care sunt criteriile de clasificare a sunetelor ? 2. Care sunt funciile fonice ? 3. Ce se nelege prin clas de alofone ?

137

MORFOLOGIA STUDIUL FLEXIUNII

MORFEMUL. ACCEPIILE TERMENULUI

Unitatea fundamental a limbii proprie nivelului morfematic poart numele de morfem. Spre deosebire de foneme, care reprezint numai latura de expresie a limbii i care dei contribuie la diferenierea sensurilor nu au sens propriu, morfemele sunt uniti minimale de expresie purttoare de sens. Definirea morfemului drept secven fonic minimal dotat cu sens i aparine lingvistului rus I.A. Baudouin de Courtenay i dateaz din jurul anului 1880. Morfemul cuprinde, n viziunea lui de Courtenay, toate afixele i rdcinile, ca pri componente ale cuvntului. Aceast accepie este mprtit de coala lingvistic rus, de o parte a lingvitilor americani i romni. n concepia glossematic, mai cu seam a lui L. Hjelmslev, morfemul este o unitate din planul coninutului. nveliul extern (sonor) al morfemului, alctuit din unul sau cteva foneme, poart n opinia structuralitilor danezi numele de formant i poate exprima mai multe morfeme. Un formant cum este, de pild, -m din lucrm conine dou morfeme: persoana I i plural. Termenul de morfem se ncadreaz ntr-o categorie i corespunde, n mare, valorilor gramaticale din gramatica tradiional (Guu Romalo, p.8). O categorie cum este cea a genului cuprinde, n romn, morfemele de masculin, feminin i neutru. Andr Martinet i reprezentanii curentului funcionalist au nlocuit termenul generic de morfem cu cel de monem unitate minim de expresie dotat cu sens , cruia i se subordoneaz lexemul i morfemul. ntr-un cuvnt cum este umbl, Martinet identific dou moneme: primul, umbl-, monem lexical (lexem), iar cel de-al doilea, -, care marcheaz persoana i numrul, monem gramatical sau morfem. Termenul de morfem se opune, n numeroase studii de specialitate, rdcinii cuvntului, el incluznd numai unitile de expresie purttoare de semnificaii gramaticale. Introducerea rdcinii n rndul morfemelor este motivat de tendina evitrii conceptului de cuvnt, insuficient de clar definit. n
138

lingvistica modern, morfemul, i nu cuvntul, reprezint unitatea fundamental. Cuvntul, atunci cnd e luat n discuie, e considerat o combinaie de morfeme, tip special de sintagm, deci subordonat morfemului, pe cnd n lingvistica tradiional, care definete morfemul ca parte, ca diviziune a cuvntului, morfemul era subordonat cuvntului (Iordan, Guu Romalo, Niculescu, p.45). Rdcina nu exist izolat, ea face parte din cuvinte i trebuie studiat mpreun cu celelalte pri ale cuvintelor; cnd avem impresia c rdcina e izolat, avem de fapt sufixul i desinena zero, prin urmare rdcina ajunge s reprezinte i celelalte elemente ale cuvntului, despre care nimeni nu se ndoiete c sunt morfeme (Graur, p.5).
CRITERIILE DE CLASIFICARE A MORFEMELOR

Unul dintre criterii este reprezentat de posibilitile de combinare a morfemelor. Unele morfeme, care pot s apar singure ori combinate cu un morfem zero: frig, loc, zvon, sunt morfeme i n d e p e n d e n t e. Morfemul -uri, de pild, care marcheaz pluralul nominativacuzativ al substantivelor de mai sus necesit, ns, prezena unui alt morfem, independent, cruia s i se ataeze. Asemenea morfeme sunt d e p e n d e n t e. n categoria morfemelor dependente intr desinenele, sufixele, prefixele. Ele pot fi comutabile cu zero: copil-a, re-aduc-e i pot s comute unele cu altele: grdin- / grdin-i; priv-i / priv-ind / priv-ete / priv-ea; r-uc- / r-ioar-. Deoarece, din punctul de vedere al distribuiei, aparin aceleiai clase cu morfemele frig, zvon, sunt considerate independente i morfemele de tipul grij-(grij-), comutabil cu coaj(-), main(-) etc. E. Vasiliu consider morfemele-rdcin de tipul frig, vnt, morfeme l i b e r e, elementele flexionare, toate afixele (care pot constitui enunuri numai nsoite de alte morfeme): in- (in-uman), - a (copil-a) morfeme l e g a t e, iar morfemele de tipul grij-(care pot forma enunuri numai cnd se combin cu un morfem legat) morfeme s e m i l e g a t e (Vasiliu, p.29-30). Criteriul structurii expresiei delimiteaz morfeme c o n t i n u e formate dintr-un ir nentrerupt de foneme sau formate dintr-un singur fonem (zid, -r-, -a, -a-) i morfeme d i s c o n t i n u e. Acestea din urm pot fi ntrerupte sau repetate. Sunt considerate ntrerupte acele morfeme n interiorul crora se intercaleaz corpul fonetic al unui alt morfem. Asemenea morfeme se ntlnesc, de pild, n german, la formele de participiu: singen gesungen, lernen gelernt. n limba
139

romn morfeme ntrerupte se ntlnesc la formele de infinitiv ale verbelor: a cnt-a, la formele genitivale: al tatlui. Morfeme repetate se ntlnesc n limbile care cunosc fenomenul sintactic al acordului gramatical: rom. fat frumoas / fete frumoase. Morfemul de feminin singular sau plural apare att la substantive, ct i la adjective. n englez, n schimb, numai substantivul i schimb forma: nice girl / nice girls. Natura coninutului morfemelor delimiteaz morfeme lexicale, care cuprind morfeme-rdcin (copil, loc, cas-, coal-) i afixe derivative, ce contribuie la formarea unor cuvinte noi: ne-, re-, des(dez-), -a, -ic, -esc etc. i morfeme gramaticale: n loc de sufixe (exprim, la verbe, modul i timpul: lucr-a-se, gs-ind), desinene (care exprim persoana i numrul verbului cnt-a-i, iar n cazul flexiunii nominale valorile de gen, numr i caz: frumoasei fete). Menionm c rdcina este morfemul lexical central, neanalizabil din punct de vedere morfologic, comun cuvintelor ce aparin aceleiai familii: om, omenos (-oas), omenie, omenire, omenesc (-easc), (a) omeni, omenit (-), omuor, omule, neom, neomenos (-oas), neomenete, neomenit (-), supraom, supraomenesc (-easc). Rdcinii i se ataeaz, deci, grupuri de sunete cu ajutorul crora se formeaz cuvinte noi sau forme diferite ale aceluiai cuvnt: omului, omule, oamenilor. Morfemelor de mai sus li se poate aduga i o a treia clas, a morfemelor lexico-gramaticale, care au att capacitatea de a forma cuvinte noi, ct i valoare gramatical. Prefixe cum sunt: arhi-, ultra-, hiper-, prea- formeaz nu numai cuvinte noi, dar pot marca i superlativul adjectivelor: arhicunoscut, ultramodern. Sufixele moionale cum sunt -i: pictor-i, colr-i; -c: romn-c, pui-c; - oaic: lup-oaic, zme-oaic; - eas: croitor-eas sunt sufixe lexicale, care formeaz cuvinte noi, dar exprim i categoria gramatical a genului (feminin). La verbul a desen-a sufixul final este att morfem lexical, care contribuie la formarea unui cuvnt nou, ct i morfem gramatical, ce contribuie la exprimarea modului infinitiv. Criteriul poziiei fa de morfemul independent distinge morfeme dependente plasate n faa, n interiorul ori n spatele rdcinii cuvintelor, cunoscute, toate la un loc, sub numele de afixe. Ele servesc la formarea cuvintelor, la precizarea sensurilor, la exprimarea relaiilor dintre cuvinte. Prefixele sunt morfeme aezate naintea morfemului independent (dez-aproba, bi-lunar, pre-colar, ne-nchipuit, co-autor). Cu ajutorul
140

lor se formeaz cuvinte noi de la cuvintele existente n limb, care aparin aceleiai categorii gramaticale de la care s-a pornit: engl. antibody, improbable, forefather, to undo, to reread sau unor categorii diferite: bedew, encircle. Puin utilizate n indo-european, unele prefixe s-au dovedit a fi foarte productive n limbile moderne: namora, narma, nlbi, nspri, nclca, nclzi, ncruni, nctua, ncercui, nchipui, ncnta, ncoli, ncredina etc. (prefixul provine din prepoziia n). Menionm, ns, c n alte limbi (ugro-finice, turcice) nu exist prefixe, cuvintele ncepnd totdeauna cu rdcina. Infixele sunt afixe de regul monofonematice (o sonant nazal, -m- sau n-), care se introduc n rdcina cuvntului. ntlnite n vechile limbi indo-europene, ele nu mai caracterizeaz limbile europene moderne. Ex.: lat. rumpo, rumpere, rupi, ruptum; vinco, vincere, vici, victum. n limbile indo-europene moderne se ntlnete ns un mare numr de sufixe. Acestea sunt afixe care se adaug dup rdcin i formeaz teme sau cuvinte noi: alb-i-se, copil-a, engl. profit-eer, to black-en. Tema este o structur morfematic complex, construit n jurul unei rdcini, o secven constant a cuvntului ntr-o paradigm verbal sau nominal. n cuvntul prefcui, de pild, tema este format din prefixul pre-, rdcina -fc- i sufixul -u-. Uneori tema include mai multe sufixe: pre-fc-u-se-i (-u- sufix al tuturor timpurilor trecute, iar -se- sufix al mai mult ca perfectului). Un alt morfem dependent, gramatical, diferit de afixele susmenionate (care pot fi i lexicale) i adugat dup rdcin i dup tem este reprezentat de desinen e. Ele sunt morfeme specializate care indic, n paradigma nominal, la substantiv numrul i cazul: student- (sg., N.-Ac.) student-ei (sg., G. D.), iar la adjective genul, numrul i cazul: acestei studente (fem., sg., G. D.). n limba rus de exemplu, n flexiunea substantivelor o desinen poate fi polisemantic: n forma ruki, desinena -i poate marca fie singularul genitiv, fie pluralul nominativ-acuzativ. Alteori accentul este cel care precizeaz valoarea desinenei: master (pl., N.), mstera (sg., G.). n flexiunea verbal desinenele marcheaz numrul i persoana: desen-ez-i (sg., pers. II). Uneori se ntlnete fenomenul omonimiei morfemelor-desinen: desinena de persoana I sg. a imperfectului e omonim cu cea de persoana I pl.: eu calcul-a-m / noi calcul-a-m. Fenomenul de omonimie a morfemelor gramaticale este relativ des ntlnit n limba romn: primul sufix -se- din verbul culesese este o marc a perfectului, iar cel de-al doilea a mai mult ca perfectului;
141

n substantivul poart morfemul desinen - (fem., N.-Ac.) se opune desinenei -i din pluralul pori; aceeai desinen - n forma verbal de singular (el) poart se opune desinenelor de persoana I eu port i desinenei -i de persoana a II-a tu pori etc. Alteori acelai morfem gramatical este marcat prin desinene diferite: engl. sg. plateau - pl. plateaus / plateaux; sg. bear - pl. bears sau bear- ; sg. bufalo - pl. bufaloes, bufalos, bufalo- (formele de plural bear- , bufalo- se ntlnesc n limbajul vntorilor). Un alt criteriu de clasificare l reprezint distana morfemelor dependente fa de cel independent. Sufixele i desinenele se pot afla n imediata vecintate a rdcinii - pe poziia I: lucr-a, lucr-ez, ori la distane mai mari fa de aceasta, ocupnd poziia a II-a: lucr-a-se, a III-a lucr-a-se-r sau a IV-a lucr-a-se-r-i. Unele desinene se pot afla pe poziii diferite: balcoan-e (poziia I) balcon-a-e (poziia a II-a); beiv-i (I) beiv-an-i (II). Prefixele pot ocupa i ele poziia I, cnd sunt plasate imediat lng rdcin: in-uman, a-poetic sau poziia a II-a: re-n-chiri-a. Unele prefixe pot ocupa att poziia I, ct i poziia a II-a: ne-clar, re-da sau ne-re-cunot-in, re-n-col-i. Menionm c morfemul-rdcin ocup poziia zero, o poziie de reper pentru afixe. O alt clasificare a morfemelor se face avndu-se n vedere numrul de morfeme dependente combinabile. Exist, astfel, morfeme dependente care necesit prezena unui singur morfem independent: -ist fotbal-ist; -esc romnesc; -ea ved-ea. Altele au nevoie, n schimb, n afara morfemului independent, i de prezena unor alte morfeme dependente: cit-i-se-r-m, arip-ioar-. Exist i morfeme care pot aprea n ambele situaii: inel-u / inel-u-e, mn-u-. Criteriul naturii expresiei delimiteaz, pe de o parte, morfeme s e g m e n t a l e, care sunt reprezentate prin foneme propriu-zise (cart-, -e), iar pe de alt parte morfeme s u p r a s e g m e n t a l e, reprezentate de accent i intonaie. Accentul poate diferenia, n romn, att cuvinte (rin-arn, cele-acle), ct i forme gramaticale ale unor cuvinte. Astfel, morfemul - din forma de indicativ prezent adun- este reprezentat numai de elementul segmental -, n timp ce morfemului - din forma de perfect- simplu adun- i se adaug i accentul. Deoarece se scriu la fel, asemenea forme gramaticale se numesc omografe.
142

