Department of Genetics Osmania University Hyderabad 500 007
There is a need for Understanding Molecular Mechanisms of Salt Stress Since the Problem of Salinity is Severe
World population has steeped up to 6.663 billion and if this feature of growth continues, world population would reach up to 9.2 billion by 2050.
Out of 14 billion ha of available land on earth for farming, arid and semi-arid regions compose 6.5 billion ha. There are 1200 million hectares of land that is affected by soil salinity.
With the increase of salinity in the soils over the years, it is expected that by 2050, more than 50% of the available land for agriculture will be lost because of severe salinity.
The exhaustion of essential resources such as fresh water has imposed serious constraints on the cultivation of food crops.
Hence, there is every need to understand molecular mechanisms underlying salt stress tolerance in plants. Outline of the Cardinal Responses of Plants to Salt and Drought Stresses Salinization of the medium
Depression of the external w
Perception of stress by the plant
Uptake of ions
Little Much
Synthesis of organic solutes High internal salt concentration
Little Much Toleration Susceptibility
Low tissue concentration, Osmotic Damage to membranes Low turgor adjustment organelles, enzymes Salt Stress Mostly Affects Photosynthesis Salt stress affects the closure of stomata
Salt stress influences the photosynthetic rate by affecting the rate of CO 2 entry through the stomata
Photosynthesis decreases as a result of stomatal closure
Stomatal closure during salt stress reduces CO 2 concentration at the photosynthetic site thereby limiting both assimilation and the utilization of photochemically derived ATP and NADPH 2
Bleaching of pigments occurs in chloroplasts during salt stress
Photosynthetic apparatus would become susceptible to photoinhibition and photooxidation
Photorespiration is reduced at lower water potential which may limit the plants ability to deal with surplus energy There are three Distinct Types of Plant Responses or Tolerance to Salt The mechanisms of salt tolerance fall into three categories : 1. Tolerance to Osmotic Stress :
The osmotic stress immediately reduces cell expansion in root tips and young leaves, and causes stomatal closure.
Plants synthesize and accumulate osmotic agents such as proline and glycine betaine in cytoplasm, but accumulate sugars, and K + in vacuoles and other compatible solutes to adjust osmotic strength.
A reduced response to the osmotic stress would result in greater leaf growth and stomatal conductance, but the resulting increased leaf area would benefit only plants that have sufficient soil water.
Greater leaf area expansion would be productive when a supply of water is ensured such as in irrigated food production systems, but could be undesirable in water limited systems, and cause the soil water to be used up before the grain is fully matured. Mechanisms of Salt Tolerance are Three Types 2. Na + exclusion from root plasma membrane (by SOS pathway) and leaf blades (through salt glands) :
Na + exclusion by roots ensures that Na + does not accumulate to toxic concentrations within leaves.
A failure in Na + exclusion manifests its toxic effect after days or weeks, depending on the species, and causes premature death of older leaves. 3. Tissue tolerance to Na + and Cl - : Tolerance requires compartmentalization of Na + and Cl - at the cellular and intracellular level to avoid toxic concentrations within the cytoplasm, especially in mesophyll cells in the leaf.
Toxicity occurs with time, after leaf Na + increases to high concentrations in the older leaves. Na + and K + Uptake Systems in Plants is Complicated Na + is toxic at high millimolar concentrations.
Plants require high K + compared to Na + .
K + is an essential macronutrient and the most abundant cation in plants.
K + contributes up to 10% of total plant dry weight and plays an important role in the activation of enzymatic reactions, photosynthesis, protein synthesis, maintenance of cellular osmolarity, regulation of turgor, stomatal movement and cell elongation.
K + uptake in plants is mediated by two mechanisms, a low affinity system (KIRCs, KORCs) that functions when extracellular K +
concentration is high (> 200 M to mM) and a high affinity system (KUP- HAK) that functions at low extracellular K + concentrations.
The ratio of K + /Na + in plant cells will depend on the concerted action of transport systems located at plasma and vacuolar membranes and probably involves K + selective, Na + selective and non-selective pathways.
Sodium Uptake
Under typical physiological conditions, plants maintain a high cytosolic K + /Na + ratio.
