Documente Academic
Documente Profesional
Documente Cultură
INDEX PAGE
Prefacescopeofworks
1.Executionstatement 3
2.InterpretationsandAbbreviations 3
3.ProjectExecutionPlan 3
3.1C.A.T.ApproachPlan 3
3.2LongLeadItemsProcurement 5
3.3BulkMaterialProcurement 9
3.4ConstructionActivities 9
3.4.1.TemporaryFacilities 9
3.4.2.OrganizationChart 10
3.4.3.Subcontractors 10
3.4.4.FieldCoordinationProcedures 10
3.4.5.DetailedConstructionSchedule 10
4.DetailedConstructionSchedule 11
4.1.DataCollection 11
4.2.EngineeringandDesign 11
4.3.ConstructionoftheCoolingPlant 12
4.4.ConstructionofHEXBuildingsandETSs 18
4.5.Calibration 18
4.6.TestingandPrecommissioning 19
4.7.Commissioning 19
4.8.Training 19
5.QualityAssurance(QA) 20
6.Health,SafetyandEnvironment(HSE) 20
Appendix1PROJECTCHART
Appendix2ORGANIZATIONCHART
Appendix3LONGLEADITEMSLIST
Appendix4PROJECTKEYMILESTONES
Appendix5TEMPORARYFACILITIES
Appendix6LISTOFSUBCONTRACTORS
Appendix7CIVILMETHODSTATEMENTLIST
Appendix8MECHANICALMETHODSTATEMENTLIST
Appendix9E&IMETHODSTATEMENTLIST
Appendix10DESIGNINTENTREPORT
-2-
Q06024-IDCP-PLN-GT-001-REV A
1.Executionstatement
Forproperexecutionandtimelycompletionoftheproject,weareplanningtofollowourproposed
projectexecutionplan,whichisinlineandconformstothetargetscopeofworkandcompletion
datesasstipulatedinthecontractdocuments.
2.InterpretationsandAbbreviations
Intheprojectexecutionplan,thefollowingwordsandexpressionsshallhavethemeaninghereby
assignedtothem,exceptifotherspecifiedorwherethecontextotherwiserequires:
EMPLOYER(orClient,Owner,Company)meansQATARCOOLQCwillbecommonlyused
insteadofQATARCOOL.
PMCmeansDARALHANDASAHDARwillbecommonlyusedinsteadofDARAL
HANDASAH.
CONTRACTORmeansC.A.T.INTERNATIONALQATARW.L.LC.A.T.willbecommonlyused
insteadofC.A.T.INTERNATIONALQATARW.L.L.
DESIGNTEAMmeansSTANLEYEngineeringSCIwillbecommonlyusedinsteadofSTANLEY
Engineering.
3.ProjectExecutionPlan
3.1.C.A.T.Approach
TheimplementationofthisprojectExecutionPlanthatcomplieswithQ.Crequirementswillbethe
mainobjectiveofC.A.T.
C.A.T.willbeworkingwithEMPLOYER(QC)personnelandPMC(DAR)personnel,andDesign
Team(SCI)personneltoensurethatthisprincipalobjectiveisaccomplished.Ourexperienceon
similarprojectshasseasonedourpersonneltocompleteanyandallservicesrequiredwithoptimum
performanceresults.
TheC.A.T.ProjectsTeamandseniormanagementarecommittedtoprovidingaprojectthatmeets
EMPLOYERsobjectivesaswellasourownprincipalobjectives.Wetakeprideinourworkandare
confidentthesewillbeaccomplished.TheprincipleobjectivesthattheC.A.T.managementexpects
tobemetareasfollows:
MeetallcriticalmilestonesandcompletetheProjectonschedule
-3-
Q06024-IDCP-PLN-GT-001-REV A
Maintainprojectcostswithinbudget
Meettechnicalperformanceobjectives
ObtaintotalsatisfactionfromEMPLOYER
TheproposedProjectChart(seeAppendix1)hasbeendevelopedtoachievetheabovementioned
expectations.
Thesuccessfulmanagementoftheprojectrequiresgoodcommunicationsbetweentheengineering
team and construction team, comprehensive management information systems and a competent,
welldirectedprojectteam.
Directly upon award, a qualified management and supervisory Project Team was appointed to
prepareadetailedstudyoftheprojectrequirementsasfarasengineering,materials,equipmentand
labor force required (see Appendix 2, Contractor Organization Chart). This group of dedicated
projectpersonnelbeganidentifyingtheprioritiestobecompletedintheearlystagesoftheproject
andplannedfortheinitialkickoffmeetingthatwasheldinQCoffices.Thisinitialmeetingwas
importantinestablishingastrongteamrelationshipwiththeQC,DAR&SCI.
Afterawardofthecontract,themanagementpersonnelfromareasbeganmobilizingtofulfillthe
staffingneededfortheproject.ThisstaffstartedwithSCIverifyingtheavailabledesign.
Basedontheconceptdesign,procurementoftheLLILongleaditems(seelistinAppendix3)
startedaspertheprocurementprocedures.Theprojectkeymilestones(seeAppendix4)weretobe
confirmedasperthesuppliers&projectprogress.
SCIstartedwiththeconceptdesign,aimingtosubmitthesametoQC&DARforclearanceandto
goaheadwiththedetaileddesign.
-4-
Q06024-IDCP-PLN-GT-001-REV A
3.2. LongLeadItemsProcurement
FLOWOFPROCUREMENTACTIVITIES
Composite Commercial
Requisition
Vendor List Terms
Procurement
Project
Concept Design Policy and Inquiry
Vendor List
Procedures
Client Approval
Negotiation
with Vendor
Data Input
-5-
Q06024-IDCP-PLN-GT-001-REV A
TherequisitionofLLIiscriticalandwillbedevelopedonarushbasis,immediatelyaftercontract
awardandapprovalofconceptdesign.Owningtothecriticalmilestonesrequirements,itis
essentialthataccelerationpremiumsforspecificequipmentandmaterialstobedevelopedand
reflected
C.A.T.sflowprocurementactivities,asshownabove,includethefollowingpolices:
AwellscreenedprojectvendorlistwithapreferenceforQCrecommendedvendorswillbe
prepared,reflectingC.A.T.recentprocurementexperience;dueconsiderationisgivennotonlyto
technicalcapabilities,commercialcompetitivenessandofferedguaranteeconditions,butalsoto
deliveryperformance.
Purchaseorderplacementwillbebasedonquotationdevelopmentexceptwheresourceor
leadtimeconstraintsdictateotherwise.
Fasttrackingproceduresareestablishedtofacilitateearlyprocurementoflongleadtime
items;closelyknitinterfacingamongQC,DAR,C.A.T.andSCIisexpectedandwillbe
implemented.
Rigorousexpeditingandfrequenttrackingofmaterialsstatuswillbeperformedinthe
realizationthatanydelayfromtheConstructionRequiredDates(CRD)ofmaterialsarrivalonthe
sitewillendangermeetingofthecontractualprojectcompletiondate.
Anefficientfieldmaterialscontrolsystemwillbeestablishedandthroughindoctrinationon
warehousingoperationwillbecarriedout.
LLIprocurementwillbedoneasperourC.A.T.standardprocurementprocedure,inorderto
complywiththeemployerspecifiedpolicies.3rdPartyValidation(ifrequired)forLLIprocedure
willbeperformedasandwhenrequired.
AspartofprocurementactivityC.A.T.&SCIwillcarryoutatechnicalevaluationforeachitem
startingwithtechnicalclarificationandfinalizingwithaTechnicalEvaluationReportC.A.T.&SCI
willcarryoutalsoareviewofvendorsdrawings/documentationaspartoftheabovementioned
procurementactivity.
The technical bid evaluation will be undertaken by each engineering discipline. The technical bid
evaluationisusedtosummarizethetechnicalaspectsofbidsreceivedforaspecificrequisition,in
order that the bids may be compared and evaluated. Proposals (bids) are forwarded to the SCI
EngineersandCATConstructionManagersforevaluation.
A thorough review of technical data will be made to determine whether bids conform to the
specified technical requirements. Any deviations or inadequate information is identified at that
time.Inaddition,C.A.T&SCIcoordinateanyotherreviewsapplicabletotheparticularevaluation
(constructionimpacts,technicalspecialistreview,etc.)andincorporatetheresultsofthesereviews
onthetechnicalbidevaluation.
ThetechnicalbidevaluationisthenreviewedandapprovedbytheProjectManager.Atthispoint,
C.A.T. area procurement department shall evaluate the bids based on project requirements and
-6-
Q06024-IDCP-PLN-GT-001-REV A
commercial issues. Compliance with project requirements will be imposed on the vendor for all
aspectsofhisequipment.
Onceabidisdeterminedtobetechnicallyacceptableandcommerciallyoptimal,C.A.T.willsendits
recommendation to DAR for approval. C.A.T. will award purchase orders only upon obtaining
QC/DARapprovals.
Upon receiving Companys vendor approvals, C.A.T. will issue purchase orders to the selected
vendors. All purchase orders are monitored. Suppliers will submit monthly progress reports to
tracktheequipmentstatus.Similarly,theshopdrawings/productionanddeliveryschedulereport
willdepict,indetails,thestatusofvendordrawings,data,factoryacceptancetestsandinspections,
otherrelevantdocumentsasrequested.
All LLI will be received on site. All LLI will be checked upon receipt for quality, quantity,
conformance with specifications, damage and tag or identification number, and entered on stock
cards.
A receiptreport and, if applicable, an overage,shortage or damage reportwill be prepared. Issue
will be made on a materials requisition form signed by a signatory from a limited list of persons
authorizedbytheprojectmanager.
Theprojectprocurementofficerwilloverseealllocallysuppliedmaterial.Receiving,warehousing,
reportingandmaterielissuedforconstructionactivitiesshallfollowC.A.T.QA/QCprocedures.
Importeditemswillbereceivedbypurchaseordernumber/tagnumberifappropriate,andchecked
for quantity and evidence of any shipment damage. Contractor will establish a construction
warehousesystem,whichincludecoveredandopenstoragetocontrolthematerialuntilitisneeded
for construction. The Construction Manager will be responsible for issuing material transfer
authorizationstoreleasematerialstothevariousConstructionSuperintendents.
TheProcurementOfficerwillberesponsibleforprovidingmarkingandtagginginstructionsonall
purchase orders. This effort will provide means in the identification of all materials received and
establishtraceabilityasrequired.