n limba turc, n care accentul st, n general, pe ultima silab, sunt ntlnite opoziii de tipul Mehmt (subiect) Mhmet (vocativ). Alte limbi, cum este, de exemplu, vietnameza, nu au accent. Morfem de sine stttor poate fi i intonaia. Un enun cum este: Rspunde bine poate fi rostit cu o intonaie care coboar, enuniativ, sau care urc n final, interogativ. Dac vocativul este marcat, uneori, de morfeme-desinen specifice: Florico!, Radule!, cumnate!, uneori numai factori de natur suprasegmental pot delimita formele de nominativ de cele de vocativ: Petre (N.) / Petre! (V.), Zoe (N.) / Zoe! (V.), Mimi (N.) / Mimi! (V.), Roberto (N.) / Roberto! (V.). Aceleai forme suprasegmentale disting vocativul de formele identice ale genitiv-dativului plural: Frailor! (V.) / frailor (G.-D.); Vitejilor! (V.) / vitejilor (G.-D.). Intonaia este foarte important n limbi cum sunt chineza, vietnameza etc. Ea are nu numai rolul de a diferenia cuvinte (ch. m mam, m cnep, ma cal, m a injuria), dar are i valoare de morfem: n limba fula (limb nigero-congolez) o wara el omoar, o war el a fost omort.
CAZURI PARTICULARE DE MORFEME DEPENDENTE

Cazurile particulare de morfeme dependente sunt reprezentate de morfemul zero (un morfem lipsit de expresie fonic, material, care are ns coninut) i de interfixe (care, dimpotriv, sunt lipsite de coninut, ns au o expresie material).
MORFEMUL ZERO

Lipsa unor sufixe sau desinene poate s constituie, uneori, o trstur ce difereniaz ntre ele forme ale unor cuvinte. Dac raportm, de pild, formele de plural ziduri, scaune la formele corespunztoare de singular zid, scaun, se impune s recunoatem n structura ultimelor forme desinena zero, marc a singularului; raportat la forma de N. Ac. pl. basmale, forma basma de N. Ac., sg. conine un morfem zero. La formele verbale de prezent, pers. I de tipul rup, dreg, aleg, dorm, nu exist sufixe, desinenele sunt zero, iar forme cum sunt cele de imperfect sau mai mult ca perfect (pers. a III-a) ca rupea, auzise se caracterizeaz printr-o desinen zero (rupeam, rupeai, dar rupea ; auzisem, auzisei, dar auzise ). Morfemul zero poart, deci, o informaie gramatical, opunnd, ntre ele, diferite forme dintr-o paradigm.
143

INTERFIXUL

Interfixul este un segment de expresie lipsit de accent i de sens, de coninut propriu, plasat ntre rdcina i sufixele unor cuvinte derivate. El ocup totdeauna poziia I i apare, mai cu seam, la cuvintele neologice. Dac de la mai vechiul substantiv de provenien slav prieten se obin derivate cum sunt prietenete, prietenesc, la unele neologisme constatm plasarea n seriile paralele a unor interfixe: camarad-erete, camarad-er-esc sau pirat-er-ete, pirat-er-esc.
ELEMENTE EXTRAMORFOLOGICE CU ROL DE MORFEME GRAMATICALE

Exprimarea diferitelor categorii gramaticale ale numelui (gen, numr, caz, grade de comparaie) i ale verbului (diatez, aspect, mod, timp, persoan, numr) se poate realiza i cu ajutorul unor elemente nemorfologice. Accentului i intonaiei abordate mai sus, li se pot aduga alte cteva asemenea morfeme. Reduplicarea const n repetarea unuia sau a mai multor foneme din rdcina unui cuvnt (uneori a ntregii rdcini, teme, a ntregului cuvnt). Prin acest proces cuvintele primesc noi valori morfologice ori stilistice sau sunt create cuvinte noi. Fenomenul este ntrebuinat, n unele limbi, pentru a exprima pluralul. ntr-una dintre cele mai cunoscute limbi africane, hausa, pluralul unui substantiv cum este biri maimu are forma biri biri, busa fluier formeaz pluralul busa busa; n japonez yama munte are pluralul yamayama; orang om, din malaez, are forma de plural orang-orang. Uneori reduplicarea este nsoit de mici modificri fonetice: jap. kuni ar pl. kuni-guni. Ea poate fi total (ca n cazurile de mai sus) sau parial: magana cuvnt pl. maganganu, n hausa. Uneori pluralul se formeaz prin reduplicarea celei de-a doua consoane din radical: tufa estur pl. tufati; iri fel pl. irari. Reduplicarea nu este utilizat, ns, totdeauna, ca morfem de plural. n latin, greac, sanscrit, ea exprima indicativul perfect: lat. do dedi, gr. dicmi ddoka. ntr-un dialect al limbii maori reduplicarea poate fi marc a gradului superlativ: nu mare, nu-nui foarte mare sau a simultaneitii aciunii: nofo a locui, nonofo a locui (n acelai timp cu cineva).
144

Fenomenul reduplicrii se ntlnete i n limba romn: a da ddui, ddusem, ddeam, a sta sttui, sttusem, stteam sau n construcii cu valoare de superlativ cum sunt: Apa era rece-rece. Rol de morfem gramatical poate avea i lungimea vocalei n limbile n care exist vocale lungi i scurte (latin, greaca veche, sanscrit, leton): lat. silva (N., Voc., sg.) silv (Abl., sg.), n care lungimea vocalei exprim opoziia cazual; vnit vnit, fgitfgit, n care exist o opoziie temporal. Geminarea (dublarea sau lungirea) consoanelor poate fi, i ea, marc a unui morfem gramatical. n lapon, n eston, geminarea consoanelor poate contribui la exprimarea opoziiilor cazuale: est. kapi al dulapului, kappi n dulap. Flexiunea intern const n modificarea sunetelor din rdcin n scopul marcrii formelor gramaticale. Fenomenul este des ntlnit n limbile semitice, n care rdcina unui cuvnt este reprezentat printr-un scurt schelet consonantic neschimbat n cursul flexiunii n interiorul cruia se introduc vocale caracteristice pentru diferite forme gramaticale. n arab, de exemplu, de la rdcina ktb a scrie se pot crea fie alte forme verbale kataba a scris, fie cuvinte diferite: ktib scriitor, secretar (cel care scrie), kitb carte. Pluralul este marcat i el, deseori, prin schimbri ale vocalelor interne: kitb pl. kutub; rajul prieten pl. rijal. n limbile indo-europene alternanele fonetice constituie, mai rar, unica modalitate de marcare a flexiunii: engl. sing sang sung, cling clung clung, dig dug dug forme de infinitiv, trecut i participiu ale verbelor; forme substantivale de singular i plural ca man men, foot feet. n limba romn alternanele vocalice i consonantice destul de numeroase au rolul de a diferenia formele gramaticale n manier suplimentar, n mod redundant: coal coli, mas mese, mr meri, dud duzi. Supletivismul opoziia dintre cuvinte formate de la rdcini (teme) diferite, care au, ns, aceeai valoare lexical poate avea, i el, rol de morfem gramatical. Semnalm forme cum sunt germ. sg. Man pl. Leute, rus. sg. elovk pl. ljdi, sg. rebjnok pl. dti. n limba rus fenomenul este i marc a aspectului verbal: govort skazt, brat vzjat, iskat nati. Des ntlnit este fenomenul n limbile indo-europene n formarea gradelor de comparaie ale adjectivelor i adverbelor: engl. bad comp. worse, well comp. better, ill comp. worse; fr. bon comp. meilleur; germ. gut comp. besser.
145

Fenomenul marcheaz i opoziiile de persoana I i a II-a a pronumelor personale: fr. je nous, tu vous; rus. ja my, ty vy; rom. eu noi, tu voi. n limba romn fenomenul nu este foarte des ntlnit. Menionm formele diferite pe care le capt, n conjugare, verbul a fi: sunt, eti, eram, fui, fusei, fost. Rol de morfem gramatical poate juca i topica. n limbile cu o flexiune bogat raporturile dintre cuvinte sunt marcate cu ajutorul desinenelor, ordinea n care sunt dispuse cuvintele fiind relativ indiferent. Horatius videt Paulum Horaiu l vede pe Paul este acelai lucru cu Paulum videt Horatius Pe Paul l vede Horaiu, deoarece subiectul indiferent de locul n propoziie este cel marcat prin desinena us, iar obiectul prin desinena um. n francez, n schimb, se impune ordinea subiect predicat obiect: Horace voit Paul. n limbile lipsite de flexiune sau n care cuvintele flexioneaz n mai mic msur (englez, chinez, japonez, bulgar) ordinea pe care o au cuvintele ntr-o propoziie poate fi indice al funciei gramaticale a acestora. Sensurile gramaticale pot fi redate i cu sprijinul cuvintelor auxiliare (prepoziii, conjuncii, verbe auxiliare, adverbe, articole etc.). Prepoziiile pot preciza funciile cazurilor (pe copil, la copil, spre copil, pn la copil, pentru copil, despre copil .a.), pot forma anumite cazuri: rom. spune ntmplarea la toi (D.), fr. le livre de Monique (G.), donner le livre Monique (D.), pot deosebi ntre ele moduri verbale: scris (participiu) de scris (supin). Conjunciile exprim raporturi de coordonare sau de subordonare, contribuind, uneori, la marcarea unor opoziii gramaticale: dorm (indicativ) s dorm (conjunctiv). Adverbele pot constitui mrci ale gradelor de comparaie: fr. plus, trs; rus. oen; rom. foarte, prea. Articolele considerate n gramaticile moderne morfeme, nu pri de vorbire distincte pot contribui la exprimarea cazului: al omului; n exemple de tipul copiii fac greeli / greeli fac copiii, indiferent de topic, subiectul este exprimat prin substantivul articulat, iar obiectul prin cel nearticulat. Verbele auxiliare (a fi, a avea, a vrea, fr. tre, avoir) contribuie la exprimarea unor categorii gramaticale verbale: sunt neles (diatez), am deschis, voi ncerca, voi fi scris (timp); fr. je suis parti, jai mang (timp).
MORFEM (INVARIANT) I ALOMORFE (VARIANTE)

Analiza unui text sau ir de enunuri n uniti minimale semnificative duce la evidenierea unui numr mare de elemente concrete, ntre care unele apar n contexte identice sau foarte asemntoare, putnd fi grupate la un loc, dei sunt diferite ca expresie.
146