Given the negative membrane potential difference at the plasma membrane (- 140 mV), a rise in extracellular Na + concentration will establish a large electrochemical gradient favouring the passive transport of Na + into the cells (through non-selective cation channels, i.e. NSCC).
Na + ions can be transported into the cell through K + transporters. Plants use low and high affinity transporters to take up K + from the extracellular medium.
Sodium Efflux at the Plasma Membrane is Through Salt Overly Sensitive Protein (SOS1) In plants, the main mechanism for Na + efflux is mediated by the plasma membrane H + -ATPase.
The H + -ATPase uses the energy of ATP hydrolysis to pump H +
out of the cell, generating an electrochemical H + gradient.
This proton motive force generated by the H + -ATPase operates the Na + /H + antiporters, which couple the movement of H + into the cell along its electrochemical gradient to the extrusion of Na +
against its electrochemical gradient.
It is the SOS1 (or sodium proton antiporter, NHX1) protein located at the plasma membrane in concert with SOS2 and SOS3 complex helps in exclusion of Na + ions out of the cell.
Regulation of Na + and K + Homeostasis by the SOS pathway High Na + H + V-ATPase P Pase SOS3
SOS2 Vacuole
NHX HKT1 ? SOS3 Transcriptional and posttranscriptional gene regulation SOS1 SOS2 K + Ca 2+ H 2 O ? Ca 2+ H + Na + Na + H + Na + pH 5.5 pH 7.5 H + Methodology Adapted in the Present Study Genetic transformation in tomato and tobacco using Agrobacterium NHX1 gene isolation from sorghum Transfer into pTZ57R/T intermediate vector Construction of pCAMBIA1300 vector using SOS1 or NHX1 Functional validation of transgene integration I n silico analysis of NHX and HAK homologs Transfer of NHX1 into the vector PRT100
NHX1 Gene specific primers for partial gene were designed based on homology of the gene isolated from different species using NCBI, CLUSTALW and IDT tools.
Partial NHX1 gene sequence was used to localize full length NHX1 gene using the blastpar-simple.html tool with complete Sorghum genome sequence and the position of gene was retrieved, which is on chromosome 9.
Genbank accession number for this gene is EU482408 and protein ID is ACD64982. NHX1 (SOS1) Gene is Located on Chromosome 9 in Sorghum 1.5 kb M 1 2
pCAMBIA1300 vector 2.3 kb M 1 NHX1 Gene is 1473 bp in Length in Sorghum and has 10 Exons and 9 Introns cloning and characterization of full length NHX1 gene
Exon 1 Exon 2 Exon 3 Exon 4 Exon 5 Exon 6 Exon 7 Exon 8 Exon 9 Exon 10 Arrows represent the exons (10) while bars represent the intron regions (9) 3' UTR CODING REGION 1473 bp
Diagrammatic representation of full length NHX1 cDNA 5' UTR 252 bp 320 bp MGLDLGALLKSGALSVSDYDAIVSINIFIALLCSCIVIGHLLEGNRWVNESITALVMGLIT GGVILLVTNGTNSRILVFSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFITIILFGAVGTLI SFVIISLGAMGLFKKLDVGPLELGDYLAIGAIFSATDSVCTLQVLNQDETPLLYSLVFGEG VVNDATSVVLFNTIENLDIANFDAIVLLNFVGKFLYLFFTSTILGVATGLLSAYIIKKLCF ARHTFATLSFIAEIFLFLYVGMDALDIEKWKLASSSPKKPIALSAIILGLVMVGRAAFVFP LSFLSNLSKKEARPKISFKQQVIIWWAGLMRGAVSIALAYNKFTSSGHTEVRVNAIMITST VIVVLFSTMVFGLLTKPLLSLLIPPRTGLNTSSLLSSQSILDPLLTSMVGSDFDVGQINSP QYNLQFILTAPTRSVHRLWRKFDDRFMRPMFGGRGFVPFVPGSPVERSVPEPHLGTVTEAE HS
NHX1 has 490 Amino Acids and 8 Transmembrane Segments The complete amino acid sequence was subjected to MEME online analysis tool with following parameters: a) width of motifs from 6 to 50, b) maximum number of motifs (10), c) distribution of single motif among the sequence is one per sequence. Red color- Amelioride binding site, Blue and Orange NHX signature sequence
8 transmembrane segments are present in NHX1 gene with a hydrophobicity plot of 0.68. In the graph red color peaks are the transmembrane regions.