AsprojectLLIarereceived,areportofmaterialsreceivedwillbetransmittedtoupdatetherecords
and generate reports for construction management and QC use. Material inventories will be
adjusted as contractor issues materials and equipment for construction through standard material
transferdocument.
Theprocurementteamwillinterfacewiththequalitycontrolfunctiontoensurethatmaterialsand
equipmentareacquiredwithoutdisruptingthedesignandconstructionschedules.Giventhehigh
coordinationdemandsofthisfunction,theProjectProcurementOfficerwillserveasakeyfacilitator
between the various elements of timely procurement. He will track the progress of materials and
-7-
Q06024-IDCP-PLN-GT-001-REV A
equipment through delivery to the work site, providing a centralized point of information for all
projectmanagement.
The project quality and project controls functions will supplement the procurement effort in
support roles. Inherently linked by their common goals of vendor quality and schedule impact,
thesetwofunctionswillcloselyinterfacewithProcurementthroughoutthelifeoftheproject.
The quality control function monitors the procurement function with each of its supporting
positions. Working to ensure quality from both its subcontractors and vendors, this function
assumes the role of quality assurance for its vendors and quality control for the entire project
throughcontinuedanalysisofoureffortsaswellasourvendorsandsubcontractors.
Where discrepancies are observed, nonconformance reports will be prepared and submitted.
ProvisionhasbeenmadeforFATtestedandwitnessedbyQCandC.A.T.
The QA/QC Manager will verify the technical viability of potential vendors and subcontractors.
Throughadocumentedprocessandinspection,thiscoordinatorwillresearchtheabovecriteriaas
wellasthequalitysystemsofpotentialsuppliers.
The project Planning Engineer will predominantly assist in the scheduling and document control
activities. Working with the Expediter on the area Procurement Department, the project Planning
Engineer will develop procurement schedules, linking the relationship between procurement of
specificequipmentandmaterialswithcriticaldesignandconstructionactivities.
The Document Controller will maintain the officials vendor data control register, updating and
tracking all vendor data processed for review/approval. The Document Controller will coordinate
vendor communications, receiving and returning markedup and/or approved drawings or other
vendor data. This data will include, but is not limited to, design calculations, parts lists, special
tools,sparepartsrecommendedbythevendorandvarioussubvendordocuments.
Vendor data submissions will include drawings, spare parts data packages, operating and
maintenance manuals/instructions, procedures, and other pertinent data needed to support the
equipmentormaterialbeingpurchased.
On arrival of products to storage area, the storekeeper with the help of relative department
(Mechanical, Electrical, etc) or his designate shall start unloading, checking against the purchase
order or the loading note and labeling each item with its correct description, tally sheet number,
stocknumber,drawingnumber,andstoreitinitsproperplaceasadvisedbythespecifications.
Upon receipt of equipment, each delivery shall be checked for quantity and quality, shortages
visible or concealed damages. Should there be any damages, shortages, etc then the Site
Management shall be informed according to applicable procedure. The material received shall be
recordedonstockrecordsaspertheapplicableprocedure.
-8-
Q06024-IDCP-PLN-GT-001-REV A
To avoid double handling and only in the event that it suits, lifts will be initially programmed to
arrive to site after their prospective foundations are ready. The QA/QC Department and the
storekeeper shall ensure that the handling of products is according to vendor specifications,
contractual documents, safety standards and project requirements. Similarly, he shall ensure that
concerned people are properly and currently informed of material received or to be received. All
concernedemployedinmaterialhandlingshallbewellconversantwithvariousprojectsandhave
hadpreviousexperiencedealingwithconstructionpermanentmaterial.Specialconsiderationsshall
beappliedtomaterialsandcomponentsthatshouldnothaveunnecessaryhandlingduetoweight,
orconfiguration.
3.3.BulkMaterialProcurement
The materials procurement, other than LLI, will be done as per the same described procedure for
LLI.
3.4.ConstructionActivities
Soon after N.T.C. a construction group was organized within the Project Team. Based on the
constructionstrategyestablishedandprojectrequirementsidentifiedduringthebiddingstage,this
group will develop the Construction Plan, keeping in close contact with the engineering and
procurementgroups.TheConstructionPlanwillbecontinuallyrevisedandupdatedasrequiredto
reflectthelatestinformationaffectingconstructionoperationsandwillcoverthefollowingareas:
3.4.1.TemporaryFacilities
3.4.2.OrganizationCharts
3.4.3.Subcontractors
3.4.4.FieldCoordinationProcedures
3.4.5.DetailedConstructionSchedule
3.4.1.TemporaryFacilities
Temporaryfacilities(seeAppendix5)shallbeerectedincloseproximitytotheworks,aftersecuring
M/SUDCs&DARsapprovaltothelayoutandlocationsofsiteoffices,stores,workshops,etc...Site
PlotPlanandofficesAreasshallbefencedinaccordancewiththeConstructionRegulations.
We shall accommodate our personnel in existing camp in Rayyan & Shahaniyah Areas. Proper
transportshallbeprovidedtoensurethetransferofemployeesfromandtositeincomfortableand
suitableconditions.Staffwillbeaccommodatedinfurnishedapartments.
QC & DAR requirements for Temporary Facilities shall be completed in accordance with the
supplementaltermsandspecifications.SafetyandEnvironmentalProtectionshallbemaintainedby
ourSafetydepartmentasperRequirementsandasperCATSafetyManual.
-9-
Q06024-IDCP-PLN-GT-001-REV A
OurHSEDepartmentpersonnelareaswellfamiliarwiththehandlingandsecuringpassesfromthe
localauthoritiesandUDC;immediately,theprocessofsecuringpassestoallpersonnelenteringthe
zoneshallproceedtoguaranteethatsuchpasseswillbeavailableontime.
3.4.2. OrganizationCharts
TheProjectChart(seeAppendix1)andtheContractorChart(seeAppendix2)havebeenstructured
to effectively and economically achieve the project construction objectives. The proposed
organizationaddressesalltheprojecttraderequirementsasfarasmanagementandsupervision.It
isdesignedinawaytoprovideQC&DARwithacomprehensiveandhomogeneousteameffective
in the execution of this type of works and meeting the project milestones. Staff C.Vs, from
Supervisorlevelandabove,shallbesubmittedtoQC&DARforpriorapproval.
3.4.3. Subcontractors
Thesubcontractors(seeAppendix6.ListofSubcontractors)shallcoverspecificareasandshallbe
specializedfortheirexpertisearea.PriorapprovalwillbeobtainedfromDARbeforesubcontracting
thework.TheProjectManager,ConstructionManagers,ProjectEngineers,DisciplineEngineers,QC
andSafetyEngineershallcontroltheSubcontractorsfieldofactivities.
3.4.4. FieldCoordinationProcedures
Field control will be broken down into the following areas, with management coordinating the
separateeffortsintoaneffectiveandefficientfieldorganization:
ManpowerControl
SafetyandSecurityControl
WarehousingandMaterialsManagementPlan
ConstructionEquipmentControl
FieldChangesControl
DocumentControl
3.4.5. DetailedConstructionSchedule
ThedetailedConstructionScheduleiscovering:
DataCollection
EngineeringandDesign
ConstructionofCoolingPlant
ConstructionofHEXbuildingsandETSs
Calibration
TestingandPrecommissioning
Commissioning
Training
WarrantyPeriod
- 10 -
Q06024-IDCP-PLN-GT-001-REV A
Theconstructionscheduleisdetailedinnextchapter.
4. DetailedConstructionSchedule
4.1 DataCollection
C.A.T.&SCIwillpreparethecheckliststoidentifytheinformationneededandtheinformationto
beobtainedfromDARandotherparties.Thedatacollectionactivitiesembraceeachofthevarious
disciplinesandwillbestructuredtomeettheneedsforthedesign.
CriticaltothescheduleforthisprojectisthedatasitesurveythatwillbeundertakenbyC.A.T.at
thestartoftheproject.
4.2. EngineeringandDesign
SCIwillreviewtheprojectrequirementswithQC,DAR&C.A.T.toconfirmandobtainallrequired
datapertainingtotheprojectdeliverables.Duringthemeetings,themainequipmentsandsystems
will be finalized. Data, such as production rates, physical properties of the products and other
relevantdatawillbereviewedandagreed.
SCIwilldeveloptheconceptdesign,passittoCATfordoublecheckingandreviewingit,andverify
itwithQC/DARpriortodevelopingthedesign.ADesignIntentReportwillbeissued,(Appendix
no.10).
Based on the verified design, the procurement of the LLILong Lead Items will start as per the
procurementproceduresalreadydescribed.Theexactsequenceofactivitiesduringtheengineering
and design phase will be dependent on the schedule requirements for construction and
consequently the manufacturing and shipping times for procurement. Thus, some activities may
needtostartearlierbasedontheinformationprovidedbyQCinthestagepriortoaward.
SCI will perform detailed design ensuring that all process related activities defined in the project
requirements will be undertaken in accordance with international and QC standards and codes.
SCIsexperienceofsimilarprojectswillenablearecognizedandeffectivedesign.Oncethedetailed
design is substantially completed and approved, the mechanical, instrumentation and electrical
designs will commence and the finalized specifications and requisitions completed. Following
QC/DARapproval,thematerialandequipmentwillbetenderedandpurchased.
Usingthedataobtainedduringthesurveysandthefinalizedprocessdrawings,theplotplansand
layoutdrawingswillbedevelopedforDARapproval.
- 11 -
Q06024-IDCP-PLN-GT-001-REV A
The piping drawings and specifications will commence, based upon the approved plot plan and
layout drawings. These will be completed once finalized vendor data is received and approved.
Where applicable SCI/C.A.T. will check for compact designs with simplicity of installation but
which retain ease of access for operation and maintenance. SCI/C.A.T. will ensure that the plant
piping is laid out in an economical and effective manner to suit the process and operability
requirements.
SCI/C.A.T. will ensure that all civil engineering will be detailed with due regard to the local
conditions and taking into account the specificity of the area. SCI/C.A.T. will also ensure that full
considerationwillbegiventooperationalfunctionality,safetyandaestheticconsiderations.
Based upon the equipment & piping arrangements and relevant approved vendor data the
mechanical,electricalandinstrumentationdrawingswillbecompletedandfinalMTOsestablished.