Pentru a determina o clas de morfeme se folosete analiza distribuional. n limba romn, de pild, la substantivele feminine culoar-e/ culor-i, vizit-/ vizit-e, basma- / basma-le, remarcm desinenele de singular - e, - , - , respectiv -i, -e, -le de plural. Dei diferite ca expresie, ele realizeaz aceleai morfeme: morfemul de feminin, N.-Ac., singular i pe cel de feminin, N.-Ac., plural. Desinenele -e, -, -, respectiv -i, -e, -le constituie alomorfele morfemelor sus-menionate. Invariantele (morfemele) se realizeaz, deci, printr-o clas de elemente concrete care apar, de regul, n poziii n care toate celelalte variante sunt excluse. Rareori sunt admise dou (sau mai multe) variante n aceeai poziie: chibrit-e/ chibrit-uri. n englez morfemul de plural al substantivelor poate fi realizat prin alomorfele /s/, /z/, /iz/: cats /kts/, dogs /dogz/, roses /rouziz/. La verbe, alomorfele /s/, /z/, /iz/ constituie morfemul de persoana a III-a prezent: he takes /s/, he runs /z/, he kisses /iz/. Morfemele se realizeaz prin anumite alomorfe n funcie de contextul fonetic sau de cel morfologic. Atunci cnd prezena variantelor poate fi pus pe seama unor particulariti de natur fonetic a contextului n care apar, alomorfele sunt fonetice, iar cnd se datoreaz apartenenei elementului care reprezint contextul la o clas caracterizat morfologic, alomorfele sunt morfologice (Iordan, Guu Romalo, Niculescu, p.47). Substantivele neutre romneti selecteaz, la plural, desinenele -e, -uri, -i, i -. Primele dou, des ntlnite, care apar n condiii fonetice similare: lemn/-e, tren/-uri; atlas/-e, compas/-uri, reprezint alomorfe morfologice. n schimb, alomorfele i, ntlnit dup un radical n i aton: suplici-i, sacrifici-i i , realizat numai dup un radical n vocal labial: ou/ou-, sunt considerate alomorfe fonetice. Rareori alomorfele se realizeaz n contexte ce nu pot fi caracterizate fonetic sau morfologic: rom. om/oam-eni, engl. ox/ox-en. Asemenea alomorfe sunt considerate alomorfe lexicale.
BIBLIOGRAFIE R.A. Budagov, Introducere n tiina limbii, Ed. tiinific, Bucureti, 1961, p. 239. Paula Diaconescu, Evoluia noiunii de morfem i stadiul actual al analizei morfematice, n vol. Elemente de lingvistic structural, red. Ion Coteanu, Ed. tiinific, Bucureti, 1967, p. 90-112. Al.Graur, Note asupra structurii morfologice a cuvintelor, n Studii de gramatic, II, Ed. Academiei, Bucureti, 1957, p. 3-18. 147

Al.Graur (coord.), Introducere n lingvistic, Ed. tiinific, Bucureti, 1972, p. 157-163, 230-237. Al.Graur, Sorin Stati, Lucia Wald, red., Tratat de lingvistic general, Ed. Academiei, Bucureti, 1971, p. 199-202, 223-226. Valeria Guu Romalo, Morfologie structural a limbii romne, Ed. Academiei, Bucureti,1968. Emil Ionescu, Manual de lingvistic general , Ed. ALL, Bucureti, 1992, p. 148-150. Iorgu Iordan, Valeria Gu u Romalo, Alexandru Niculescu, Structura morfologic a limbii romne contemporane, Ed. tiinific, Bucureti, 1967, p. 44-54. John Lyons, Introducere n lingvistica teoretic, Ed. tiinific, Bucureti, 1995, p. 206-220. Solomon Marcus, Edmond Nicolau, Sorin Stati, Introducere n lingvistica matematic, Ed. tiinific, Bucureti, 1966, p. 24-44. Andr Martinet, Elemente de lingvistic general, Ed. tiinific, Bucureti, 1970, p. 34-35, 157-158. Marius Sala, Ioana Vintil-Rdulescu, Limbile lumii. Mic enciclopedie, Ed. tiinific i Enciclopedic, Bucureti, 1981. Emanuel Vasiliu, Introducere n teoria limbii, Ed. Academiei Romne, Bucureti, 1992, p. 27-38. A. Vraciu, Lingvistic general i comparat, Ed. Didactic i Pedagogic, Bucureti, 1980, p. 196-206. CHESTIONAR 1. Ce este morfemul? 2. Care sunt criteriile de clasificare a morfemelor? 3. Caracterizai morfemele din punctul de vedere al posibilitilor de combinare a acestora. 4. Raportul desinen-terminaie. 5. Segmentai n morfeme cuvintele: renscunaser, desfacere, rennoit i analizai morfemele obinute. 6. Ce este morfemul zero? Exemple. 7. Ce elemente extramorfologice cu rol de morfeme gramaticale cunoatei? Caracterizai, la alegere, unul dintre aceste elemente. 8. Ce sunt alomorfele? Exemple.

148

SINTAXA STUDIUL FUNCIILOR CUVINTELOR I PROPOZIIILOR

SINTAXA TRADIIONAL I CEA MODERN

Cuvntul este considerat unitatea de baz n gramatica tradiional. Termenul ca atare are accepii diferite, n funcie de palierul de analiz a limbii. Cuvintele sunt considerate uniti total abstracte la nivelul limbii, ale cror unice proprieti sunt acelea de a avea funcii combinatorii i de contrast. La nivelul vorbirii ele se realizeaz ca grupuri sau complexe de elemente ale expresiei (din punct de vedere fonologic). Pentru toi cei care accept cuvntul ca unitate fundamental a limbii (i ei formeaz cvasiunanimitatea lingvitilor) el este tratat sub aspectul flexiunii. Flexiunea (morfologia) se ocup de structura intern a cuvintelor. Flexiunea este corelat cu sintaxa, care i propune s explice modul n care cuvintele se combin pentru a forma propoziii. Noiunea de baz a sintaxei este propoziia. n accepia lingvisticii moderne, din gramatic fac parte numai flexiunea i sintaxa, i nu ntregul studiu al limbii, cum a fost considerat ea din cele mai vechi timpuri de ctre greci, cu deosebire, dar i de Pnini, n gramatica limbii sanscrite. Gramatica tradiional, numit i noional pornete de la ipoteza c exist categorii universale ale gramaticii prile de vorbire i categoriile gramaticale (timpul, modul, genul, numrul .a.), valabile pentru toate limbile. Termenul categorie este unul tradiional, consider John Lyons, folosit de lingviti pentru c teoria gramatical occidental (pe care o avem cu preponderen n vedere, deoarece ne referim la limbile indo-europene) s-a dezvoltat pe baza sistemului filosofic aristotelic. Din punct de vedere etimologic termenul categorie deriv dintr-un cuvnt grecesc care nseamn atribuire de proprieti obiectelor sau, altfel spus, predicaie. Clasificarea gramaticienilor s-a fcut n moduri de a predica (adic de a atribui proprieti obiectelor) i moduri de a exista. Datorit corespondenelor dintre modurile de a fi i de a semnifica este posibil cunoaterea lumii.
149

Gramaticienii din Europa, ocupndu-se de limbi indo-europene, i-au bazat analiza gramatical pe stabilirea modului n care cuvintele opereaz ca semne (instrumente pentru descrierea i nelegerea realitii), cu clasificarea lor ca pri de vorbire i cu stabilirea paradigmelor (modelelor) de declinare i conjugare. Deoarece orice obiect individual (denumit substan) este alctuit din materie i dintr-o form care l individualizeaz, i elementele limbii au fost considerate ca substane i au fost analizate avndu-se n vedere materia i forma lor. n calitate de substane, elementele limbii au fost grupate n clase (pri de vorbire), dup modul lor de a semnifica obiectele, proprietile i relaiile la care se refer. n cadrul substanei se disting accidentele forme diferite pe care le capt cuvntul potrivit funciei sale sintactice i modului specific de semnificare. Unele categorii accidentale sunt considerate tipice i definitorii pentru anumite pri de vorbire (de exemplu substantivele au forme flexionale pentru caz nominativ, acuzativ i numr singular, plural, aparin unui gen masculin, feminin; verbele au forme flexionare pentru timp, persoan, numr etc.). Deoarece categoriile gramaticale cuprindeau i categoriile accidentale, n unele limbi, de exemplu n englez, s-a perpetuat termenul accidence pentru a denumi morfologia. Metoda gramaticii tradiionale, considerat inductiv, pentru c descrierea pleac de la particular spre general, prezint inconvenientul de a utiliza concepte care au valoare numai n cadrul unui sistem lingvistic particular (o limb pe care o avem n vedere). Dup prerea lui L. Hjelmslev, ntreaga terminologie gramatical motenit, vehiculat nc n manualele de coal, sufer de aceast inadecvare la general, definirea categoriilor sale genitiv, dativ, subjonctiv, pasiv etc. nu poate fi aplicat tuturor limbilor. De exemplu, imperfectul (timp verbal) n limba francez se opune unei alte categorii perfectul simplu, n comparaie cu limbile german sau englez, n care aceast opoziie nu exist exist un singur timp pentru trecut, numit imperfectul. Unele limbi cunosc dou categorii ale numrului: singular i plural, n timp ce alte limbi au i un al treilea numr, dualul. Obiectivul principal al unei descrieri gramaticale este de a genera propoziii din care pot fi derivate enunuri actuale i poteniale ale limbii descrise. Noiunea de baz a gramaticii moderne este enunul. Acesta este definit drept orice poriune din vorbirea unei persoane, nainte de care i dup care urmeaz o pauz fcut de acea persoan. Pauza trebuie neleas n aceast definiie cu tolerana care
150

se acord n mod obinuit discursului netiinific curent. Trebuie s avem n vedere c ntre enunuri i propoziii gradul de coresponden este aleator. Enunul pur nu este n general identic cu propoziia (n accepiunea comun a acestui cuvnt), deoarece multe enunuri din limbi diferite constau din cuvinte izolate, grupuri de cuvintepropoziii incomplete etc.
MODELUL ANALITIC N SINTAXA MODERN (ANALIZA N CONSTITUENI IMEDIAI)

Analiza gramatical a unui corpus de enunuri (cu alte cuvinte recunoaterea n perspectiva flexiunii i a sintaxei) definete gramatica analitic tradiional, dar i sintaxa structural analitic (de tipul analizei n constitueni imediai). Sintaxa tradiional nu nseamn i nvechit, pentru c ea ofer nc posibiliti de dezvoltare. Sorin Stati difereniaz dou direcii de analiz: Prima direcie are n vedere faptul c propoziia este necesarmente bimembr, subiect predicat (sau grupul subiect grupul predicat); alii afirm existena mai multor pri de propoziie, n general patru, fiecare dintre ele avnd o structur simpl (un cuvnt) sau complex (mai multe cuvinte). O. Jespersen propune dubla clasificare a cuvintelor n pri de vorbire i clase (rank) sintactice (termeni primari, secundari i teriari), acetia corespund cu funciile de I. subiect i obiect; II. predicat i atribut; III. circumstanial. A dou direcie analitic a sintaxei tradiionale fragmenteaz enunul n pri de propoziie care se acoper aproape total cu prile de vorbire (nct se nate ntrebarea care este unitatea sintactic minimal cuvntul sau partea de propoziie) (Stati, Teorie i metod, p.69-70).
MODELUL SINTETIC (GRAMATICI GENERATIVE, CU PRIVIRE SPECIAL ASUPRA CELEI TRANSFORMAIONALE)

Orice corpus de enunuri atestate poate fi descris, n mod satisfctor, numai dac este considerat ca eantion al propoziiilor generate de gramatic. Toi lingvitii sunt de acord c nu exist opoziie ntre gramaticile descriptive i cele generative, altfel spus, gramatica este neutr fa de analiz i sintez. Aceasta nu nseamn c analiza ar fi pur i simplu reversul sintezei sau vice versa. Iar generare nu nseamn producere.
151

n tratarea modern a teoriei gramaticale, ca i a dezvoltrii teoriei sintactice generale, s-a adoptat cu predilecie o abordare pur formal. Einar Haugen a prezentat tendinele cele mai importante i metodele cele mai recente i mai matematizate, care au deplasat interesul lingvitilor de la cutarea identitii unitilor limbi spre distribuia lor, cu scopul de a identifica relaiile dintre unitile lingvistice. Mulimea tuturor contextelor n care apare o unitate lingvistic reprezint distribuia acesteia. Abordarea distribuional a analizei gramaticale presupune construirea unei mulimi de propoziii acceptabile, prin plasarea unor cuvinte diferite n acelai cadru. Fiecare limb poate fi descris n termenii unei mulimi de uniti foneme sau uniti fonologice sau pot fi specificate combinaiile acceptabile de cuvinte (propoziii). Cuvintele care se pot substitui unele cu altele n mai multe propoziii diferite sunt grupate n clase distribuionale. Teoria lingvistic avnd capacitatea de justificare a enunurilor reale ca membri ai clasei mai extinse a enunurilor poteniale este denumit generativ. O alt modalitatea de cunoatere se face prin intermediul modelului: se realizeaz (de ctre lingvist) o construcie formal sintactic numit model care ncearc s fac ceea ce face un locutor, adic s produc un numr infinit de propoziii. Emil Ionescu (p.171-172) a discutat, n ordine cronologic, diferite tipuri de sintaxe generative: 1) Automatele cu numr finit de stri. Metoda demonstreaz cum, cu un numr oarecare de simboluri i de reguli, se poate produce un numr mai mare de enunuri, dar e departe de a aproxima competena unui locutor. 2) Modelul generativ al constituenilor imediai (C.I.) aparine sintaxei de tip categorial. Aceast teorie formulat de Z.S. Harris, R.S. Wells, K.L. Pike, E.A. Nida n anii 50 (a crei denumire provine din tehnica segmentrii enunului din aproape n aproape) pornete de la noiunea de enun. Ea se bazeaz pe uniti care nu sunt predicat, subiect, atribut i complement (ca n sintaxa funcional), ci pe noiunile de sintagm (sau grup) i categorie; ea este o sintax categorial: i) un enun este segmentabil n cel puin o sintagm; ii) segmentarea se continu conform regulilor observate ntre constituenii sintagmei; iii) segmentarea nceteaz atunci cnd s-au obinut uniti minimale dotate cu sens. Modelul generativ obinut este mai puternic.
152