Different stages of regeneration and hardening of NHX1 transgenic tomato plants Explants on selection medium Multiple shoots Rooting Transgenic plants in the net house Shoot initiation Shoot elongation Development of roots Different stages of regeneration and hardening of NHX1 transgenic tobacco plants Transgenic plants in the net house Explants on selection medium Plant, Fruit and Seed Sizes are Reduced in Transgenics Tomatoes control transgenic control Transgenic After transformation with NHX1 gene, morphological changes were observed in fruit size. Transgenic plants produced small sized fruits with more yield compared to untransformed control plants. PCR and RT-PCR amplification in control and transgenic plants. M = Molecular weight marker; +C = positive control, C = non-transformed control; Lanes 1-4 = transgenic plants NHX1 PCR GFP PCR hptII PCR PCR Amplification of NHX1 was Observed in Transgenics but not in Controls 750 bp 776 bp 752 bp 776 bp 752 bp 750 bp M +C C 1 2 3 4 RT-PCR Showed Transcript Levels only in Transgenics M +C C 1 2 3 4 M +C C 1 2 3 4 M +C C 1 2 3 4 M +C C 1 2 3 4 M +C C 1 2 3 4 Southern hybridization of genomic DNA samples of transgenic
plants using NHX1 gene specific probe +C = vector DNA; C = un-transformed control. Lanes 1 4 = transgenic plants. Southern Blot Revealed Insertion of NHX1 Gene in Transgenics NHX1 gene integration was confirmed by digesting the genomic DNA from transgenic plants with HindIII restriction enzyme and probed with gene specific probe. The autoradiogram generated after exposing the blot to the film showed positive hybridization at the 776 bp region for each putative transgenic plant samples except in untransformed control plants +C C 1 2 3 4 NHX1 Protein is Localized at the Plasma Membrane Level Localization of NHX1 protein at plasma membrane level using Leica confocal microscope. T.S. of tomato transgenic leaf with GFP in green color and chlorophyll pigment in red color
To localize the NHX1 protein at membrane level, GFP peak was measured at 510 nm. Since plants contain many auto florescent compounds including lignin, GFP was masked at the same wavelength. To minimize this problem, auto fluorescence compounds were given red color but GFP with green color at the same wave length. Transgenics are Confirmed with GFP using Flow Cytometer In the above graph, green peak is untransformed control plant with autofluorescence and black peak is transgenic with GFP reporter gene With 150 mM NaCl Treatment, Untransformed Plants Wilted and Turned Brown, But not Transgenics Transgenic control Control Transgenic One month old untransformed control and T 1 transgenic seedlings were watered with 150 mM NaCl for 72 h. Control plants wilted within 5 days, while the transgenic seedlings were not affected and grew normally Fluorescence Lifetime Imaging Revealed Less Sodium Green Fluorescence in Transgenic Roots and Stems Compared to Controls 9-day-old seedlings treated with 150 mM NaCl. Root and stem segments were cut from the mature zone and incubated in 10 mM of Sodium Green solution. After 1 h of incubation, samples were examined using confocal microscopy. Na + content in each cell compartment is proportional to the intensity of Sodium Green uorescence Transgenic Root Control root Transgenic stem Control stem Type of Sample Type of explant
With stress (% by mass/PPM)
Without stress (% by mass/PPM) Ions Ca 2+ K + Na + Cl - Ca 2+ K + Na + Cl -
Compared to Controls Data indicate average of 4 samples taken from two independent transgenic lines. Ion analysis (% by mass/PPM) of control and transgenic plants (I and II) with and without stress using inductively Coupled Plasma Optical Emission Spectrometer (ICP-OES) instrument. Chlorophyll Fluorescence Varied Significantly Between Transgenics and Untransformed Controls Control without stress Transgenic 1 without stress Transgenic 2 without stress Transgenic 3 without stress Control with stress Transgenic 1 with stress Transgenic 2 with stress Transgenic 3 with stress Transgenic 1 after recovery Transgenic 2 after recovery Transgenic 3 after recovery Fluorescence variation was observed under normal and saline (150 mM NaCl) conditions. Transgenics showed more tolerance and recovered after stress , whereas untransformed control plants eventually died after 10 days Chlorophyll fluorescence of control and transgenic plants were measured using Handy Pea instrument under dark conditions with 3 parameters (without stress, 150mM NaCl for 72 h and after recovery from stress) Comparative studies have been carried out in order to characterize the Na + and K + transporter genes that determine morphological and functional similarities of the grasses