When drawings are finalized and approved by QC/DAR they will be issued as Approved for
Construction(AFC).
The construction of the whole project will be performed according to our proposed construction
schedulethatgivesthestartandfinishdateofeachactivity.
4.3.ConstructionoftheCoolingPlant
The works for the plant and administration building shall cover but shall not be limited to the
following:
Siteclearing
Excavationandcompaction
Dewatering
WaterProofing
Raftfoundation&BuildingConcreteWorks
PrecastConcreteWorks
Equipmentfoundations
FinishingWorks
EquipmentWorks
PipingWorks
Fabrication&Erection
Electrical&Instrumentationworks
Landscape,Roads,curbstoneandsidewalks
SiteClearing
Weshallcarryonallthenecessaryclearing,grubbingandsoftlandscapinginaccordancewiththe
specifications .Excavated material shall be removed from the site and replaced by suitable one if
required,allasspecified.Weconfirmthatsuchworksshallstartaftersitepossessionandsecuring
therelatedapprovalandpermitsandagreeingtothelevels.Siteclearingwillbeperformedpartially
byC.A.T.andmainlybyourexcavationSubContractor.
- 12 -
Q06024-IDCP-PLN-GT-001-REV A
ExcavationforFoundationandSubstructures
The building shall be divided into 4 Areas. Areas are separated by construction joints. Each area
mighthaveadifferentexcavationlevel.TheselevelswillbecalculatedbySCIandagreedbyDAR.
The excavation work shall be executed, by our Subcontractor and under our supervision, in
accordance with drawings, specifications and instructions. Thus, excavation shall be done to the
lines and grades or elevation, agreed with QC & DAR during concept Design evaluation and
cleared with UDC. Excavated material shall be used for backfilling providing it passes required
tests. Unsuitable material shall be removed when encountered and replaced by suitable one.
Permanent works blinding concrete membrane or such other protection as specified on the
drawings shall be placed, by our concrete subcontractor, following completion of excavation and
compaction works, clearing the soil tests with DAR and as soon as it is practical .All precedent
worksistobeexecutedtoDARsatisfaction.
Dewatering
Dewateringshallbedoneviasubmersiblepumpsinwellsdistributedaroundtheperimeterofthe
excavation.Waterwillbepumpedtothenearbysea.ThepumpsshallbefedfromtwoElectrical
sourcesforredundancy.DewateringshallbesubcontractedtoaProfessionalSpecialist.
WaterProofing
WaterproofingshallbedonebyaProfessionalSpecialistsubcontractorusingMaterialapprovedby
DAR. The water proofing activities are mainly in the Foundation stage, wherever the concrete
touchessurroundingsoilandontheroofwherewehavetheCoolingTowers.
RaftFoundations&BuildingConcreteworks
Thebuildingshallbedividedinto4Areas.Areasareseparatedbyconstructionjointsandtherefore
canfollowdifferentscheduleofworksoncetheyreachthesuperstructurelevels.
Concrete works shall be executed by an approved Concrete Subcontractor. For civil method
statementlist,refertoAppendix7
AQA/QCprocedurecoveringalltheactivitiesrelatedtotheconcreteworksshallbesubmittedto
DAR for approval. The latter provide for all the sampling and testing activities carried out in the
field and/or in the laboratory. Sources of material i.e. suppliers/manufacturers and material to be
used shall be in prior approved by DAR including working methods and delivery conditions.
Transport,transportmeans,protection,delivery,storageandcertificationofcementshallbedonein
accordancewithspecificationsandapprovedproceduresandtothesatisfactionofDAR.
A bar bending schedule shall be submitted to DAR for approval. The number, size, form and
positionofallsteelreinforcingbars,ties,links,stirrupsandotherpartsofthereinforcementareto
be in accordance with the drawings and kept in the correct position in the forms without
displacement during the process of vibrating, tamping and ramming the concrete in place. The
approved spacers shall be used during the process. The concrete cover shall not exceed tolerance
unlessparticularlyotherwisespecified.
- 13 -
Q06024-IDCP-PLN-GT-001-REV A
Duringthepreviouslydetailedactivities,inspectionandtestsshallbeconductedasrequiredinthe
specificationsandtoDARsatisfaction.Recordsshallbegenerated,maintainedandkeptforallthe
duration of the process. Concrete shall be placed in the positions and sequences indicated on the
drawingsorinthespecifications.
Raft foundations shall be constructed first, after watering proofing and screeding works is done.
Different Rafts sizes will be constructed for different areas. Sizes will be calculated depending on
loads in various floors and equipment vibrations. Method statements shall be submitted for large
pouringareas.
Backfilling will be made on top of the raft foundations to bring the construction to the required
levels,priortoproceedingwiththedifferentfloorplans.
Two large Tower cranes will be erected to cover most of the building area and adjacent steel
workshop.MobilecraneswillbeusedtocovertheminorareasunreachablebyTowerCranes.
Theworksequencewillfollowourscheduleofworksinordertomatchthedeliveryandinstallation
scheduleofmainequipment.
For all concrete works, ordinary or Medium Sulfate Portland cement shall be used. Concrete
surfacesadjacenttosoilshallbecoveredbybituminouspaint.Slumpcontrolshallbeexecutedand
samples shall be taken for strength control during the placing of concrete. Concrete will be
compactedwiththeuseofavibrator.Afterwards,thenecessarycuringwillbedone.
Foundation, column and concrete wall Formwork shall be made of conventional wooden or steel
formwork. Formworks shall be prepared for concrete placing after the control of axes, elevation,
alignment and the necessary strengthening have been carried out. All formwork systems shall be
strengthenedbyscaffoldingsandworkingplatforms.Theclient/PMCshallapprovethecompleted
works.
PrecastConcreteworks
Precast hollow core panels and beams will be subcontracted to a specialist company, following
approvalbyDAR.Thiscompanyshallsupplyanderecttheprecastitemswiththeassistanceofthe
Concrete Subcontractors and CAT. Some of the works will be erected by the large Tower Cranes
andtherestwithlongreach,properlysizedMobileCranes
ConcreteworksshallbeexecutedbyanapprovedConcreteSubcontractor.
- 14 -
Q06024-IDCP-PLN-GT-001-REV A
A QA/QC procedure covering all the activities related to the precast concrete works shall be
submittedtoDARforapproval.
EquipmentFoundations
Once Material is approved and shop drawings produced and approved, Major Equipment
foundations shall be designed, coordinated with concrete works and constructed on site in
accordancewithManufacturerrecommendations.
FinishingWorks
All Sundry and finishing works shall be executed by C.A.T and by different approved
SubcontractorsinaccordancewithapprovedfinishingschedulesandMaterial.
SelectionofFinishingMaterialwillbebasedontherequirementsoftheAcousticStudythatcaters
for the noise requirement of the Project and with the Aesthetic requirements of the specifications
detailedinourAlternativeNo.2.
EquipmentWorks
Once the major Equipment and Material are approved, manufacturer shop drawings will be
coordinated and integrated into the Shop Drawings. C.A.T. shall also prepare the necessary
procedures/methodstatementsforthemechanicalmaterialandequipmentinstallation,priortoany
Installation.(SeeAppendix8forMechanicalMethodStatementlist).
For the major equipments to be erected by C.A.T. the work is to be executed under the direct
supervision of the supplier representative when required and in accordance with provided
instructions and manuals. All necessary measures shall be taken to protect and preserve the
suppliedequipment.
C.A.Tshallexecutetheworkswithallnecessarysafetyandsecurityprecautions.
Having the concrete foundations properly cured, brushhammered and shimmed to the right
elevation, the chillers, RO equipment, and other mechanical equipment shall be installed as per
approvedmethodstatementsontherespectivefoundationsleveledandproperlycentered.
For pumps, preliminary alignment shall be carried out before grouting. All equipment shall be
installedasperQC/DARrequirementsandvendorsspecificationsandrecommendations.
Special Platform on rail/track system will be manufactured in our workshop to bring the chillers,
pumps and other equipment into the building and right to the location where they should be
installed.Hydraulicjacks,telehandlersandspecialtoolswillbeusedtomaneuverinsidetheplant
building. Equipment on the first floor can be brought in via external platforms with the help of a
craneorfromtheinsideinthegroundfloorwiththeuseofelectricalhoists.Equipmentontheroof
willbeinstalledusingthetowercranesortelescopicexternalmobilecranes.CoolingTowersshall
- 15 -
Q06024-IDCP-PLN-GT-001-REV A
beassembledbythemanufacturer.AllMajorEquipmentshallbestarted,testedandcommissioned
bythemanufacturers.
PipingWorks
ShopDrawingsforpipingfabricationanderectionwillbepreparedandutilizedinthefabrication
shop for preparing spools, ready to be erected. All works shall be carried out in line with above.
Pipingerectionshallcommencewhenbuildingisready.
FabricationandErection
Pipefabricationworkshallstartinthefabricationshopinthedesignatedareaonsite.
AnN.D.T.subcontractorwillbecarryingouttherequiredN.D.T.forC.S.weldsasperspecifications
doneinthefabricationshopsothatanyrepairsarecarriedoutbeforetransportingthespoolstosite.
Prior to fabrication, field checks shall be carried out to ensure that the shop drawings are
compatiblewiththesiteconditions.
Copies of the shop drawings used by the fabrication crews shall be given to the erection crews.
Thesecopiesshallshowthenumbersassignedtotheweldingjointsandshallindicatewhichjoints
werealreadytestedinthefabricationshop.Thisshallenablethesitecrewstocorrectlyidentifyand
mark the welds performed on site. This shall ensure proper reporting and assist the N.D.T.
crews/QCInspectorstoattendandcontrolallthefieldwelds.
TheQA/QCofficeralongwiththeforemanresponsibleforthefabricationwillensurethatallwelds
on the drawings are clearly marked to distinguish the fabrication welds from the field welds. A
record of every day welds and N.D.T. will kept. Once fabrication, welding of the spools are
complete, the spools shall be transported to site for erection. All the spools to be tagged properly
priortotransportationtosite.
Allerectionworksshallbeinaccordancewiththedrawingsandspecifications.
The fabricated spools shall be transported to their designated area one day ahead of the start of
erectiontoavoidanycongestionintheexistingfacilities.