3) Sintaxa transformaional presupune un model care reprezint un stadiu mai avansat al generativismului. Emil Ionescu detaliaz mijloacele prin care ea rezolv probleme de ambiguitate a modelului C.I. (din constitueni imediai). Modelul transformaional conine, n plus, reguli denumite transformri (o transformare este o regul care opereaz n anumite condiii): se aplic dup ce au fost aplicate i alte reguli; se aplic numai pe anumite tipuri de structuri sintactice, iar efectul aplicrii trebuie s fie conservarea sensului. Tipurile de reguli de transformare (ap. Ionescu, p.179) sunt: coordonarea constituenilor, pasivizarea, pronominalizarea. Fiecare tip de transformare se aplic pe o anumit clas de structuri sintactice. De pild, pasivizarea nu se aplic pe structurile care permit pronominalizarea, iar pronominalizarea nu se aplic la construciile ce permit coordonarea constituenilor. Introducerea conceptului de transformare ntr-o gramatic generativ are consecine importante: 1) ntr-un enun se poate face distincia ntre structura sintactic de adncime (baza de aplicare a transformrii) i structura de suprafa (rezultatul obinut prin transformare). Aceasta ajut la elucidarea unor situaii ce par contradictorii: gramatica tradiional definete adverbul drept partea de vorbire ce determin un verb (sau un alt adverb), dar admite atribute adverbiale (adverbe care sunt determinani ai substantivului d. ex., ziua de ieri, biatul de acolo). Prin modelul transformaional, nelegem c contradicia poate fi explicat: construciile ziua de ieri, biatul de acolo sunt structuri rezultate din transformrile unor structuri de adncime (ziua care a fost ieri, biatul care se gsete acolo), unde adverbul a fost determinant al verbului. 2) O sintax transformaional are fa de un model C.I. o putere explicativ superioar (pune n relaie structuri sintactice ale unei limbi, de pild: activul i pasivul, construciile pronominalizate i nepronominalizate). Relaia este explicativ, deoarece una din construcii este structura de adncime a celeilalte. 3) O sintax transformaional se dovedete mai simpl dect una netransformaional (printr-un numr mai redus de reguli). 4) Un model transformaional conduce la interpretri diferite de cele ale gramaticii tradiionale, prin faptul c se apreciaz structura de suprafa ca rezultat din transformarea unei structuri de adncime i, astfel, se ajunge la o interpretare adevrat (Ionescu, 178-179).
153

BIBLIOGRAFIE Sorin Stati, Teorie i metod n sintax, Ed. Academiei, Bucureti, 1967. Sorin Stati, n Tratat de lingvistic general, sub redacia Al. Graur, Sorin Stati, Lucia Wald, Ed. Academiei, Bucureti, 1971, p. 70-71, 130-132, 134-141. Felicia Van-tef, Sintaxa, n Introducere n lingvistic, coord. Al. Graur, Ed. Academiei, Bucureti, 1972, p. 192-212. Emil Vasiliu, Gramatici generative i gramatici transforma ionale, n Crestomaie de lingvistic general, ed. I.Coteanu, Ed. Fundaiei Romnia de Mine, Bucureti, 1998, p. 169-179. Emil Ionescu, Manual de lingvistic general, Ed. All, Bucureti, 1992, p. 152-182. John Lyons, Introducere n lingvistica teoretic, Ed. tiinific, Bucureti, 1995, p. 197-206, 237-303, 375-449. CHESTIONAR I SUGESTII DE APLICAII 1. Care este metoda de baz a gramaticii tradiionale? 2. Dai definiia enunului. 3. Analizai n constitueni imediai enunurile: rom. Buturuga mic rstoarn carul mare; fr. Tu lis un roman gothique; sp. Volvern las oscuras golondrinas; engl. Every human being likes to be free. 4. Comentai raporturile dintre structura de suprafa i structura de adncime din enunurile: rom. Am deschis o carte Cartea a fost deschis de mine; engl. Shakespeare wrote The Tempest in 1612 The Tempest was written by Shakespeare in 1612. 5. Descoperii structura de adncime a enunului rom. El i ea se salut cordial. 6. Artai ce enunuri pot rezulta din transformarea urmtoarelor structuri de adncime: rom. (1) Tu ai cumprat cartea. Tu cutai cartea pe la toate librriile. (2) Ea a pierdut un creion. El a ntrebat de creion.

154

LEXEMATICA STUDIUL CUVNTULUI*

Lexematica este o disciplin tnr, ramur autonom a cercetrii semantice i form special a lexicologiei. Principiile ei au fost expuse n anii 1950-1960, cu deosebire de ctre Eugeniu Coeriu; n aceast expunere ne bazm integral pe studiile sale.
LEXEM (INVARIANT) I ALOLEXEME (VARIANTE)

Unitatea lexical minimal este numit lexem datorit ambiguitii termenului cuvnt. Cuvntul este o unitate semnificativ minimal a limbii. Cel de-al treilea sens mai abstract al su este cuvnt gramatical denumit lexem (celelalte realizri sunt: cuvnt fonologic i cuvnt ortografic). Aceast disciplin i-a propus stabilirea aspectelor paradigmatice i sintagmatice ale vocabularului din limbile funcionale.
TIPURI DE STRUCTURI LEXEMATICE

Structurile lexematice au fost clasificate astfel: A. structuri paradigmatice a) primare: cmpul lexical clasa lexical b) secundare: modificarea dezvoltarea compunerea B. structuri sintagmatice: afinitatea selecia implicaia A.a. Cmpul lexical i clasa lexical sunt structuri primare, n sensul c: definirea lor nu presupune alte structuri lexicale anterioare; ele pot fi stabilite n vocabular ca atare, fr s se raporteze la eventuala gramaticalizare a acestuia. Cmpul lexical este o structur paradigmatic care const din uniti lexicale (lexeme) care i mpart o zon de semnificaie comun i care se afl n opoziie nemijlocit unele cu altele.
*

Lexicografia va fi tratat ntr-un curs special. 155

De ex. verbele de deplasare formeaz un cmp lexical n multe limbi: n germ. gehen laufen rennen fliegen schwiemmen fahren etc.; n rom. a merge a alerga a fugi a zbura a nota a cltori (cu un vehicul) etc. sau adjectivele ce indic temperatura: germ. kalt khl lau warm heiss; rom. rece rcoros cldu cald fierbinte. Clasa lexical este o clas de lexeme care, independent de structurarea cmpului lexical, sunt legate de un clasem, adic de o trstur distinctiv comun, care funcioneaz ntr-o ntreag categorie gramatical (respectiv, n alt clas deja existent n cadrul unei categorii gramaticale). Clasele se evideniaz prin distribuie gramatical i/sau lexical, adic prin aceea c lexemele apar n combinaii analoge gramaticale i/sau lexicale. Astfel, de ex., n categoria substantivului: animat inanimat; uman non-uman; masculin feminin pot reprezenta clase, dac lexemele corespunztoare cer anumite combinaii specifice lor. Lexeme determinante i lexeme determinate clasematic pot fi deosebite din acest punct de vedere: Lexemele clasematic determinante sunt lexemele care cer anumite combinaii. Lexemele clasematic determinate sunt lexemele care nu apar dect n combinaii (explicite sau implicite) cu anumite clase, altfel spus ele sunt lexeme care conin o determinare de tipul: pentru clasa x, care se spune despre clasa x: essen a mnca (omul) Mund gur fressen a mnca (animalul) Maul bot determinate clasematic A.b. Modificarea, dezvoltarea i compunerea sunt structuri secundare, n sensul c presupun structurarea cmpului lexematic (sau a claselor lexematice) i corespund unei gramaticalizri a vocabularului: Modificarea Feluri (procedee) ale formrii (interne) Dezvoltarea a cuvintelor Compunerea Formarea cuvintelor prezint totdeauna determinri de natur gramatical. Modificarea corespunde unei determinri gramaticale neactuale, adic unei determinri care nu cuprinde o anumit funcie sintactic a lexemului determinat. O anumit funcie a lexemului determinat este: 1. derivarea diminutival 2. derivarea colectiv 3. prefixarea verbal
156

Lexemele formate prin modificare fac parte totdeauna din aceeai categorie gramatical cu lexemele modificate care le stau la baz. De exemplu: 1. germ. Pferd Pferdchen, rot rtlich, lachen lecheln, rom. cald-cldu, rou-roior; 2. germ. Tier Getier, Schrift Schriftum; rom. scris scriere; 3. germ. fahren abfahren, fallen hinfallen, rom. a schimba a preschimba, a scrie a rescrie. Dezvoltarea, n schimb, prezint o determinare gramatical: de ex. germ. Schnheit, Reichtum, Ankunft; rom. frumusee, bogie, sosire implic funcia predicativ a lexemelor Schn, reich, ankommen (frumos, bogat, a sosi) care stau la baz (pot fi chiar propoziii de tipul Maria ist schn, Hans kommt an, cci persoana, numrul, timpul i modul nu sunt indicate n aceast dezvoltare). Lexemele formate prin dezvoltare aparin totdeauna altei categorii gramaticale dect lexemele care stau la baza lor: germ. schn Schnheit, abfahren Abfahrt, reich bereichern Bereicherung, kreis einkreisen, Tisch auftischen, Art ausarten; rom. frumos frumusee, a pleca plecare, bogat a mbogi mbogire, cerc a ncercui. Compunerea implic asocierea a cel puin dou uniti ntre care exist o determinare gramatical. Compunerea poate fi: 1. prolexematic 2. lexematic. 1. Dac una din cele dou uniti este o unitate pronominal, adic un prolexem, atunci compunerea e prolexematic. De ex. germ.: unitate pronominal + lesen a citi Leser cititor. 2. Dac ambele uniti sunt lexeme, compunerea respectiv este lexematic. De ex. germ.: Korb co + Papier hrtie Papierkorb co de hrtie. Categoria gramatical a compuselor este totdeauna cea a lexemelor, respectiv a prolexemelor determinate. Diferite structuri secundare pot fi combinate ntre ele: modificare, germ. gehen a merge ausgehen a iei (n ora); dezvoltare, germ. gehen a merge Ausgang ieire; compunere: 1. prolexematic: germ. unitate pronominal + lehren a nva pe cineva Lehrer nvtor. 2. lexematic: Schule coal + Lehrer Schullehrer nvtor. B. Structurile lexematice sintagmatice (solidaritile lexicale) sunt combinri lexicale condiionate. Ele sunt de trei feluri: 1. afiniti 2. seleciuni 3. implicaii
157

avnd elementul condiionat al combinaiei un clasem, un arhilexem sau un lexem. Afinitatea este o combinaie condiionat de clasem, d. ex. ntre Lwe leu i fressen a mnca (numai despre animale) afinitatea este condiionat de clasemul lexemului Lwe (clasa animat). Selec iunea este combinaia condiionat n care elementul determinant este un arhilexem de ex. ntre Wagen car, main, vagon i fahren a merge cu un vehicul, condiionarea o face Fahrzeug vechiul de care ine lexemul Wagen. Implica ia este combinaia n care lexemul este condiionat de un alt lexem de ex. n expr. seit geraumer Zeit de mult vreme, geraumer e condiionat de lexemul Zeit, deoarece geraumer nu se poate folosi dect cu acest lexem. Cmpul lexical este o structur paradigmatic primar a lexicului. Definiia n aceast perspectiv este: paradigm constituit din uniti lexicale de coninut (lexeme), care i mpart o zon de semnificaie continu, comun i care se gsesc n opoziie imediat unele cu altele. Opoziia imediat se poate stabili: (a) ntre o arhiunitate (arhilexem) exprimat sau nu i o unitate sau (b) ntre arhiuniti. Cu alte cuvinte, un cmp poate fi inclus n alt cmp; el poate forma o parte dintr-un alt cmp, de ordin superior. ntr-un microcmp opoziiile se stabilesc ntre unitile lexicale (lexeme); ntr-un macrocmp opoziiile se stabilesc ntre un microcmp n totalitatea lui, care se opune ca arhilexem unui alt lexem sau altor microcmpuri (arhilexeme). Ca paradigme, cmpurile lexicale sunt, n principiu, analoge: a. micro sistemelor fonologice / macro sistemelor fonologice vocale anterioare- vocale / consoane labiale - consoane; b. micro sistemelor gramaticale / macro sistemelor gramaticale. Un cmp lexical corespunde unui sistem categorial, adic unei categorii a gramaticii (numr, gen, mod; timp, aspect) i opoziiile interne ale unui cmp lexical corespund opoziiilor care exist n interiorul unei categorii gramaticale. n timp ce a) paradigmele gramaticii sunt incluse sau limitate (n oricare limb, singular-plural pentru numr, masculin-feminin neutru pentru gen; b) paradigmele lexicale sunt deschise sau nelimitate, dar aceast difereniere este valabil numai dac ele se constituie din punctul de vedere al gramaticii, al sintaxei sau sunt sintagmatice, i atunci ele trebuie privite ca serii lexicale.
158