The idea behind this study is that the knowledge gained in one species can be easily transferred to other grass species which will be of great interest for genes controlling salt stress and K + nutrition
Comparative studies can also result in an increase in our understanding of the evolutionary mechanisms that have led to the current structure of grass genomes
Cation proton antiporter (CPA1) family is a large family comprising of 3665 genes with 46 unique families. Of these, many genes with unknown function are present. NHX1 and HAK1 also belong to this family Genome-wide I n silico Analysis of Cation (Na + and K + ) Transporters is Necessary to Know the Number of Genes and Tissue Localizations Comparative map of NHX1 homologs among 3 species NHX Transporters are not Present on Chromosomes 4, 6 and 7 in Sorghum, 3, 5 and 9 in Maize, 3 and 4 in Rice Features in red have correspondances, red line denotes automated name based correspondance Top hits of Na + transporters were collected from sorghum, rice and maize and uploaded into cMAP tool using PERL script. In each plant, NHX1 and NHX3 genes are highly conserved and present on same chromosome, likewise NHX2, NHX4, NHX5 and NHX6 genes are also present on same chromosome regions. Synteny Analysis for NHX1 Revealed more Block Duplication Events than Tandem Duplication Events Duplication type Count Percentage No Duplication event 16 61.54 % Tandem duplication event 3 11.54 % Block duplication event 9 34.62 % Tandem & block duplication event 2 7.69 % Gene duplication type venn diagram and table Synteny map of NHX1 gene Tandem duplication
Block duplication NHX Homologs are Highly Conserved, but Evolutionarily Diverged NHX homologs are highly conserved but are evolutionarily diverged about maximum due to genome duplications 700 million years ago among monocots. NHX1 gene isolated from Sorghum bicolor is closely related to NHX3 gene of Oryza sativa. Distance matrix histogram showing the functional diversity of Na +
transporters using DIVEIN tool as a tree based method Not Much Functional Divergence of NHX Transporters Has Been Observed Using DIVEIN Tool Protein-Protein Interaction Map of NHX1 NHX proteins have produced 20 interactors in yeast and Arabidopsis Gene name Sorghum Maize Rice Chr a.a ORF E TM L chr a.a ORF E TM L chr a.a ORF E TM L NHX1 9 490 1473 12 9 V 10 304 915 7 5 P 5 454 1365 8 8 V NHX2 2 784 2355 15 8 P 7 518 1557 13 10 Cy 7 458 1377 10 10 P NHX3 9 823 2472 17 8 P 10 539 1620 12 10 Cy 5 544 1635 13 10 V NHX4 2 696 2091 16 4 P 7 518 1557 13 10 Cy 7 458 1377 10 10 P NHX5 2 696 2091 15 4 P 7 518 1557 13 10 Cy 7 479 1440 11 9 P NHX6 2 696 2091 15 5 P 7 518 1557 13 10 Cy 7 479 1440 12 9 P NHX7 4 558 1677 3 0 N 6 612 1839 9 1 N NHX8 8 720 2163 6 0 Ch 1 829 2490 14 0 N 12 1025 3078 16 6 Cy NHE isoform1 8 597 1794 5 0 Ch 8 884 2655 12 0 N 11 806 2421 8 0 N NHE isoform2 3 1127 3384 2 0 Cy 10 819 2460 10 0 N 2 817 2451 7 0 N NHE isoform3 3 726 2181 4 0 N 7 1278 3837 2 0 P 10 733 2202 1 0 M NHE isoform4 10 1150 3453 7 0 N 6 1007 3024 5 0 N 5 1189 3570 8 0 Ch NHE isoform5 5 955 2868 3 2 P 7 748 2247 4 0 N 1 812 2439 1 1 N NHE isoform6 2 699 2100 3 0 N 7 765 2298 8 0 N 8 810 2433 7 0 N NHE isoform7 1 686 2061 1 0 N 6 909 2730 3 0 Cy 2 630 1890 1 1 P NHE isoform8 1 908 2727 8 1 V 8 955 2868 6 0 Ch 5 561 1686 5 6 P NHE isoform9 2 596 1788 3 0 Ch 4 1033 3099 5 0 Cy 9 595 1788 3 0 Ch Chr-chromosome number from which the gene sequence is retrieved, a.a-amino acid sequence, ORF-open reading frame, E-number of exons, TM-number of transmembrane segments. L- predicted cellular location of gene. Ch-chloroplast. Cy-cytosol. M-mitochondria. N-nuclear. P-plasmamembrane. V-vacuolar membrane.