Oncethespoolsbelongingtothesystemareallerected,connectedtotherestoferectedpipesand
checked,thesystemwillbepunchedoutbyustoensurethatinstallationwascarriedoutasperthe
drawings,fieldsupportsareallinposition.
Oncesatisfied,allrelevantpaperworkwillbesubmittedtoDARandarequesttostarthydrostatic
testingwillbeputin.
- 16 -
Q06024-IDCP-PLN-GT-001-REV A
Electrical&InstrumentationWorks
Upon design approval and in accordance with material specifications, manufacturer and supplier
will be submitted to Client for approval, orders will be placed upon suppliers and weekly status
reportswillberequestedtoensuretimelydeliverytosite.
Transformers,switchboards,lightfixturesandfloodlightswillallbeinstalledaspermanufacturers
recommendations.Vendorsrepresentativeswillconductthecommissioningoftheswitchgearsand
thetransformers.(SeeAppendix9forElectricalMethodStatementlist).
AllElectricalSwitchgearsandMCCswillbedeliveredinsectionsandassembledonsitebyC.A.T.
except for the 3.3 KV Switchgears and Soft Starters which shall be assembled by the
Manufacturer/Supplier.
Supervision of installation, checking of Bus Bars jointing, Testing and Commissioning will be
performedbythemanufacturer.
AllTransformerswillbedeliveredandinstalledonsitebyC.A.T.
Supervisionofinstallation,TestingandCommissioningwillbeperformedbythemanufacturer.
All raceways, cables, lighting, electrical accessories, lo current systems will be delivered and
installedonsitebyC.A.T.
Cable terminations will be made by C.A.T. except for 11 KV cables which shall be made by
approvedandlicensedsubcontractor.
Supervisionofinstallation,TestingandCommissioningofLoCurrentsystemswillbeperformedby
theSuppliers.
All electrical cables shall be laid according to the cable schedules and adhering to the following
steps:
Prior to cable installation, a cable cutting schedule detailing the cable number, type, size, length,
and cable drum number shall be established to avoid and minimize any wastage as much as
possible.Thesaidschedulesshallbebasedonthefollowingdata:
Actualindividualcablelength.
Cablelengthonthedrum
Placeoninstallationtominimizedoublehandling
Cable drums shall be transported to their respective site. Actual length of the cable shall be
measuredonsiteandarecordofeachcablenumbertypeandlengthshallbemade.
All distribution boards (lighting, small power), Push button Control station, and marshalling box
will be connected in accordance with Electrical Installation Specification, attached schedules and
- 17 -
Q06024-IDCP-PLN-GT-001-REV A
drawings.Alllightningandgroundingshallbedoneasperspecificationandwithrelevancetothe
applicabledrawings.
Electrical systems will be tested as per relevant test procedures that will be submitted during the
courseoftheproject.
InstrumentationandControlSubcontractorwillinstallallControlsandInstrumentationasperhis
approvedMethodStatement.HeshallalsoinstallandterminatetheinstrumentcablesasperC.A.T.
MethodStatement.
Absolutelynoprecommissioningshallstartuntilthegroundingsystemiscompletedandtested.
Landscape,Roads,CurbstoneandSidewalksWorks
OncethebuildingiserectedandmainEquipmentinstalledandtheneedforlargemobilecranesis
over,theaboveworkshallstart,notingthatthefinal areatobelandscaped issubjecttoQC/UDC
approval.
4.4 ConstructionoftheHEXBuilding&ETSs
ConstructionofallHeatExchangersbuildingsandETSswillbesimilartomethodologytotheonce
oftheplant.
Closecoordinationwillbemadewithothercontractors,viaDAR,inordertopossesssitesofHEXs
andtocoordinateworksforETSs.
4.5 Calibration
Qualified technicians will be utilized to carry out the calibration of the instruments. Records
documenting the calibration will be kept in our Document Control Department. All instruments
usedforcalibrationshallbecertifiedbyaThirdparty.Ateamshallbeassignedtoremovetheskid
mountedinstrumentsandtheirreinstallationalongwiththefieldinstruments.
Dedicatedinstrumentfitterswillberesponsiblefortheinstallationofthetubingonsiteunderthe
supervisionoftheinstrumentandinstrumentsupervisor.Thefitterswillproceedwiththetestingof
thetubingaftercompletiontheinstallation.
After complete installation of the tubing, instruments, instrument cables and all required testing,
loopcheckingshallstartaccordingtoloopsheetspreviouslypreparedbytheinstrumentengineer
andapprovedbytheClient.
- 18 -
Q06024-IDCP-PLN-GT-001-REV A
4.6 TestingandPreCommissioning
During the construction phase the QA/QC engineer along with the discipline engineers shall be
responsible for maintaining the quality and ensuring that the supervisors are carrying out the
installationasperthedrawingsandspecifications.
Theinspectionfacilitiesutilizedonthisprojectshallinclude:
Hydrostatictesting
Ascheduleshallbemadeandsubmittedtotheclientapproval.Thisscheduleshallindicatethedate
andthelocationinthefieldoftheproposedhydrotest.Pipeflushingandcleaningtobeincluded.
LoopChecking
The loop sheets shall be prepared and submitted to the client for approval. A schedule of loop
checkingshallbemadeandagreedwiththeclienttoavoidanydisruptionsandensurethesmooth
continuityofwork.
Testingandinspectionprocedures
Detailedtestingandinspectionproceduresshallbepreparedatthebeginningoftheproject.These
proceduresshallcoveralltheaspectsoftheworksandbeimplementedthroughouttheexecutionof
theproject.
Oneverysuccessfultestcompletion,resultsshallbetranscribedontoformats,copiesofwhichshall
besubmittedtothecompanyfortheirrecords.
4.7 Commissioning
C.A.T.isconsideringemployingasubcontractorfortheTestingandcommissioningactivities.This
subcontractor shall check the design drawings at the design stage. Commissioning will be
performedfollowingonapprovedMethodStatementwhichshallbesubmittedduringthecourseof
theprojectprovidingelectricityandotherservicesareavailable.
4.8Training
C.A.T.throughitssubcontractorsandsupplierswillprovidetrainingservicesforQCpersonnelas
specifiedinourproposal.Thetrainingprogramwillbesetupformanagers,supervisors,operators
andmaintenancepersonnel.
- 19 -
Q06024-IDCP-PLN-GT-001-REV A
A full program will be developed in detail and in close cooperation with QC. Such a service is
considered one of the most important steps for a successful execution of the project including
commissioningandmaintenance.
TheforeseenTrainingAidsarebutnotlimitedto:
TrainingManual,preparedforthisspecificpurpose.
OperationManual.
MaintenanceManual.
SafetyManual.
5. QualityAssurance(QA)
We confirm that all QC requirements and recommendations shall be adhered to and put into
application. The QA Plan for IDCP has been issued to meet the Employer and C.A.T. QA system
requirements.
6. Health,SafetyandEnvironment(HSE)
C.A.T. ensures that all construction employees are aware of and adhere to all safety rules and
regulations.C.A.T.ensuresthepromotionofsafety,health,andenvironmentprotectionasamutual
objective for management and employees at all levels, including subcontractors. We will give
detailedsafetyandsecurityinstructionstoeachsubcontractorpriortothecommencementofwork
andduringtheconstructionperiod.
We confirm that all QC requirements and recommendations shall be adhered to and put into
application.TheHSEPlanforIDCPhasbeenissuedtomeettheEmployerandC.A.T.requirements.
ListofAppendixes:
Appendix1PROJECTCHART
Appendix2ORGANIZATIONCHART
Appendix3LONGLEADITEMSLIST
Appendix4PROJECTKEYMILESTONE
Appendix5TEMPORARYFACILITIES
Appendix6LISTOFSUBCONTRACTORS
Appendix7CIVILMETHODSTATEMENTLIST
Appendix8MECHANICALMETHODSTATEMENTLIST
Appendix9E&IMETHODSTATEMENTLIST
Appendix10DESIGNINTENTREPORT
- 20 -
APPENDIX 1
PROJECT CHART
RELATIONS:
FORMAL AUTHORITY / COMMUNICATIONS / REPORTING
EMPLOYER
QATAR COOL
CONTRACTOR
C.A.T.
INTERNATIONAL
QATAR W.L.L
DESIGN TEAM
PMC
STANLEY
DAR AL CONSULTANTS
HANDASAH INC.
APPENDIX 2
ORGANIZATION CHART
C.A.T. H.O
Qatar Cool
C.O.O
N.El- Saadi
M. El Hajjar
Qatar Area
PMC - DAR
Manager
K. Salman
M. Matar
Project Manager
Nazih Ghazi
AREA PROC.
Expedition / IT Project Contract Sr. Planning UNIT
Admin Coord. Eng. Eng.
R. Geryes Mohan M.G. F. Bustani N.A. Nahed
Cost Eng /
Doc. Control QS Plann Eng
D. Ramos G. Gobatan C. Ashkouti
Deepak E.P. D. Dahwan
Deputy PM -
Cons. Mngr
M,E&I Cons. Mngr. Civil
P. Natrajan
N. Saba
Cons. Mang.
Sr. ELEC. Eng. Sr. Eng. Coord. QA/QC Eng. Sr. Safety Eng. Admin. Mngr.
Mech.