Pentru c, de fapt, paradigmele lexicale sunt la fel de delimitate ca i cele gramaticale. Dac pe axul paradigmatic lexemele constituie serii nelimitate, deschise pentru funcia de subiect sau complement direct, n acest caz alegerea din lexic este pentru funcii gramaticale. Alegerea propriu-zis lexical cel puin n ceea ce privete lexicul structurat are loc n cadrul unei paradigme limitate i delimitabile (ca i cele ale gramaticii) (a). De exemplu, pentru a desemna temperatura printr-un adjectiv alegerea se face ntre: n lb. fr. froid frais tide chaud; n germ. kalt khl lau warm heise; n rom. rece rcoros cald fierbinte (ca termeni fundamentali). Cmpurile lexicale n cadrul unei semantici structurale pot fi identificate, delimitate i descrise. Sarcinile unei tipologii sunt tocmai s determine ntr-un mod sistematic: a. diversitatea de structurare b. stabilirea tipurilor de clase. U. Weisgerber a schiat dou feluri de cmpuri: A. cu un singur strat a. cu organizare liber b. cu organizare plan c. cu organizare stereometric. B. cu mai multe straturi. Teoria sa, ca i cea lui J.Trier nu privete structurile lexematice n perspectiva lansat de Coeriu, dar acestea pot fi reinterpretate n termeni structurali i integrate unei semantici structurale.
TIPOLOGIA CMPURILOR LEXICALE

O tipologie a cmpurilor lexicale se bazeaz pe clasificarea opoziiilor lexematice. Opoziiile (ca i n fonologie) sunt: a. graduale fr. tide chaud, frais frois; rom. cldu cald, rcoros rece. b. echipolente fr. rouge vert jaune; rom. rou verde galben. c. privative fr. dominer matriser; rom. a domina a stpni; lat. albus candidus. Tipul acesta formal (este formal pentru c se arat subordonat numrului de criterii semantice sau de dimensiuni care funcioneaz n cmpuri) nu este suficient n sine pentru c:
159

1. tipuri formale diferite pot s funcioneze n acelai cmp; ele pot caracteriza seciuni de cmpuri sau microcmpuri, dar nu cmpuri ntregi sau macrocmpuri; 2. cnd caracterizeaz cmpuri ntregi, ele disting subcmpuri, dar nu tipurile principale care nglobeaz aceste subcmpuri. E. Coeriu a adugat acestui tip formal i alte criterii: 1. Numrul dimensiunilor manifestate de opoziiile unui cmp. 2. Felul n care dimensiunile se combin n teritoriul cmpului. 3. Tipul ontic al realitii obiective i al opoziiilor lexematice. 4. Tipul raportului ntre coninut i expresia lexemelor.
CLASIFICAREA CMPURILOR LEXICALE

Pe baza acestor criterii i combinndu-le, cmpurile lexicale se claseaz: 1. dup configuraia lor; 2. dup sensul lor obiectiv; 3. dup exprimarea lor. Configuraia depinde de: a. numrul de dimensiuni semantice; b. tipurile formale de opoziii n legtur cu aceste dimensiuni semantice; c. felul n care lexemele se combin n interiorul acestor paradigme. Dimensiune, termen introdus de F. Lounsbury, este punctul de vedere sau criteriul unei opoziii oarecare, adic, n cazul unei opoziii lexematice: proprietatea semantic vizat de aceast opoziie. De ex. n cmpul adjectivelor relative la temperatur, dimensiunea semantic va fi: grad relativ de temperatur, constatat prin simul termic. Dimensiunii semantice i se mai spune i criteriu semantic sau categorie lexical. Termenul dimensiune este comod pentru lingviti pentru c permite formarea compuselor: unidimensional pluridimensional Termenul categorie lexical este folosit numai pentru cmpuri ntregi (macrocmpuri): termeni pentru culori, rudenie, fiine, instrumente; verbe de micare etc. Cmpuri din punctul de vedere al numrului de dimensiuni: A. unidimensionale (simple, lineare) B. pluridimensionale (complexe).
160

A. Cmpuri unidimensionale: a. antonimice, prin adugare de distincii devin pluridimensionale, iar termenii primari devin arhilexeme. Cmpurile antonimice, din punctul de vedere al ordonrii lexemelor n cmpuri lexicale, nu prezint diferene eseniale ntre opoziiile antonimice i sinonimice, ambele sunt subclase ale clasei de opoziii polare. b. graduale, opoziii graduale n interiorul arhilexemului, se aranjeaz lexemele. c. seriale, opoziii multilaterale, echipolente, de ex., numele zilelor sptmnii, nume de psri, de peti etc. Cmpurile unidimensionale seriale sunt, la rndul lor, ordinale (opoziia de natur relaional), serii nchise, lexemele sunt n ordine fix, de ex. numele zilelor sptmnii n orice limb. non-ordinale (opoziie de natur substantival), serii neordonate, deschise, se pot aduga la infinit lexeme noi, de ex. nume de psri, de arbori, n orice limb. Cmpurile seriale constituie totdeauna terminologii: nu sunt structurate lingvistic dect la nivelul arhilexemelor. B. Cmpuri pluridimensionale: a. bidimensionale - corelative, cele dou dimensiuni se ncrucieaz, formeaz fascicule de corelaii: b//p/f; t/d//th/dh. combinare a dou opoziii polare (antonimic i/sau sinonimic)
easy light ngust strmt difficult heavy lat larg

- non-corelative, de tip: vocal / consoan; nume de culori, psri, etc. b. multidimensionale. cmpuri antonimice + distincii (cf. Aa)
BIBLIOGRAFIE Eugeniu Coeriu, Ctre o tipologie a cmpurilor lexicale (Vers une tipologie des champs lexicaux, Cahiers de lexicologie XXVII, 1975, 30-51), n Lingvistica modern n texte, red. resp. Maria Iliescu i Lucia Wald, 161

[Univ. din] Bucureti, 1981. Idem, Studiul funcional al vocabularului. Lexematica (Die funktionelle Betrachtung des Wortschatzes, in Sprache des Gegenwart, Dsseldorf, 1976, 7-25), n vol. cit., 39-77. Idem, Structurile lexematice (Les structures lexematiques, Zeitschrift fr franzsische Sprache und Literatur, Wiesbaden, 1968, 3-16), n Revista de lingvistic i tiin literar, Chiinu, nr.6, 1992, 41-53. John Lyons, Introducere n lingvistica teoretic, Ed. tiinific, Bucureti, 1995, 221-230. CHESTIONAR I SUGESTII DE APLICAII 1. Ce este lexematica? 2. Definii lexemul i raportul lui cu cuvntul. 3. Care sunt tipurile de structuri lexematice? 4. Enunai caracteristicile cmpului lexical i ale clasei lexicale. 5. Ce schimbri antreneaz structurile secundare paradigmatice? 6. Care sunt categoriile de compuneri lexematice? 7. Analizai lexemele germ. das Wrterbuch, die Uhrzeiger, fr. fluviatile, fluorhydrique, engl. shopman, knighthood. 8. Care este elementul condiionat al structurilor lexematice sintagmatice? 9. Ce nseamn lexem determinant i lexem determinat? 10. Pe ce se bazeaz tipologia cmpurilor lexicale? 11. Care sunt criteriile de clasificare a cmpurilor lexicale? 12. Dai exemplu de cmp unidimensional serial non-ordinal.

162

SEMANTICA STUDIUL SENSULUI

NOIUNI INTRODUCTIVE. CONCEPTUL DE SENS

nc din antichitate s-au semnalat preocupri de semantic: studii pe marginea tropilor, a sinonimelor, a omonimelor. Semantica tiinific s-a constituit, ns, ca ramur lingvistic de sine stttoare abia la sfritul secolului trecut. Printe al ei este considerat lingvistul francez Michel Bral, autor al lucrrii Essai de smantique. Science des significations, aprut la Paris, n 1897. Cu zece ani naintea lui Bral, Lazr ineanu publica la Bucureti lucrarea ncercare asupra semasiologiei limbei romne. Studii istorice despre tranziiunea sensurilor, lucrare care nu a fost cunoscut, probabil, de Bral, nici de majoritatea cercettorilor strini de atunci. Obiectul de studiu al semanticii (sau semasiologiei) este sensul cuvintelor. ntlnit uneori sub numele de neles, semnificaie, valoare, funcie, accepie .a., sensul a acumulat, n timp, definiii a cror varietate e fr doar i poate descurajant afirm Sorin Stati, care realizeaz o trecere n revist a celor mai reprezentative ncercri de caracterizare a termenului (Stati, p.7-10). O vom reine, dintre toate aceste definiii, pe cea care vede n sens nsuirea obiectelor reflectat n mintea noastr (Hristea, coord., p.14). Nu de puine ori sensul este considerat a fi identic cu noiunea, pornindu-se de la natura generalizatoare a celui dinti i apropiindu-l de caracterul sintetizant al celei de-a doua. Dei sensul i noiunea coincid la mai toate cuvintele formnd o semnificaie unitar, fenomenul nu este general-valabil (T.L.G., p.27). O perfect identitate sens-noiune se ntlnete la termenii tiinifici i tehnici: elipsoid, xenon, tungsten, naftol, galvanocauter, pereu, antimoniu, fonem, colodiu etc. Toate cuvintele au sens; nu toate exprim ns i denumesc noiuni. Fac acest lucru substantivele, adjectivele, pronumele, numeralele, verbele cu sens lexical i adverbele. Interjeciile exprim dar nu denumesc emoii, sentimente, imit zgomote sau strigte. Alte cuvinte (prepoziiile i conjunciile, articolele, verbele auxiliare) exprim raporturi ntre noiuni i marcheaz diferite raporturi gramaticale
163

ntre cuvinte. Unele dintre ele cumuleaz numeroase valori, care se precizeaz numai n context: pe mas (spaial), pe sear (temporal), pe furi (modal), pe Ioana (obiect direct). Noiunile, pe de alt parte, pot fi exprimate nu numai printr-un singur cuvnt, ci i prin mbinri de cuvinte: schimbtor de vitez, plac fotografic, energie cinetic. Dac noiunile exprim nsuirile cele mai generale, eseniale i necesare, preponderent obiective, colective ale obiectelor i fenomenelor, sensul se poate referi i la trsturi particulare fiind marcat, uneori, de factori de natur individual, subiectivi sau aparintori unei colectiviti limitate. Noiunea este mai rece, mai impersonal, mai precis, mai puin cuprinztoare, n timp ce sensul i poate lrgi coninutul prin nuanele personale, afective pe care, uneori, le aduce. Aadar, de multe ori nelesul cuvintelor nu exprim noiuni ca atare, el subliniaz anumite laturi ale noiunii, la care adaug nuane afective care depesc cadrul logic propriu-zis (T.L.G., p.271). n literatura de specialitate se vorbete despre un sens denotativ (noional, conceptual) al cuvntului, care are valoare obiectiv i exist independent de intenia vorbitorului, despre un sens conotativ, reprezentat de valoarea suplimentar sugestiv, afectiv, atmosfera etc. care nsoete un anumit cuvnt (un termen cum este cafelu, de pild, se refer nu neaprat la o cantitate mic de cafea, ci poart n el asemenea valori) i despre un sens referenial, care este dat de raportarea cuvntului la realitatea concret, la desemnat. La un numr mare de cuvinte el trezete n plus imaginea concret a obiectului la care se refer. Aici generalul se exprim direct prin individual (T.L.G., p.277). Unele cuvinte puine la numr sunt monosemantice. Au un singur sens, n general, termenii tehnici i cei tiinifici: cuant, perigon, oxidril, diedru, plesiozaur, taliu, ignitron. Majoritatea cuvintelor sunt ns polisemantice (au dou sau mai multe sensuri). Sensurile cuvintelor polisemantice sunt legate ntre ele, fapt simit nu numai de ctre lingviti, ci i de ctre simplii vorbitori. Astfel, un cuvnt cum este, de pild, colone poate avea urmtoarele sensuri: 1) cetate sau ora ntemeiat de vechii fenicieni sau greci pe teritorii strine; 2) regiune sau ar aflat sub dominaia unei puteri strine; 3) grup de oameni de aceeai naionalitate, aezai ntr-o alt ar sau n ora strin; 4) grup de copii aflai ntr-o staiune; 5) grup de animale din aceeai specie care triesc n comun. Arcada desemneaz att un element arhitectural format dintr-un arc i elementele care l susin, ct i o formaie anatomic n form de arc (arcada ochiului). n
164

structura unui cuvnt polisemantic exist un sens ctre care converg toate celelalte, pe baza unei asemnri oarecare a nsuirilor pe care le nsumeaz (Diaconescu, p.140). Cuvintele pot avea sensuri diferite de la un domeniu de activitate la altul: perioad, de exemplu, are un sens n domeniul fizicii, altul n cel al muzicii, altul n geologie; termenii sincop, acord, predicat au un sens pentru lingvist i un altul pentru muzician (primele dou), jurist (cel de-al doilea) sau logician (al treilea).
NOIUNI DE SEMANTIC ISTORIC (DIACRONIC)