NHX Transporters Comparison Table Among Sorghum, Maize and Rice Comparative Map of HAK Transporters Revealed that HAK1 and KUP1 Have Evolutionary Lineage Top hits of K + transporters were collected from sorghum, rice and maize and uploaded into cMAP tool using PERL script. Synteny Map of HAK1 Gene Among the Three Different Species Duplication type Count Percentage No Duplication event 22 52.38% Tandem duplication event 7 16.67% Block duplication event 14 33.33% Tandem & block duplication event 1 2.38% Tandem duplication
Block duplication More Block Duplication Events were Observed Compared to Tandem Duplications also for HAK1 Gene HAK Homologs are Conserved but Diverged Evolutionarily K + homologs are highly conserved but are evolutionarily diverged about maximum due to genome duplications, 700 million years ago among monocots. HAK1 gene isolated from Sorghum bicolor is closely related to KUP1 gene Distance matrix histogram showing the functional diversity of K +
transporters using DIVEIN tool as a tree based method Unlike NHX Transporters, HAK Transporters are Functionally Diverged as Indicated by DIVEIN Protein-Protein Interaction Map of K + Transporters 22 Interactors with KUP Protein Have Been Observed with Arabidopsis Complex Network of Sodium and Potassium Transporters SOS1 is Interacting with RCD1 (radical induced Cell death1), potassium transporters, calcium exchangers and NHX proteins Full length NHX1 gene was isolated from Sorghum bicolor and cloned into pCAMBIA1300 binary vector and transformed into Agrobacterium tumefaciens LBA4404 strain using freeze thaw method.
NHX1 gene characterization showed that it has 8 transmembrane segments with 10 exons and 9 introns. Genetic transformation of tomato and tobacco plants was carried out and putative transgenics were selected on selection media.
Preliminary screening of T 0 and T 1 transgenics for gene integration was confirmed by molecular methods like PCR, RT- PCR and Southern blotting.
I n silico analysis of cation transporters (Na + and K + ) was done. cMAPS and synteny plots at genome level for 3 grass species were generated.
Expressed in: 23 different plant tissues (when PLAZA tool was used)
Expressed during: 13 growth stages (using PLAZA bioinformatics tool)
The NHX genes were shown to have produced 20 interactors in yeast and Arabidopsis. All genes excepting NHX1 and NHX3 were found to have orthologs while NHX5 alone is known to have nine interacting partners in Arabidopsis Phylogenetic analysis reveals that NHX1 and NHX2 originated via evolutionary lineage-specific events
The interesting fact found with above tools is that NHX gene interacts with Radical induced Cell Death (RCD1), a regulator of oxidative stress and also expresses in plant structures during different stages Conclusions Functions of HAK: Potassium uptake, membrane transport, inward and outward rectifier potassium activity, cyclic nucleotide binding, root hair elongation etc.
Located in: integral to membrane
Expressed in: 26 plant structures (or tissues when PLAZA tool was used)
Expressed during: 15 growth stages (using PLAZA bioinformatics tool) Phylogenetic analysis reveals that HAK1 and KUP1 originated via an evolutionary lineage-specific events
Some atomisation-excitation sources used in atomic emission spectrometry are:- Flame - Electric spark- Electric arc- Inductively coupled plasma (ICP)- Microwave plasma- Glow discharge lamps- Lasers