F. Takieddine D. Mankikis
Z.Nazzal
R. Prasad (**) (*) R. Seyouri M. Saadeh
Campboss
N. Asaad
J. Lukose
Wages Clerk
A. Kannan
K. Lal
Acc. Clerk
J. Khan
Time Keeper
A. Majeed
A. Jackson
M. Ahmed
S. Riyas
C.A.T. International Qatar W.L.L proposes to subcontract parts of the works and to
supply principal items of the plants as follows:
Note: the above names are only for reference. Other Subcontractors will
be submitted as applicable. Selection will be based on Compliance to
specifications and Milestones
APPENDIX 7
ME Equipment Reference No
1 Rigging ,installation and pipe connection of chillers Q06024-IDCP-MOS-ME-001
2 Rigging , erection and pipe connection of cooling towers Q06024-IDCP-MOS-ME-002
3 Rigging , installation and pipe connection of chilled water pumps Q06024-IDCP-MOS-ME-003
4 Rigging , installation and connection of condenser water vertical turbine pumps Q06024-IDCP-MOS-ME-004
5 Rigging ,installation and connection of plate heat exchangers Q06024-IDCP-MOS-ME-005
6 Installation and connection of tertiary pumps Q06024-IDCP-MOS-ME-006
7 Rigging , installation and connection of expansion tanks Q06024-IDCP-MOS-ME-007
8 Installation and connection of pressurization units Q06024-IDCP-MOS-ME-008
9 Installation and connection of in line centrifugal solid separators on first floor Q06024-IDCP-MOS-ME-009
10 Installation and connection of refrigerant silencers on roof Q06024-IDCP-MOS-ME-010
11 Installation of condenser tube cleaning system including 4 way valves Q06024-IDCP-MOS-ME-011
Valves Reference No
12 Installation of sluice gate valves in cooling tower basins Q06024-IDCP-MOS-ME-012
13 Installation of process valves Q06024-IDCP-MOS-ME-013
RO System Reference No
14 Rigging , installation and pipe connection of RO system Q06024-IDCP-MOS-ME-014
15 Installation and connection of transfer pumps Q06024-IDCP-MOS-ME-015
Common to all Systems Reference No
Installation of inserts (pipe connections) in concrete tanks and cooling tower
16 Q06024-IDCP-MOS-ME-016
basins
17 Installation of Overhead cranes Q06024-IDCP-MOS-ME-017
18 Tagging and labelling of pipe,duct and equipment Q06024-IDCP-MOS-ME-018
19 Installation of Antivortex fittings in concrete tanks Q06024-IDCP-MOS-ME-019
20 Pipe handling and storage Q06024-IDCP-MOS-ME-020
21 Installation of process ,HVAC and domestic water pipes Q06024-IDCP-MOS-ME-021
22 Insulation of Process , HVAC and domestic water pipes Q06024-IDCP-MOS-ME-022
23 Jacketing of pipes Q06024-IDCP-MOS-ME-023
24 Fabrication and installation of pipe supports Q06024-IDCP-MOS-ME-024
25 Painting of pipes and supports Q06024-IDCP-MOS-ME-025
26 Hydrotesting of pipes Q06024-IDCP-MOS-ME-026
27 Installation and connection of diesel tanks Q06024-IDCP-MOS-ME-027
28 Introducing new equipment into the system at different stages Q06024-IDCP-MOS-ME-028
Welding and Soldering Reference No
29 SMAW Welding Q06024-IDCP-MOS-ME-029
30 Installation and soldering of copper pipes Q06024-IDCP-MOS-ME-030
Drainage and Plumbing Reference No
1 Installation and pipe connection of electric water heaters ( admin part ) Q06024-IDCP-MOS-PL-001
2 Installation of cast iron storm water and drainage pipes . Q06024-IDCP-MOS-PL-002
3 Installation of frames for drainge gratings and manhole covers Q06024-IDCP-MOS-PL-003
4 Installation of floor drains , roof drains and flower bed drains Q06024-IDCP-MOS-PL-004
5 Installation of sanitary fixtures , toilet mixers and accessories ( admin part ) Q06024-IDCP-MOS-PL-005
6 Installation of oil interceptors Q06024-IDCP-MOS-PL-006
7 Installation and pipe connection of submersible pumps in basement Q06024-IDCP-MOS-PL-007
Fire Fighting Systems Reference No
Rigging , Installation and connection of fire pump room equipment and
1 Q06024-IDCP-MOS-FP-001
components
2 Installation of preaction ,deluge , alarm zone valves and siamese connections Q06024-IDCP-MOS-FP-002
3 Installation of fire hose cabinets Q06024-IDCP-MOS-FP-003
4 Installation of fire fighting grooved pipes and fittings ( vertical and horizontal ) Q06024-IDCP-MOS-FP-004
5 Installation of diesel pump exhaust with supports up to roof Q06024-IDCP-MOS-FP-005
6 Installation of FM-200 fire fighting system Q06024-IDCP-MOS-FP-006
Chemical Treatment Reference No
1 Installation of chemical treatment systems Q06024-IDCP-MOS-WTR-001
2 Chemical cleaning of pipes Q06024-IDCP-MOS-WTR-002
HVAC Reference No
1 Rigging , installation and pipe connection of Air handling units Q06024-IDCP-MOS-AC-001
2 Installation and pipe connection of fan coil units Q06024-IDCP-MOS-AC-002
3 Installation and duct connection of fresh and exhaust fans Q06024-IDCP-MOS-AC-003
4 Galvanised duct and accessories fabrication and installation Q06024-IDCP-MOS-AC-004
5 Internal and external Insulation of galvanised sheet metal duct Q06024-IDCP-MOS-AC-005
6 Jacketing of galvanised sheet metal duct Q06024-IDCP-MOS-AC-006
7 Installation of grilles , diffusers , louvers ,dampers sand trap louvers Q06024-IDCP-MOS-AC-007
APPENDIX 9
FINAL REPORT
September 2006
Q06024-IDCP-RPT-GT-001-REV 3
Table of Contents
Project Description
The Pearl, Qatar is a 400 hectare man-made island located off the Eastern coast of Qatar
approximately 20 kilometers north of the Doha central business district and east of the West Bay
Lagoon. The Pearl Island is connected to the mainland by a causeway. This island is being
developed (United Development Company) to include residential and commercial usage arranged
around three primary marinas, including hotels, shops, and residential villas and apartments.
The roads and infrastructure for The Pearl Island development were completed under a separate
contract to support the entire island. The road work consists of roads, bridges, underpass,
culverts, surface water drainage, signage, and roadway lighting. The infrastructure work consists
of potable water, sanitary sewer, irrigation transmission, chilled water distribution,
telecommunications civil work, and electrical distribution.
Chilled water has been a primary medium for the transfer of heat from building coils to the
refrigeration system since the beginning of heating, ventilating, and air-conditioning design.
Providing chilled water from a centrally located plant is an energy efficient and low maintenance
means of rejecting heat from air-conditioning systems across a localized campus, whether that
campus is a university setting, industrial complex, or large urban site. Over the last five years or
more, district energy has exploded on to the scene in the Middle East becoming a necessary
utility for new developments.
The Integrated District Cooling Plant (IDCP) at The Pearl Project includes a new central chilled
water plant to serve the cooling needs for the proposed building construction on the island. Qatar
Cool will own and operate this plant upon completion and have established a design-build
The chilled water generated at this facility will be provided for the following:
Customer loads at energy transfer stations or heat exchangers.
Customer loads at valve pits (Take-off Chambers).
Plant cooling system including, air handling units and fan coil units.
The IDCP is arranged on site to accommodate the construction of the buildings and the island
roads and infrastructure and the plant will architecturally be tied into the aesthetics of the
surrounding building structures. The plant will have a guaranteed capacity of 115,000 tons
expandable to 120,000 tons (ARI Tolerance) using forty-six (23 pairs) 2,500-ton nominal electric
motor-driven centrifugal chillers. Provisions will be incorporated into the design of the IDCP for
future expansion using two 2,500-ton nominal electric motor-driven chillers. The chillers will be
in a series-series, counter flow arrangement utilizing a direct primary pumping scheme.
The heat picked up by the chiller refrigeration cycles will be rejected via twenty-four 5,000-ton
cooling tower cells. Each cooling tower cell will serve up to two chillers and will be piped in a
headered arrangement such that each cell can be used with any combination of chillers. The
cooling towers will be constructed of fiberglass and will be field-erected on the roof of the plant
to conserve space on the site for other use. Aesthetic enhancements to the new building will
visually compliment the architecture of the area per UDC approval.
Utilities serving the IDCP will be installed by the Infrastructure Contractor under a separate
contract with the Owner. The chilled water distribution system will routed to a vault at the limits
of the plant site as depicted in the Conceptual Design Drawings.
The plant will hydraulically operate as two independent facilities; each connected to new
underground chilled water distribution systems. Chilled water will be delivered to network
through a constant flow, direct primary pumping scheme. The Pearl Chilled Water Distribution
System will be a looped, underground distribution network served by the IDCP and installed
under a separate infrastructure contract as described above.
New high-voltage transformers will be provided by the infrastructure contractor and connected to
the IDCP to serve the power requirements of the plant.
The control system will utilize a SCADA control system for monitoring and operation of the new
equipment, except for the chillers, which will be started locally. This system will allow control of
the new facility from operator workstations, located in the new plant control room. The system
will utilize digital communications for remote monitoring and/or control of the various systems
within the plant.
General
This section of the Design Intent Report includes the narrative description of the Civil
Engineering and Landscape Site Planning for the Integrated District Cooling Plant (IDCP) at The
Pearl, Qatar. Site survey data obtained during the course of this project will form the basis for the
development of the grading and paving design. Discussions between the Owner, Qatar Cool,
PMC, the Contractor, C.A.T. International (CAT), and the Design-Build Engineer, Stanley
Consultants are detailed in Exhibit A Project Correspondence.
Compliance Statement
The Civil Engineering and Landscape Site Planning design will comply with all portions of the
Tender Documents prepared for Qatar Cool and issued by DAR during the tender phase. These
documents include the general requirements, tender specifications, tender drawings, and the
appropriate addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Site Layout: The latest revisions to the U-07 plot limits will form the basis of the site
layout and grading and paving design.
Access Road Width: Service access roads around the plant will be wider than 6 meters at
areas designated for equipment installation and removal from the plant building as
indicated in Section Q0547/a-SPC-TR-01 REV 1 of the Tender Specifications. Paved
equipment staging areas will be provided at these locations to facilitate those operations.
Paving
A new service access drive will be provided to the site from the north and will serve the normal
operational traffic of the IDCP as well as to support maintenance and delivery activities for the
plant.
All paving will conform to local codes and standards as well as Section 6 of QCS 2002.
Drainage
The drainage collection system will run along the roads surrounding the site and will consist of
storm sewer piping, manholes, gullies, and swails. Storm water run-off will be collected by the
gullies and swails. Manholes will be placed not more than 75 meters apart and will be used for
inspection of the storm water system.
Landscaping
The soft landscape at ground level will use tree groups in stone mulch (10-cm crushed stone
mulch to cover all unplanted and unpaved areas), towards the plot boundaries, providing framed
views of the building, with ground cover and shrubs closer to the building, screening the service
ring road and providing the first tier of planting to the building. Trees should be of a single,
spreading, flowering variety, shrub to comprise a single type of ornamental grass such as
Pennisetum alopecuroides, and ground cover of a spreading flowering succulent variety. The
same ground cover and ornamental grass shall be used to the planter behind the battered ground
floor parapet wall. All planting for the project will be appropriate to the exposed seashore
conditions of the site and island. Trees to be minimum 250-cm overall height, shrubs and
ornamental grasses grown.