Termenul de semantic se suprapune, pn prin anii 50, cu cel de semantic istoric. Obiectul ei de studiu l reprezint schimbrile de sens ale cuvintelor de-a lungul existenei lor. Lazr ineanu, Michel Bral, Antoine Meillet, A. Darmesteter, St. Ullmann sunt nume de referin ale domeniului, care au cutat s explice factorii i mecanismele ce stau la baza mutaiilor de sens, direciile dup care sensul se modific.
CAUZELE SCHIMBRILOR DE SENS CAUZE EXTRALINGVISTICE

Cuvintele i pot schimba sensul odat cu schimbarea realitii pe care o denumesc. n vechime se scria cu pan de gsc, termenul actual peni nefiind altceva dect diminutivul cuvntului pan. Printr-un transfer de sens termenul a trecut asupra obiectului metalic montat la un toc i utilizat pentru a scrie cu cerneal. Termenul francez galrien i desemna, cu secole n urm, pe criminalii trimii s vsleasc pe galerele regelui. Cu toate c s-a renunat, cu timpul, la aceast pedeaps, criminalii fiind trimii n temnie aflate pe uscat, termenul a continuat s existe pentru a-i denumi pe cei condamnai. O dat cu evoluia gndirii se poate schimba i sensul unor cuvinte. Dei atomul se tie c nu mai reprezint componenta cea mai mic a materiei (gr. a-tomos indivizibil), cuvntul s-a pstrat. Cauze extralingvistice stau la baza schimbrilor de sens la trecerea cuvintelor dintr-un mediu social n altul. Astfel, cuvntul latinesc iecur (ficat) a disprut din toate limbile romanice, locul lui fiind luat de un cuvnt utilizat n limbajul buctarilor i format dup un model grec: ficatum (ficat) umplut cu smochine. Denumirea unui fel de mncare a devenit, prin trecere n limba comun, nume al unui
165

organ. A. Meillet nota c verbul quiper la origini era un termen marinresc i nsemna a echipa o nav cu ceea ce e necesar, i, ntruct n limbajul tehnic ideea de nav se subnelegea, nsemna a nzestra cu ceea ce e necesar. Anticiparea fcut de cunoscutul lingvist francez n urm cu circa 100 de ani, conform creia dac va trece n limba comun cuvntul nu va mai pstra dect ultimul sens, s-a adeverit. Tot la cauze extralingvistice semnalm interdiciile de vocabular. Unele cuvinte sunt nlocuite cu altele mai puin periculoase, mai blnde, mai decente. Numele unui mamifer carnivor, nevstuica, obiect de team superstiioas i de interdicii corespunztoare de tabu (Antologie de semantic, St.Ullmann, p.142), are nume dintre cele mai alese: fr. belette frumuica, it. donnola i port. doninha domni, sued. lilla snlla feti drgu, jungfru domnioar, v. engl. fairy zn, dan. kjonne frumoasa, bruden mireasa, bavar. Schntierlein, Schndinglein animlu drgu.
CAUZE LINGVISTICE

La cuvintele care pierd legtura cu familia din care provin se constat schimbri de sens care nu s-ar realiza dac etimologia s-ar mai simi. Cuvntul virtus virtute, derivat de la vir brbat, avea sensul brbie, curaj, fel de a fi al brbatului. Cum vir n-a fost motenit n limba romn, virtute nseamn acum atitudine moral exemplar, fr a se mai referi la ideea de brbat. n limba francez particulele ntrebuinate pentru exprimarea negaiei point, pas sunt, la origine, substantive (punct, pas), iar reflexivul on provine din substantivul homme (om). Cuvntul Mann din german (om) se folosete, i el, n construcii impersonale. Unele schimbri de sens se datoreaz contextului. Datorit desei ntrebuinri n anumite mbinri, unele cuvinte preiau sensul cuvntului alturat. Astfel, fr. fromage brnz e motenit din lat. caseus formaticus brnz pus n form; pche piersic provine din lat. malum persicum mr din Persia; substantivul romnesc roie este i el, la origine, un atribut provenit din sintagma ptlgea roie. Sensul sintagmelor a fost, deci, preluat numai de epitete. O alt cauz a schimbrilor de sens este aceea a apropierii formale dintre cuvinte: fortuit, de pild, care nseamn, de fapt, ntmpltor, pus n legtur cu forat, este utilizat uneori cu sensul fcut sau impus cu fora, prin constrngere; mutual care se face n mod reciproc i simultan este raportat greit la cuvntul mut i se folosete cu sensul de pe tcute.
166

CILE DE REALIZARE A SCHIMBRILOR DE SENS

Aceste ci sunt variate i corespund, n general, figurilor de stil. Des ntlnit este metafora, o comparaie subneleas sau prescurtat, n virtutea creia cuvntul-imagine nlocuiete cuvntulobiect. Numeroase metafore au intrat n limbajul cotidian: poalele muntelui, gura vii, piciorul patului, gura tunului, buza paharului, aripa podului, i rareori mai sunt recunoscute ca figuri de stil. Nu puine sunt denumiri de plante: gura-leului, sngele-voinicului, piciorul-caprei, laba-gtei, cinci-degete, talpa-ursului, ochiul-boului, limba-soacrei, limba-petelui etc. Metonimia marcheaz nlocuirea efectului cu cauza, a cauzei cu efectul, a coninutului cu conintorul, a operei cu autorul, a autorului cu opera .a.: a bea toat sticla (tot paharul), a avea condei, a cumpra un Pallady, clasa se foia, a ciocni un Murfatlar. Sinecdoca este o figur de stil prin intermediul creia genul se substituie, uneori, prin specie, ntregul prin parte, pluralul prin singular: acoperi n loc de cas, pnz n loc de corabie, americanul n loc de americanii. Hiperbola marcheaz o exagerare, prin mrirea sau micorarea obiectului. Este des ntlnit n vorbirea curent n construcii de tipul: a fugi mncnd pmntul, cu inima ct un purice, a arde de nerbdare, mai iute ca vntul i ca gndul, mort de spaim.
DIRECII DE DEPLASARE A SENSULUI

Uneori se constat o lrgire a sensului cuvintelor: cuvntul cerneal, care, n vechime, desemna numai cerneala neagr, este, actualmente, nume al unei substane ce servete la scris, la tiprit i poate avea diferite culori; lat. passer vrabie a devenit, n romn, pasre (termen general), iar n spaniol pjaro (sp. vrabie = gorrin); rus. kanikuly vacan numea, iniial, un interval de timp (22 iulie 23 august) cnd soarele se afla n Constelaia Cinelui (lat. canicula Constelaia Cinelui). Aceast perioad coincidea cu vacana de var. Cu timpul, termenul a ajuns s denumeasc orice vacan, pierzndu-i legtura cu numele constelaiei. Alteori s-a produs fenomenul invers, de restrngere a sensului: lat. linteolum bucat de pnz de in i-a restrns, n romn, sensul: linoliu = giulgiu; n urm cu cteva sute de ani termenul varz denumea plantele verzi, verdeaa, n general, iar acum este numele unei plante legumicole folosite n alimentaie; lat. tempestas nsemna starea
167

vremii (timp frumos sau timp urt); n cteva limbi romanice termenul i-a restrns sensul, meninndu-l numai pe cel de-al doilea: fr. tempte, sp. tempestad, ital. tempesta - vreme rea, furtun. Sensul cuvintelor a evoluat de la abstract ctre concret: lat. anima suflet, via, a devenit, n romn, inim; lat. conventus adunare a dat, n francez, couvent mnstire. Nu lipsete nici fenomenul invers, de trecere de la concret la abstract: germ. der Raum spaiu avea, iniial, un sens concret: teren liber, ce urmeaz s fie cultivat; lat. pensare a cntri, care avea iniial numai sensul de a determina masa unui corp cu cntarul sau balana, a dat, n francez, verbul penser a gndi. Din lat. pensum greutate cntrit, a evoluat romnescul ps suprare, necaz, greutate sufleteasc. Unele cuvinte i-au nnobilat, n timp, sensul: lat. minister servitor st, n mai multe limbi moderne, la originea termenului ce desemneaz un membru al guvernului care conduce un minister; v. germ. marahskalk slug la grajd, biat la cai a devenit, n francez, marchal mareal. Dimpotriv, alte cuvinte au cptat un sens peiorativ: sl. prost simplu e la baza cuvntului romnesc prost lipsit de inteligen; nerod, stupid; din franuzescul parler a vorbi provine, n spaniol, verbul parlar a trncni, a plvrgi.
NOIUNI DE SEMANTIC SINCRONIC

Alturi de semantica istoric exist i o semantic sincronic (static sau descriptiv) care analizeaz, sistematizeaz i clasific sensurile cuvintelor, aa cum acestea exist la un moment dat n contiina celor ce le folosesc n vorbire (Hristea, coord., 14). Ea s-a dezvoltat dup anii 50 ai secolului al XX-lea i e departe de a fi un domeniu unitar, n rndul ei existnd mai multe curente, dintre care cel mai important este semantica structural, bazat pe analiza semic sau pe teoria cmpurilor semantice.
ANALIZA SEMIC

Sensul unui cuvnt numit i semem poate fi descompus i analizat n uniti semantice elementare numite seme, la fel cum fonemul fascicul de trsturi distinctive este analizat n aceste trsturi. Fonemele f i v, de pild, prezint urmtoarele caracteristici:
168

/f/ - nesonant - constrictiv (fricativ) - labiodental - surd

/v/ - nesonant - constrictiv (fricativ) - labiodental - sonor

Trei dintre aceste trsturi sunt deci comune, iar una este difereniatoare. n mod analog procedeaz semanticienii adepi ai analizei semice. S lum, de pild, dou cuvinte nrudite: canotaj i caiac, denumiri ale unor sporturi nautice. Primul se practic, ns, n ambarcaiuni puse n micare cu ajutorul vslelor sau ramelor, iar cel de-al doilea n ambarcaiuni conduse cu ajutorul unei padele. Cele dou sememe pot fi descompuse, deci, n urmtoarele trsturi distinctive:
canotaj- sport caiac- sport - nautic - nautic - practicat cu o ambarcaiune - practicat cu o ambarcaiune - vasul este condus cu vsle - vasul este condus cu o padel sau rame

Sensul unui cuvnt este, prin urmare, un fascicul de seme, distinct de alte fascicule. Semele obinute printr-o asemenea descompunere se pot ntlni i n structura sensului altor cuvinte: primele trei, de pild, sunt proprii i cuvntului canoe (n cazul creia ambarcaiunea este condus cu ajutorul unei pagaie). O alt trstur distinctiv ce difereniaz caiacul de canoe este faptul c ambarcaiunea este prevzut, n cazul caiacului, cu crm, iar canoea este fr crm. Referindu-se la obiectele care servesc pentru aezat, B. Pottier identific urmtoarele trsturi distinctive ale acestora: 1) pe care te aezi, 2) care are picioare, 3) pentru o singur persoan, 4) cu sptar, 5) cu brae, 6) din material rigid, i realizeaz urmtoarea schem: scaun fotoliu taburet canapea s1 + + + + s2 + + + + s3 + + + s4 + + + s5 + + s6 + + -