The IDCP building will include planters as required to meet the agreed upon architectural
appearance of the plant relative the surrounding area.
General
This section of the Design Intent Report includes the narrative description of the architectural
design for the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar. Discussions between
the Owner, Qatar Cool, PMC, the Contractor, C.A.T. International (CAT), and the Design-Build
Engineer, Stanley Consultants are detailed in Exhibit A Project Correspondence.
The IDCP will be designed as an attractive, functional, building that acknowledges and expresses
the buildings purpose. The new building and cooling towers should be considerate of the
appearance, scale, and other features of the surrounding structures and at the same time, minimize
the impact of the building on the surrounding visual and aesthetic environment, as well as provide
for future horizontal expansion.
Compliance Statement
The Architectural design will comply with all portions of the Tender Documents prepared for
Qatar Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, room data sheets, tender drawings, and the appropriate
addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Building Exterior
The design must consider the buildings physical and visual impact on the site and its relative
scale to surrounding structures.
There are three main components to the proposed building; the operational plant, the cooling
towers and the Administration Building.
There are two rows consisting of 12 cooling towers each that sit on top of the operational plant.
The Administration Building is a three floor building; ground, mezzanine and first.
The exterior is concrete structure and blockwork with grooved plaster and paint finish, in addition
to powder coated aluminum louvers at the transformers areas, the Administration Building will
have powder coated aluminum curtain walls and windows to allow natural light to filter into the
building.
A service elevator rated at 1-ton lifting capacity will provide vertical access between the ground,
mezzanine and first floors of the Administration Building.
The roof of the operational plant will be accessible by three individual stair towers.
Four cranes will be provided at the ground floor of the operational plant to allow handling spare
parts and maintenance of the chillers and pumps.
One crane will be provided at the roof floor of the operational plant to allow handling spare parts
and maintenance of the cooling basin pumps.
Access opening (6000 x 3000 cm) will be provided in the center of the operational plant to handle
equipment from the ground floor to the first and roof floors.
Access hatches will be provided to handle the generators and pumps to the basement.
Containment Requirements
Electrical areas containing oil-filled transformers will be designed with passive containment
provisions as required by the National Electrical Code and Stormwater Pollution Prevention Plan
to prevent the accidental release of oil and to facilitate clean up and removal of spilled oil.
Occupancy
The plant will be occupied 24 hours per day.
The floor, walls, and ceiling of the operational and storage areas are all concrete. The floors have
a transparent sealer. The walls and ceilings are painted for better light.
The lab and control room will have resilient tile. The lab has epoxy resin worktops with integral
sinks.
Life safety features include an automatic sprinkler system and a fire alarm system.
General
This section of the Design Intent Report includes the narrative description of the structural
systems for the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar. Discussions
between the Owner, Qatar Cool, PMC, the Contractor, C.A.T. International (CAT), and the
Design-Build Engineer, Stanley Consultants are detailed in Exhibit A Project Correspondence.
This section includes the design criteria, subsurface conditions, foundations, building basement
walls, concrete slabs on grade, operating floor over basement, and interior walls within the IDCP.
Two expansion joints will be provided for the operational plant building and one expansion joint
will be provided between the operational plant building and the support space building.
Compliance Statement
The Structural design will comply with all portions of the Tender Documents prepared for Qatar
Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, room data sheets, tender drawings, and the appropriate
addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Design Criteria
Codes and Standards
The following codes and standards will be used in conjunction with the structural design:
BS6399: Code for Loading for Buildings
BS8110: Structural use of Concrete
Design Loads
The Uniform Building Code (UBC) 1997 Edition, with the following criteria:
Codes: BS 6399: Part 1 for dead and imposed loads CP3 Chapter V, Part 2, for wind
loads, UBC for seismic loads.
Dead Loads:
- Concrete Unit Wt. = 24.00 KN/m3
- Floor Covering (Typical Floors) = 2.00 KN/m2
- Partition Loads (Typical Floors) = 2.50 KN/m2 for block work and 1.00 KN/m2 for
Gypsum Partition.
- Floor Covering (Roof) = 2.50 KN/m2
Live Loads: The live loads will be based upon the following:
- Equipment Weight: Location and magnitude of loads will be coordinated with the
mechanical design.
- Pipe Support Loads: Location and magnitude of loads will be coordinated with the
mechanical design.
- Cooling Tower Weight: Location and magnitude of loads will be coordinated with
the mechanical design. These loads will include the basin water weight on roof
slab.
- Water Tanks: Location and magnitude of loads will be coordinated with the
mechanical design.
Wind Loads: The wind load will be based upon a basic wind speed of 45 mps.
Seismic Loads = Zone 2A Seismic Risk
Load Combinations:
- 1.40 x D.L. + 1.60 x Live loads
- 1.40 x D.L. + 1.60 x Lateral Loads
- 1.20 x D.L. + 1.20 x L.L + 1.20 x Lateral Loads
Foundations:
- Foundations will be shallow foundations of raft type.
- The IDCP will have two levels for the raft foundation. The first will be under the
basement floor on rock and the second will be divided into two parts on another raft
foundation:
The foundation type and its design parameters will be finalized as per the recommendations
of the geotechnical report.
Material Properties
Concrete of Characteristic Strength for Columns = 75 N/mm2, for Beams = 50 N/mm2,
for Other Elements = 40 N/mm2
Steel Reinforcements of Characteristics Yield Stress = 460 N/mm2
Concrete Design
Design shall be in accordance with BS 8110: Structural Use of Concrete.
Material
Concrete:
The classes of concrete are indicated below and reflect the 28 days cube strength, Fc.
Cement:
Ordinary Portland Cement (OPC) will be used for superstructure and moderate
Sulphate Resisting Cement (SRC) Type II will be used for structural elements in
contact with the soil.
Reinforcement:
All reinforcement will be deformed high tensile hot rolled steel having a minimum
yield strength (fy) equal to 460 Mpa and will conform to BS4449.
Structural System
The structural concept is driven by functional, economical and efficiency considerations. The
systems adopted will be chosen to fulfill the specific architectural and functional
requirements as well as proper manipulation of the assigned areas.
General
This section of the Design Intent Report includes the narrative description of the chilled water
plant process, heating, ventilating, air-conditioning, plumbing, and fire suppression systems for
the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar. Discussions between the
Owner, Qatar Cool, PMC, the Contractor, C.A.T. International (CAT), and the Design-Build
Engineer, Stanley Consultants are detailed in Exhibit A Project Correspondence.
Compliance Statement
The Mechanical design will comply with all portions of the Tender Documents prepared for Qatar
Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, room data sheets, tender drawings, and the appropriate
addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Thermal Storage: Thermal storage was eliminated from the project with Alternate 2 bid
proposed by CAT and accepted by Qatar Cool.
Number of Chillers: Thermal storage was removed with the Alternate 2 bid proposed by
CAT and accepted by Qatar Cool. To make up the difference in capacity the number of
chillers was increased over what was shown on the Tender Drawings and listed in
Section 60, Paragraph 15.1.4.2.b of the Tender Specifications.
Chiller Arrangement: The chillers will be arranged in pairs using a series-series, counter-
flow arrangement instead of the series-parallel counter-flow arrangement indicated on the
Tender Drawings and Section 9, Paragraph1.1.17.1 of the Tender Specifications.
Chilled Water Strainers: The Tender Specifications (Section 60, Paragraph 14.2.4.2)
indicate that basket strainers are to be provided for the chilled water system. However,
the vertical dimensions of the basket strainers are not conducive to making the equipment
connections. Stanley Consultants recommends using Tee Strainers in lieu of the basket
type to resolve this conflict. The tee strainers will be in compliance with the performance
requirements of the basket strainers as specified (i.e. 5/32 perforations).
Chilled Water Plant Process
Codes and Standards
The chilled water system, equipment, and components will be designed in accordance with
the applicable industry standards and shall conform to the provisions of the latest issue of
applicable U.S.A. codes and standards including but not limited to the following:
Uniform Building Code (UBC)
Uniform Mechanical Code
National Fire Protection Agency Codes and Standards (NFPA) or local equivalent
American Society of Heating, Refrigeration and Air-Conditioning Engineers
(ASHRAE)
American Society of Mechanical Engineers (ASME)
American Society for Testing and Materials (ASTM)
American National Standards Institute/Hydraulic Institute (ANSI/HI) Pump Standards
Applicable Local Codes and Standards
Other standards listed in the Tender Documents
The IDCP is an independent chilled water plant designed for an ultimate capacity of
120,000 tons and an initial capacity of 115,000 tons. The size and number of the chillers
were selected based upon the Alternate 2 Bid proposed by CAT and accepted by Qatar Cool
prior to award of the contract. These discussions resulted in the decision to use 2,500-ton
nominal electric motor-driven centrifugal chillers arranged in pairs using a series-series,
counter-flow configuration. To achieve the initial capacity, the plant will include 23 chiller
pairs arranged as shown on Drawings (Q06024-IDCP-A-101). Provisions will be
incorporated into the design of the IDCP for the future expansion of the plant to its ultimate
capacity using one additional chiller pair. The main equipment and auxiliaries for the IDCP
include:
Chillers Arranged in pairs using a series-series, counter-flow configuration.
Cooling Towers.
Chilled Water Distribution Pumps (Constant Speed).
Condenser Water Pumps (Constant Speed).
Refrigerant Transfer Unit with Pump-Out Receiver.
Reverse Osmosis (R.O.) Equipment (i.e. Salt Water R.O. Units, Brackish Water R.O.
Units, Sand Filters, Pumps, and Tanks).
Continuous Condenser Water Filtration Equipment.
Water Treatment System.
Cooling Tower Blowdown System.
Electrical Switchgear, Transformers, etc. (see Section 6).
Plant Control System (see Section 7).
Chillers
Forty-six (23 pairs) 2,500-ton nominal electric motor-driven centrifugal chillers will be
installed as a part of this project. Chiller pairs will be rated in accordance with ARI 550/590
based upon the specified ARI and zero tolerance performance. In addition, the chillers will
operate without loss of capacity at ambient temperatures as high as 104F. Each chiller will
be factory assembled and tested and located as shown on the Drawings (Q06024-IDCP-A-
101). The chillers will be designed to cool 7,500 gpm (1.5 gpm per ton) of chilled water from
56F to 40F and reject that heat to 11,000 gpm (2.2 gpm per ton) of condenser water. The
design water temperature rise across the condenser will be from 92F to 105F.