O combinaie de seme formeaz un semem: s1 + s2 + s3 + s4 + s6 = sememul scaun. Trstura distinctiv 4) deosebete scaunul de taburet, s5 i s6 difereniaz scaunul de fotoliu .a.m.d. Fiind n posesia unui inventar general de seme, semanticianul nu mai trebuie s nregistreze i s descrie sensul fiecrui cuvnt n parte,
169

ci s precizeze doar care sunt acele combinaii de seme care l difereniaz de sensul altor cuvinte.
TEORIA CMPURILOR SEMANTICE

Cuvintele care pot fi descrise, grupate pe baza unui numr de seme comune alctuiesc un cmp semantic: ex.: gradele de rudenie sau gradele militare, denumirile culorilor, numele de pomi fructiferi, de animale slbatice etc. Bazele teoriei cmpurilor semantice au fost puse de ctre Jost Trier. Vocabularul nu este, n opinia semanticianului german, o mas de cuvinte, ci un ansamblu de cmpuri lexicale nelese ca ansambluri de relaii ntre cuvinte care au semnificaie n virtutea acestor relaii. O relaie exist, deci, numai n cadrul unui cmp. Fiecare cmp semantic formeaz, mpreun cu altele, un cmp mai ntins i aa mai departe pn se ajunge la lexicul limbii, cmpul semantic cel mai vast. Acesta are aspectul unui mozaic, fr goluri sau suprapuneri (Stati, p.21). Fiecare cmp este un cmp lexical a ceva. Lui i corespunde un segment din realitatea extern: fenomenele meteorologice, culorile, formele de relief. Acest segment poart, la Trier, numele de arie conceptual. Dou limbi (sau mai multe) pot s aib n comun aceeai arie: rudenia, prile corpului omenesc, ns ea poate fi exprimat diferit n limbi diferite. Cuvintelor grandson i nephew din englez le corespunde, n romn, cuvntul nepot. Aria lor comun este structurat diferit n cele dou limbi: primul echivaleaz, n romn, cu nepot de bunic, iar cel de-al doilea cu nepot de frate sau sor. Diferenele dintre termenii din englez se redau n romn numai contextual, un enun ca Ne-a venit nepotul, ambiguu n romn, necesitnd, cnd e cazul, precizarea biatul fiului (fiicei) sau biatul fratelui (surorii). Unui cmp lexical i se poate asocia, deci, nu doar o arie, ci i un mod de structurare a ei. Modul n care e structurat aria este, n terminologia semanticianului german, un cmp conceptual. Acesta reprezint totalitatea sensurilor pe care le au unitile ce alctuiesc un cmp lexical (Ionescu, p.39). La un nivel superior cmpului semantic se vorbete despre clase sau categorii lexicale, caracterizate printr-o trstur general de tipul animat-inanimat, uman-nonuman .a. Asemenea clase, alctuite din semne ce indic trsturi generice poart numele de claseme. Teoriei cmpurilor semantice i se aduc obiecii de natur practic: n nici o limb nu se poate realiza o descriere complet a vocabularului doar pe baza ei, puine fiind sectoarele care permit evidenierea unei
170

organizri clare, limpezi. Descrierea vocabularului ca o clas mare de lexeme format prin combinarea unui numr mic de seme, rmne numai o ipotez.
CLASIFICAREA CUVINTELOR DIN PUNCTUL DE VEDERE AL RAPORTULUI SENS-FORM

Cuvintele cu acelai nveli sonor, dar sensuri diferite, poart numele de omonime: cf. rom: calcan1 pete marin, cu corp rombic, turtit, asimetric i calcan2 zid exterior din spatele unei cldiri, crciumreas1 femeie care are n proprietate o crcium; nevast de crciumar i crciumreas2 - plant ornamental; fr. ou1 sau i o unde, son1 al su, son2 sunet i son3 tre; rus. luk1 arc i luk2 ceap, lavka1 banc, lavi i lavka2 prvlie, dughean; engl. plate1 plac, plate2 farfurie, plate3 argintrie, duck1 ra, duck2 persoan ncnttoare, duck3 pnz de doc .a. Omonimele provin, de cele mai multe ori, din limbi diferite: rom. orar1 < fr.,lat. privitor la ore, care arat orele sau program al unei activiti mprit pe ore i repetat periodic i orar2 < sl., lat. vemnt bisericesc, lac1 < lat. ntindere de ap i lac2 < germ. preparat lichid; rus. bor1, cuvnt rusesc pdure de conifere, bor2 < fr. bor, element chimic, bor3 < germ. frez (la bormain). n romn se nregistreaz dou omonime cu aceeai provenien francez: bor1 bor, element chimic i bor2 marginea rsfrnt n afar a unei plrii. Cele mai numeroase omonime sunt cele lexicale (propriu-zise), care grupeaz cuvinte ce aparin aceleiai clase lexico-gramaticale: liliac1 arbust decorativ cu flori frumos mirositoare i liliac2 mamifer insectivor, a semna1 a nsmna i a semna2 a se asemna, a se asemui. Omonimia poate fi total, cnd cuvintele omonime au aceeai form n ntreaga lor paradigm: banc1 scaun lung i ngust i banc2 instituie financiar sau parial, cnd cuvintele nu coincid n toate formele paradigmatice: mas1 mobil pl. mese, dar mas2 mulime pl. mase; difuzor1 aparat pl. difuzoare i difuzor2 persoan care difuzeaz (pres, periodice) pl. difuzori. Omonimele gramaticale (morfologice) sunt reprezentate de identitatea unor forme gramaticale ale aceluiai cuvnt: forme de imperfect, singular i plural mergeam (eu i noi), forme de prezent, singular i plural cnt (el i ei), aleg (eu i ei).
171

O alt grup de omonime o formeaz cele lexico-gramaticale: cuvinte care aparin unor pri de vorbire diferite i care prezint unele forme identice: cer substantiv i verb, duce substantiv i verb, poart substantiv i verb, lin substantiv i adjectiv, vie substantiv i adjectiv. Asemenea omonime se mai numesc i omoforme. Omografele sunt cuvinte a cror form coincide numai n scris, dar care se pronun n alt fel i au sensuri diferite: rom. hin i han, chi i och, rin i arn; engl. lead [led] plumb, grafit, min de creion i lead [li:d] conducere, indicaie, les .a.; rus. zmok castel i zamk lact, ncuietoare. Omofonele sunt cuvinte cu grafie i sensuri diferite, dar care se pronun la fel: engl. dear drag i deer cerb; fr. verre sticl, vers ctre, ver vierme, vert verde. Considerate un fenomen negativ (J. Gilliron), care ar crea ambiguiti n limb, omonimele nu ngreuneaz comunicarea, contextul n care sunt ntlnite nlturnd eventualele confuzii. Ambiguitatea lor este valorificat n calambururi, jocuri de cuvinte: Maic-ta, de-i vie/Spune-i ca s vie/Pnla noi la vie. Limita dintre cuvintele omonime i cele polisemantice nu e totdeauna uor de stabilit, mai ales n cazul n care ele sunt rezultatul ndeprtrii unor sensuri mai mult sau mai puin apropiate la origine. Mas1 mulime, mas2 corp solid i mas3 mobil sunt cuvinte omonime. La ultimul (mas mobil) se specific n dicionar i sensul de mncare, dei diferena semantic dintre ele e foarte mare, dat fiind c fiecare face parte din serii de nelesuri destul de deosebite (T.L.G., p.267). ntr-un studiu consacrat omonimiei i polisemiei Paula Diaconescu vorbete despre criteriul ruperii lanului semantic dintre cuvinte: dac lipsete o verig de legtur, suntem n prezena unui fenomen de omonimie, iar dac sensul fundamental este ntlnit n cele secundare fie i printr-o singur caracteristic ne aflm pe terenul polisemiei. Omonime sigure sunt cele ce provin din limbi diferite: toc1(<bg.) la nclminte, toc2 (<magh., scr.) cutie mic, n care se pstreaz anumite obiecte de uz personal, instrumente, ustensil pentru scris sau desenat, pies de cherestea, toc3 (<*lat.) indicativul prezent, persoana I singular de la verbul a toca, toc4 onomatopee ce imit zgomotul produs de o ciocnitur, de o lovitur ntr-un material dur. Scindarea legturilor semantice, n cazul polisemiei trecute n omonimie, reflect, de fapt, i ea, pierderea legturii dintre laturile unei noiuni, care pot deveni noiuni diferite. Raportul dintre noiune i sens (cuvnt, n sens larg) nu este univoc: noiune sens, ci i sens
172

noiune, ceea ce confirm teza despre funcia formativ a limbii (de formare a gndirii) (Vraciu, p.99). Paronime sunt cuvintele foarte asemntoare ca form, ns deosebite ca sens: cf. rom. a emigra a pleca din patrie i a se stabili n alt ar i a imigra a veni ntr-o ar pentru a se stabili aici, inoperabil care nu poate fi operat i inoperant lipsit de efect, fr urmri, permisie nvoire (acordat n special militarilor) de a prsi serviciul pe o durat scurt de timp i permisiune nvoire, aprobare de a face ceva; ngduin, ncuviinare; fr. jeune tnr i jaune galben, admirable vrednic de admirat, admirabil i admiratif admirativ, lever a scula i laver a spla; rus. rassvet zori i rascvet nflorire; engl. caste cast i caster castor; dumping inundare a pieei cu mrfuri ieftine, dumping i doping dopaj, doping (ultimele, paronime i n limba romn). De obicei, paronimele aparin aceleiai categorii lexico-gramaticale: arhivar arhivist, cenzur cezur, apologie apologism (substantive), viral virotic, termal termic (adjective), a prescrie a proscrie, a desena a desemna (verbe). Altele aparin unor categorii diferite: oral adjectiv, orar substantiv; arabesc substantiv, arabic adjectiv; nainte adverb, naintea prepoziie. Multe paronime difer prin sufixe: aventurist aventuros, accentuabil accentual, altele prin prefixe: ezoteric exoteric, prenume pronume. Aceast grup de cuvinte genereaz numeroase confuzii, greeli de exprimare ale vorbitorilor insuficient instruii. Eroii lui I.L. Caragiale vorbesc, de pild, despre icul de la baston (n loc de i), despre o lege de murturi (n loc de moratoriu), despre o cerneal violent (n loc de violet) .a. (Hristea, 1978, p.22-23). Sinonime sunt cuvintele cu forme diferite, dar cu sensuri identice sau foarte apropiate. Bogia unei limbi afirma Gh. Bulgr e ilustrat nu numai de cantitatea cuvintelor, a construciilor i a expresiilor specifice fixate de-a lungul timpului prin uz, ci i de volumul i calitatea acelor cuvinte variate i expresive care denumesc aceeai noiune sinonimele. Limba recurge, deseori, la ele din nevoia de a nuana i de a preciza ideea, fiind acceptat, n general, de ctre vorbitori, i evidena unor suprapuneri de cuvinte pentru aceeai noiune, dac se neglijeaz nuanele mici de difereniere stilistic, afectiv, regional, familiar etc. (cf. Hristea, coord. 1981, p.25). Contribuind la o exprimare ct mai precis i mai variat, sinonimia este un fenomen des ntlnit: rom. for autoritate, compatibilitate
173