In addition, the chillers will be used in a direct-primary (constant speed) pumping scheme
consisting of pumps that are operated in conjunction with the chillers. This will allow the
system to vary the total flow to match the load of the distribution system, but maintain a
constant flow through the chiller evaporator. Refer to Section 7 for Control Systems Design
Statement.
The refrigeration cycle will utilize R-134a or R-123 as its refrigerant and the chiller
components and auxiliaries are as follows:
Refrigerant Condenser
Refrigerant Evaporator
Economizer (As Required)
Compressor
Couplings
Compressor Motors
Auxiliary Motors
Purge System (R-123 Only)
Vacuum Prevention System (R-123 Only)
Compressor Motor Starters
Auxiliary Motor Starters
Control System
Accessories and Associated Piping
Structural Steel Base with Seismic Restraints and Vibration Isolation Devices
The condensers and evaporators will be of horizontal, shell and tube design in a single-pass
configuration. The design will be stamped in accordance with ASME Section VIII.
Shell, tube sheets and supports will be constructed of carbon steel and the tubes of seamless
copper. Tubes will be 3/4-inch OD enhanced bore with integral fins and have a maximum
fouling factor of 0.00025. In addition, the evaporator and condenser pressure drop will not
exceed 15 feet of head loss.
Each chiller condenser will include a tube brush cleaning system that will scour the tubes
clean by reversing the flow through the condenser using automatic control valves as shown in
the piping configuration on the Drawings (Q06024-IDCP-M-I-614).
The water boxes will be of welded, non-marine carbon steel construction with mechanical
coupling grooves suitable for welding or bolted clamp-type coupling. Refrigerant side relief
The compressor will be open or hermetic drive, horizontally-split centrifugal-type, and driven
by an electric motor. Open drive motors will be totally enclosed, water cooled (TEWAC)
type using condenser water at a temperature of 92F.
The chiller will be guaranteed to provide 100 percent of rated capacity for any given pair of
chillers, while not exceeding 0.748 kW per ton of electrical usage. Performance testing will
be conducted in accordance with the latest edition of ARI 550/590.
Cooling Towers
Two, 12-cell, 60,000-ton cooling tower cells will be installed as a part of this project.
Condenser water leaving the chillers enters the tower through the distribution header and is
discharged through nozzles. The water falls through the fill, while air is drawn up to the fan
stack in a counter-flow fashion. Heat is rejected to the air through an evaporative cooling
process. Air is drawn through each cooling tower at a design inlet wet bulb temperature of
87F to provide the required evaporative cooling.
The cooling tower cells will be located on the roof of the plant and designed as an integral
architectural element of the facility. Exterior treatments will blend with the overall
architectural theme of the plant.
The tower cells will be constructed of double wall, FRP using structural shapes of pultruded
fiberglass components having a flame spread rating of less than 25. The tower basin will be
elevated above the roof level to allow for adequate clearance for the condenser water pumps
and will be constructed of concrete.
The fans will be multi-blade propeller type constructed of fiberglass blades and an epoxy
coated, galvanized steel hub. The fan will be electric motor-driven through reduction gears
and a variable frequency drive (VFD). The fan motors will be totally enclosed, fan-cooled
(TEFC) type and located outside of the air stream. The variable speed drive allows for load-
following at the tower as well as reduction in ambient noise during off-peak cooling hours.
The heat transfer medium will be cross-corrugated polyvinyl chloride (PVC). In addition, the
cooling towers will include multi-pass, wave form drift eliminators constructed of PVC and
capable of reducing the cooling tower drift to 0.0005 percent of the condenser water flow
rate.
The cooling tower distribution system and nozzles will provide an even distribution of water
over the fill and be capable of allowing flow reductions down to 50 percent of design flow
without modifications or adjustments. In addition, the pressure drop across a nozzle will not
exceed 2 psid.
The cooling towers will be guaranteed to provide 100 percent of rated capacity at the design
conditions listed above. Performance testing will be conducted by an independent impartial
third party in accordance with the latest edition of CTI Publication ATC-105.
Cooling towers shall not exceed sound pressure level of 50 dBA at 50 meters perpendicular
from tower wall between hours of 8:00 p.m. to 8:00 a.m. by any single cooling tower cell.
The sound pressure levels are in decibels (dB) relative to standard reference pressure of
0.0002 Dynes/sq. cm. Distances listed are from the bottom edge of air inlets facing outward
from the plant. Performance testing will be conducted by an independent impartial third
party in accordance with the latest edition of CTI Code ATC-128.
Make-up water and chemical treatment for the cooling tower water will be added at the basin
of each tower and controlled on a tower-by-tower basis. The chemical injection system will
be designed to allow for even distribution of chemicals within the basin. In addition, three
side stream centrifugal filter separators will be provided for each 12-cell tower for removal of
suspended solids. The side stream filtration system will be based upon a flow rate equal to
10 percent of the total condenser water flow rate. The condenser water will have the
following minimum characteristics:
pH Range: 8.0 to 9.0.
Chlorides (NaCl): <200 ppm.
Sulfate (SO4): <100 ppm.
Sodium Bicarbonate (NaHCO3): Negligible.
Calcium (CACO3): <50 ppm.
Oil or Grease: Negligible.
Cooling tower blowdown will be based upon two to six cycles of concentration depending
upon the operating scenario. The sanitary system will be sized accordingly.
Each chilled water distribution pump serves a dedicated chiller pair and will be sized for
7,500 gpm (16F T), 330 feet of head (estimated), and a maximum motor power of 900 Hp.
The pumps will be motor-driven centrifugal, horizontal split case type with double suction
and single stage features. The casing will be cast or ductile iron as required for the maximum
working pressure. The impeller will be constructed of bronze, fully enclosed, and
dynamically balanced. The pumps will include single, cartridge-type mechanical seals, each
with an API Plan 11 mechanical seal flushing system. Pump motors will be in accordance
with IP 54 and non-overloading throughout the entire pump curve. The pump efficiency will
not be less than 85 percent.
Each condenser water pump serves a dedicated cooling tower and will be sized for
11,000 gpm (13F T), 115 feet of head (estimated), and a maximum motor power of
400 Hp.
The pumps will be motor-driven centrifugal, vertical turbine type. The discharge head
assembly will be constructed of high grade cast iron or fabricated steel and include an ANSI
Class 150 discharge flange. The impeller will be constructed of silicon bronze, enclosed or
semi-open, and dynamically balanced. Pump motors will be in accordance with IP 54 and
non-overloading throughout the entire pump curve. The pump efficiency will not be less than
80 percent.
The piping will be constructed of carbon steel, designed in accordance with the requirements
of ASME B31.1 and shall have a minimum thickness of standard weight pipe, but wall
thickness will be sufficient for the pressure class of the system.
The major chilled water piping headers will be 48-inch diameter and will be located within
trenches. This maintains a clean operating floor and simplifies normal operation and
maintenance functions within the plant. The major condenser water headers will be 60-inch
diameter and are located above the center access aisle. These headers will be supported from
structural steel below that is directly connected to the columns. See Drawing Q06024-IDCP-
MP-100.
The chilled water system is divided into two hydraulically independent loops, each of which
serves the looped network piping system. Two separate pairs of chilled water headers leave
the IDCP and connect independently into the network piping. Each of the two headered
systems will include a bypass line between the supply and return headers with a self-
contained, back-pressure regulating valve. The purpose of this valve is to protect the chilled
water system from over pressurization.
Manual isolation within the system will typically be through the use of butterfly valves in
accordance with Section 60, Paragraph 7.2.5. Wafer-style check valves will be included at
the discharge of each pump. All valves will be rated in accordance with the system design
pressure and temperature.
Pipe supports for the IDCP will be in accordance with Section 60, Part 8 of the Tender
Specifications as well as the applicable MSS Standards.
The chilled water system will be treated for protection against corrosion as a primary
consideration and microbiological growth as a secondary consideration. Corrosion within the
chilled water system will be controlled at 2 mpy maximum. Chemicals will be injected into
the system using suitable sized, skid-mounted dosing pumps.
The condenser water system will be treated for protection against deposition, corrosion, and
microbiological growth. Corrosion within the condenser water system will be controlled at
3 mpy. Microbiological growth will be controlled using biocide and effective bio-dispersant,
as required, to operate at pH above 8.0.
Miscellaneous
In addition to the main equipment and piping, the process is supported by several auxiliary
systems:
A mobile refrigerant transfer unit with pump-out receiver sized for the refrigerant
charge of one chiller when the tank is 80 percent filled with refrigerant at 122F.
Chilled water expansion tanks will be provided on the system to allow for the thermal
expansion and contraction of the water. The pressure at the expansion tanks will be set
based upon maintaining a minimum of 4 psig at the highest elevation within the
system.
Chilled water make-up will be provided from the site potable water service and
connected to the system at the expansion tank location.
Cooling tower make-up water will be provided from a combination of three sources:
- Site Potable Water: 5,000 cubic meters per day (920 gpm).
- Reverse Osmosis (R.O. System): 7,000 cubic meters per day (1,285 gpm).
- Treated Sewage Effluent (TSE): 10,000 cubic meters per day (1,835 gpm).
The R.O. water treatment system will be designed as a complete clean-in-place skid, sufficient to
produce 7,000-cubic meters per day (1,285 gpm) of finished water and will be capable of
continuous operation.
The gulf sea water will be supplied at a nominal salinity of 47,000 mg/l total dissolved solids at a
temperature range of 68F to 97F. The R.O. system product water salinity will be less than
500 mg/l total dissolved solids under all pressure and temperature conditions with a minimum
40 percent recovery of feed water flow.
The ETS plant rooms are located within the buildings they serve, while the HEXs are located in
independent buildings and often serve multiple buildings.
The plate and frame heat exchangers will be in accordance with Section 60, Part 18 of the Tender
Specifications and will be sized to meet the cooling load of the customer to which they serve.
The Project will comply with the international standards usually in practice in the region and
specifically in Qatar. The particular standards and codes are specified each under its related
trade in this report.
The AHUs and FCUs shall have two-way valve control with three-way valve control at the
end of the piping branches to maintain a minimum flow.