potrivire, relaxat destins, insolubil nedizolvabil, a stoca a depozita; fr. demander solliciter a cere, rsoudre dcider a se hotr; engl. nice pretty - drgu, freedom liberty - libertate, obstacle hindrance piedic; rus. pravda istina adevr, zdes tut aici. Limba romn se remarc printr-o uimitoare bogie expresiv apreciat de cunoscutul romanist Alf Lombard: Importul aproape nelimitat de cuvinte noi, cadrul uimitor de extensibil al vocabularului, felul n care cuvintele triesc mpreun n interiorul acestui cadru, concurena dintre cuvintele care aparin straturilor diferite, diferenierea semantic sau geografic a sinonimelor, toate aceste probleme lexicologice constituie un ntreg pe care nici o alt limb nu-l ofer mai bine studiului (cf. Hristea, coord., 1981, p.25). Foarte puine sinonime au sensuri identice: rom. cupru i aram, natriu i sodiu, rus. lingvistika i jazykoznanie lingvistic, gostinica i otel hotel. Majoritatea sinonimelor au sensuri apropiate: stilare cultivare rafinare cizelare lefuire cioplire; a tulbura a ngrijora a emoiona a mpienjeni a rscoli a (se) zpci a (se) ntuneca a dezechilibra a instiga a deranja. ntre sinonime nu exist, de regul, o echivalen perfect. Adjectivul flexibil este sinonim cu flexionar n domeniul lingvisticii; relaia nceteaz, ns, n contextul corp flexibil (elastic, mldios); tomnatic i autumnal sunt, de asemenea, sinonime: autumnal nu poate fi, ns, folosit ntr-un context cum este flcu tomnatic; verbul a prinde este sinonim cu a gsi ntr-un context cum este l-am prins acas, nu ns i n altele ca: a prins a povesti, laptele s-a prins, a prins doi iepuri, l-a prins de mn .a. Relaia de sinonimie dintre termenii de mai sus este, deci, numai parial. Polisemia constituie o dificultate n cercetarea sinonimelor: substantivul compoziie poate avea, ca sinonime, n domeniul muzicii termenul cntec, n muzic i literatur bucat, pies, n teatru rol, n coal compunere, n domeniul tipografiei culegere, zeuire .a. Sinonimia nu se limiteaz numai la domeniul lexicului. Cercettorii vorbesc despre o sinonimie fonetic: seara i sara, umple i mple, o sinonimie gramatical: voi citi, o s citesc, am s citesc, o sinonimie afixal (prefixal: nestabil instabil, anormal nenormal sau sufixal: mugurel mugura, cscioar csu, ncetinel ncetior), despre sinonimie frazeologic: a fugi a o lua la fug a spla putina a-i lua picioarele la spinare a da bir cu fugiii i sinonimie lexico-frazeologic ce cuprinde sinonime la care relaia de echivalen se stabilete ntre un cuvnt ca unitate lexical i un grup de cuvinte
174

care formeaz o unitate frazeologic: vitriol acid sulfuric, epitaf inscripie funerar, trop figur de stil. Unii lingviti neag existena sinonimelor. Printre acetia lingvistul german H. Steinthal care afirm c aceeai noiune nu poate fi desemnat prin cuvinte diferite i c un cuvnt nu poate avea mai multe sensuri (limbile n-ar avea, deci, nici cuvinte sinonime, nici cuvinte polisemantice). Ambele fenomene sunt, ns, bine reprezentate n limb, sinonimele reflectnd aceeai noiune, accentundu-i anumite laturi, marcnd anumite nuane i contribuind la variaia expresiei. Alturi de cuvntul de origine latin timp, de pild, n limba romn s-a conservat i cuvntul slav vreme, ale crui derivate vremelnicie, a vremui exprim nuane pe care cuvntul timp nu le poate realiza: Vremea vremuiete i omul mbtrnete. Antonime sunt cuvintele care au forme diferite i sensuri diametral opuse: cf. rom. interior exterior, corect incorect, calitate defect, a urca a cobor; engl. friend prieten, enemy duman, to ask a ntreba, to answer a rspunde, tall nalt, small mrunt; fr. venir a veni, partir a pleca, jour zi, nuit noapte; rus. pravda adevr, lo minciun, nad deasupra, pod dedesubt. Antonimele pot exprima relaii calitative: rom. serios neserios; engl. rich bogat, poor srac; rus. molodoj tnr, staryj btrn; fr. grande mare, petit mic, cantitative: rom. mult puin, engl. much a little; temporale: vara iarna, engl. yersterday ieri, tomorrow mine, spaiale: aproape departe, engl. here aici, there acolo. Unele antonime grupeaz cuvinte cu rdcini diferite: rom. concret abstract, prost detept, a adormi a se trezi, sus jos; engl. big mare, small mic, to rejuvenate a ntineri, to age a mbtrni; rus. horoo bine, plocho ru, dat a da, vzjat a lua. Alteori, perechile de antonime sunt formate de la aceeai rdcin cu ajutorul unor prefixe (negative, privative .a.); rom. suficient insuficient, a face a desface, engl. agreement acord, disagreement dezacord, party partinic, non-party nepartinic, fr. dater a data, antidater a antedata, admissible admisibil, inadmissible inadmisibil, rus. vchodit a intra, vychodit a iei, serjoznyj serios, neserjoznyj neserios. Nu totdeauna grupul ne- este marc a unei relaii de antonimie (ca n
175

cazurile adevr neadevr, clar neclar): nu nebun, netot, necurat sunt antonime ale cuvintelor bun, tot, curat, ci ru, nimic, murdar. Cuvintele polisemantice pot intra n diferite relaii de antonimie: scump care se vinde i se cumpr la un pre ridicat are antonimul ieftin, iar scump foarte drag, iubit pe urt, nesuferit; greu care are greutate mare are antonimul uor, iar n contextul miros greu are antonimul plcut, agreabil. Antonimia se stabilete, deci, pentru fiecare dintre sensurile cuvintelor polisemantice. Uneori, antonimele se formeaz prin substituirea prefixelor: rom. a mpacheta a despacheta, a ncleia a descleia, a neleni a deseleni; rus. podchodit a se apropia, otchodit a se deprta, nadzemnyj de suprafa, terestru, podzemnyj subteran. Antonimele constituie o surs a expresivitii limbii des exploatat de literatura artistic. Cu ajutorul lor se formeaz antiteza: Eu veneam de sus, tu veneai de jos,/ Tu soseai din viei, eu veneam din mori (T. Arghezi) sau Ea bogat, eu srac; ea curtenit, eu izgonit i dispreuit; ea slab, mic i palid, eu voinic, mare i rumen; ea slujit de o familie ntreag de slugi, eu slugrnicind (B.St. Delavrancea). Asocierea ingenioas, n aceeai sintagm, a unor cuvinte ce exprim noiuni contradictorii oximoronul este o figur de stil cu deosebit efect artistic: Azi sunt btrn de tnr. Ce fel eram eu ieri! (M. Eminescu), nghee-te cldura, arz-te rcoarea (T. Arghezi), ulcioare mai frumoase i mai zvelte/cu mijlocul de pctoase sfinte fete (L. Blaga). Hiponime. Prin analogie cu termenii sinonimie, antonimie a fost creat termenul de hiponimie. Dei termenul hiponim este nou, noiunea de hiponimie este destul de veche i a fost de mult recunoscut ca unul din principiile constitutive n organizarea vocabularului tuturor limbilor (Lyons, p.507). Relaia de hiponimie este numit, adesea, i incluziune. Astfel, nelesul cuvntului lopat este inclus n cel al cuvntului unealt, nelesul cuvntului garoaf este inclus n nelesul cuvntului floare, nelesul cuvntului pantofi n cel al cuvntului nclminte .a.m.d. Un termen mai general, include, astfel, termeni mai speciali. Termenul sturion, de pild, include n el termeni cum sunt ceg, nisetru, morun. Acestea din urm sunt co-hiponime ale termenului sturion. Co-hiponimele pot fi n numr mai mic sau mai mare: mam i tat (incluse n nelesul cuvntului printe), primvar, var, toamn i iarn (incluse n anotimp), garoaf, trandafir, lalea, narcis, zambil, crizantem etc., co-hiponime ale termenului floare.
176

Termenii din urm printe, anotimp, floare sunt termeni supraordonai fa de hiponimele lor.
BIBLIOGRAFIE Marin Buc, Ivan Evseev, Probleme de semasiologie, Ed. Facla, Timioara, 1976, p. 118-143. Marin Buc, Onufrie Vineler, Dicionar de antonime, Ed. Enciclopedic Romn, Bucureti, 1974. R.A. Budagov, Introducere n tiina limbii, Ed. tiinific, Bucureti, 1961. Silviu Constantinescu, Dicionar de paronime, Ed. Lucman, Bucureti, 1998. Ion Coteanu, (ediie ngrijit), Crestomaie de lingvistic general, Ed. Fundaiei Romnia de Mine, Bucureti, 1998, p. 26-30. Ion Coteanu, Lucia Wald (red.), Semantic i semiotic, Ed. tiinific i Enciclopedic, Bucureti, 1981. Paula Diaconescu, Omonimia i polisemia, n Probleme de lingvistic general, vol.I, Ed. Academiei, Bucureti, 1959, p. 133-153. Al. Graur (coord.), Introducere n lingvistic, Ed. tiinific, Bucureti, 1972, p. 137-143. Al. Graur, Sorin Stati, Lucia Wald, red., Tratat de lingvistic general, Ed. Academiei, Bucureti, 1971, p. 26-28; 265-278. Theodor Hristea, Paronimia i atracia paronimic n limba romn (cu special referire la opera lui I.L. Caragiale), n Limb i literatur, nr.1, 1978, p. 22-23. Theodor Hristea (coord.), Sinteze de limba romn , Ed. Didactic i Pedagogic, Bucureti, 1981, p. 14-29. Emil Ionescu, Manual de lingvistic general, Ed. ALL, Bucureti, 1992, p. 33-41; 184-213. John Lyons, Introducere n lingvistica teoretic , Ed. tiin ific , Bucureti, 1995. Adam Schaff, Introducere n semantic, Ed. tiinific, Bucureti, 1966. Luiza Seche, Mircea Seche, Irina Preda, Dicionar de sinonime, Ed. Enciclopedic, Bucureti, 1993. S.Stati, Probleme actuale ale semanticii lingvistice, n vol. Limbaj, logic, filozofie, Ed. tiinific, Bucureti, 1968, p. 5-47. Lazr ineanu, ncercare asupra semasiologiei limbei romne. Studii istorice despre tranziiunea sensurilor, Tipografia Academiei Romne, Bucureti, 1887; reeditare, Ed. De Vest, Timioara, 1999. Emanuel Vasiliu, Introducere n teoria limbii, Ed. Academiei Romne, Bucureti, 1992, p. 70-89. A. Vraciu, Lingvistic general i comparat , Ed. Didactic i Pedagogic, Bucureti, 1980, p. 93-103. Lucia Wald, Elena Slave (red. resp.), Antologie de semantic, Universitatea Bucureti, 1976. 177

CHESTIONAR 1. Care este raportul sens-noiune? 2. Ce se nelege prin sens conotativ al cuvintelor? Exemplificai. 3. Dai cteva exemple de cuvinte ale cror schimbri de sens se datoreaz unor cauze lingvistice. 4. Ce factori extralingvistici stau la baza schimbrilor de sens? 5. Ce este analiza semic? Descompunei dou cuvinte n trsturile lor distinctive. 6. Ce este teoria cmpurilor semantice? 7. Ce sunt omonimele? Dai exemple de omonime n cele dou limbi pe care le studiai. 8. Ce se nelege prin omografe? Dar prin omofone? Exemplificai. 9. Explicai sensul urmtoarelor paronime i formai propoziii cu ele: deferent-diferend, patriotard-patriotic, anomal-anormal, secund-secundo, pasional-pasionat. 10. Dai exemple de sinonime, antonime i omonime n limbile pe care le studiai. 11. Ce sunt hiponimele? Exemplificai.

178

ABREVIERI

Abl. Ac. adj. adv. alb. ap. arab. bg. ceh. cf. comp. cuv. D. dacorom. dan. d. Hr. ebr. Ed. engl. etc. ex. fem . finl. fr. G. germ. grec. interj. ital.

ablativ acuzativ adjectiv adverb albanez, - (apud) la arab, - bulgar, - ceh,- (confer) compar (cu...) comparativ cuvnt dativ dacoromn(esc) danez,- dup Hristos ebraic,- Editur englez(esc),- et caetera exemplu,-e feminin fin(land)ez,- francez, - ; genitiv german,- grec(esc), - easc interjecie, - a, - ile italian,-

. Hr. japon. lat. lb. magh. masc. muz. N. neogr(ec.) n.n. pers. pl. pol. pop. port. pron. protorom. rom. rus. sec. sg. sl., slav. sp., span. subl.n. subst. .a. turc. v. V. vs.

nainte de Hristos japonez,- latin(esc),- limb, -a maghiar,- masculin muzic,-al nominativ neogrec(esc),- nota noastr persoan plural polon,- popular,- portughez,- pronume protoromn(esc) romn(esc),- rus(esc),- secolul,-ele singular slav, - spaniol,- sublinierea noastr substantiv i altele turc(esc), - vechi, veche vocativ versus ctre, nspre

179

Redactor: Cosmin COMARNESCU Tehnoredactor: Vasilichia IONESCU Coperta: Marilena (BLAN) GURLUI Bun de tipar: 14.02.2006; Coli tipar: 11,25 Format: 16/61 x 86 Editura i Tipografia Fundaiei Romnia de Mine Splaiul Independenei nr.313, Bucureti, s. 6, O P. 83 Tel./Fax: 316.97.90; www.spiruharet.ro e-mail: contact@edituraromaniademaine.ro 180