The chillers plant floor will be cooled with chilled water fan coil units installed exposed and
controlled as a group with remote sensors that modulate a common three-way valve. Outside
ventilation air for the plant floor will be cooled with a chilled water AHU located in the first
floor. The plant room fresh air AHU shall have an energy recovery system. The AHU shall
have an air to air heat exchange section and an exhaust fan section besides the supply fan
section.
Air conditioning of each office will be achieved with FCUs or small AHUs with ducted air
distribution. Fresh air supply will be extended to each unit through a common fresh air fan
with filter located on the roof of the office block.
In the offices block foul air of bathroom and pantries will be exhausted into adjoining shaft
and pulled up by common exhaust fan. Fire and smoke dampers will be provided at each air
exhaust point into the vertical shaft or when crossing the fire wall to control fire spread.
Electrical rooms shall be air-conditioned with air handling units located in the first floor.
The fresh air and exhaust of the chiller area and the MV rooms will be taken in and
discharged from faade louvers on the first floor level.
The pumps room in the basement shall be air-conditioned by fan coil units.
AHUs shall be interlocked to the fire alarm system such that they shut off upon fire detection
in the relevant spaces. Also, all ducts crossing fire rated zones shall have fire dampers on
them.
Plumbing
Codes and Standards
The plumbing system including potable water, non-potable water, sanitary waste, and storm
sewer will be designed in accordance with the applicable industry standards and shall
conform to the provisions of the latest issue of applicable U.S.A. codes and standards
including but not limited to the following:
Uniform Building Code (UBC)
Uniform Plumbing Code (UPC)
American Society of Plumbing Engineers (ASPE)
The building shall be supplied from the municipality, from sea water pumping station and
from a TSE plant.
Concrete tanks shall be provided in the basement level of the building for water storage. One
tank shall be used for fire water storage and one for raw water storage and a third for
permeate water storage. A pumping room in the basement shall accommodate the fire and
water pumps.
The offices toilets and services shall be supplied by gravity from polyethylene tanks located
on the roof above them. The tanks shall be supplied from the municipality water.
A booster set for the building services and hose bibs shall be used in the basement pump
room.
The municipality water shall supply the fire tank and the offices tanks and the cooling towers
sumps.
Offices Roof water tank will be sized for a minimum of one day.
A Reverse Osmosis system shall treat raw water (sea water) and discharge it into the
permeate water tank. A booster set shall supply make-up water from the permeate water tank
to the cooling tower sump on roof.
Sizing Criteria: Domestic water pipes shall be sized based on the plumbing fixture method
with a maximum pressure drop of 10 percent and maximum velocity of 2 m/sec.
Chillers area shall be provided with grated gutters and connected to the sewer system.
All drainage pipes inside the toilets or pantries are exposed under slab.
All the drainage piping, in risers or in horizontal runs shall be Cast Iron.
An underground drainage system is provided at the basement level for water tanks drainage
and pumping room drainage as well as water treatment system back wash. A sump pit with
duplex submersible sump pumps set shall be provided in the bottom of the basement floor to
serve the water tanks and pump room in the basement.
The pipes shall run at 1 percent slope. Concrete manholes drains, with grated cover and
sufficient size and depth are collecting all the water infiltration or water flushing.
The cooling towers over flow and blow out shall be drained down to the sewer network with
Black Steel pipe risers. The sump drainage shall be controlled to drain the volume over
24 hours.
The blow out and sump drainage lines shall pass in the first floor ceiling in the AHU area and
then through a shaft in the chillers area. The cooling tower design blow down water quantity
is around 700 gpm.
Storm water will be collected through roof drains and conveyed through risers using cast iron
pipes down to the external storm manhole. Storm water pipes will be sized as per UPC based
on 50 mm /hr intensity.
The rain water risers will be passed on the peripheral columns and walls cladding to avoid
passing in technical or electrical areas.
Rain water inlets will be provided to all paved areas, balconies, and planters.
The storm water piping and sundries (roof drains, etc.), shall be in cast iron.
Service Air
The service air system will be designed for 16 CFM operating at a pressure of 100 psig.
Dedicated fire pumps, supplied conforming to NFPA 20 and installed at the basement, will
pressurize the wet system of sprinklers and fire hoses.
One electric and one diesel fire pump and one jockey pump will be located in the basement
floor to meet the pressure/flow requirements of NFPA for the systems listed above. The
capacity of the fire water tank in the basement shall be based on 90 minute operation. The
estimated fire pump capacity is 750 gpm.
Alarm zone valves are installed on the fire sprinkler system. Each floor branch shall have a
zone control valve. Fire hose reels in cabinets with firemen hose connection through wet
riser pipes.
A Wet riser and landing valves will be provided in each stair with landing valves at each
floor.
Fire Hose Cabinets with 1 1/2-inch hose racks and 2 1/2-inch fire department valves and
portable fire extinguishers shall be installed such that all the areas are covered.
Portable CO2 extinguishers will be provided for electrical and telecom (or light current)
rooms.
The plant floor will have a wet pipe sprinkler system with the design density requirements for
an Ordinary Hazard Group 1 Occupancy.
The electrical areas will have a deluge system with the design density requirements for an
Ordinary Hazard Group 1 Occupancy.
The transformer areas will have a wet pipe sprinkler system with the design density
requirements for an Extra Hazard Group 1 Occupancy.
The Control Room and the telecom room shall be provided with a common FM-200 Fire
Suppression System.
HVAC Area (1F) 28-30 N/A AHU 2.6 L/S/M2 Wet Sprinkler
Control Room (Mezz) 23-25 50 +/-5% FCU 8 LPS per Person FM-200
Senior Staff Office 23-25 50 +/-5% FCU 8 LPS per Person Wet Sprinkler
General Office (1F) 23-25 50 +/-5% FCU 8 LPS per Person Wet Sprinkler
Mech. Workshop 23-25 50 +/-5% FCU 8 LPS per Person Wet Sprinkler
General
This section of the Design Intent Report includes the narrative description of the plant electrical
systems including distribution, motor control, general building power, building lighting, and extra
low voltage systems for the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar.
Discussions between the Owner, Qatar Cool, PMC, the Contractor, C.A.T. International (CAT),
and the Design-Build Engineer, Stanley Consultants are detailed in Exhibit A Project
Correspondence.
Compliance Statement
The Electrical design will comply with all portions of the Tender Documents prepared for Qatar
Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, room data sheets, tender drawings, and the appropriate
addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the Alternate 2
bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Any references to changes that have been agreed upon and not referenced in the above listed
documents including, but not limited to, thermal storage, secondary pumps, 3.3-kV CT Fans,
3.3-kV VFDs, etc., will be disregarded.
Use of the terms High Voltage, Medium Voltage, Low Voltage and their respective
abbreviations HV, MV, and LV will be minimized to avoid confusion. Voltage levels will be
defined per the Electrical Works Tender section A.4 Power Supply Characteristics.
Ratings of electrical equipment will be based on detailed design calculations based in part on
information received from the Electrical Utility and Primary Substation and Infrastructure
Contractors.
The concept of the electrical installations will be based on the main objectives as summarized
below:
To comply with the applicable standards.
To achieve reliability and durability of systems and components.
To implement safety measures for the protection of people and equipment.
While achieving the deign objectives, other important factors will be carefully considered as
follows:
Efficiency and Energy Conservation
Coordinated Design Elements
Simplifying of Systems Operation and Maintenance
The equipment, apparatus, material and accessories will be specified to be corrosion proof, and
UV stabilized if used outdoors.
The power factor of the plant will be maintained at 0.9. The necessary capacitor banks and
switching control elements will be carefully studied and implemented on the 3.3 kV and
415-V level switchgears to match with motor loads in particular and prevent any capacitive
load.
Motor starters will consist of ninety-two 3.3-kV soft start starters for chiller motors, twenty-
four 3.3-kV soft start starters for condenser water pumps, twenty-three 3.3-kV soft start
starters for chilled water pumps, twenty-four 415-volt Variable Frequency Drives (VFD) for
cooling tower motors, and miscellaneous 415-volt starters for building auxiliaries and the
Reverse Osmosis (RO) system. Other miscellaneous electrical equipment consists of two
emergency diesel generators, two automatic transfer switches (ATS), an uninterruptible
power source, miscellaneous distribution boards and a grounding grid.
The two emergency diesel generators are required to serve the Supervisory Control and Data
Acquisition (SCADA) system, fire pump, lighting, and ventilation requirements of the
chemical storage area. The generator will be sized to carry these loads and any other
auxiliary loads required. The emergency loads will be transferred via an automatic transfer
switch.
In general, the electrical design for the plant will utilize cable tray to distribute cables
throughout the plant, and where multiple cables run to the same location. Conduit and wire
systems will be used where it is not feasible to use cable tray.
Diesel generator rooms will be treated against the noise in such a way to obtain acceptable noise
criteria value.
The UPS unit will be provided with static bypass switch for economical mode operation and
with a manual bypass switch for maintenance mode. Minimum harmonic distortion values
will be adopted, with capabilities to switch to the gensets power feed without falling outside
the permissible limits.
Lamps will be specified with high power factor control gears in public and private areas
Lighting levels will be in accordance with CIBSE recommendations. Refer to Exhibit C for
details of room lighting type, level, and switching mode.
Lighting control panels with control means will be distributed and will be controlled from the
supervisory room. Offices, stores and the like will be controlled from local switches.
Boards
Boards will comply to IEC439-1 and with local regulations. All boards will be type tested
with color matching the surround. All boards and panels will be labeled, ferruled and will be
provided with a laminated distribution schedule sheet mounted inside the main door frame.
All indoor boards and panels will be cooled or ventilated in order to ensure proper
components heat dissipation. Spare and spaces will be ensured inside each enclosure.
The main distribution board (MDB) will be located in the central electrical room. Each
outgoing feeder will supply a secondary board through armored cables. The sub main
distribution boards (SMDB) will be located in secondary electrical rooms and/or closets.
The mechanical rooms and other miscellaneous HVAC and mechanical equipment will be fed
through motor control panels or motor control centers and through built-in motor starters as
required. Feeder pillars will be reserved for the external areas.
The final branch circuit panel boards will be of the DIN chassis assembly type. These panels
will be located as much as possible nearby the final branch loads, while ensuring proper
accessibility and maintainability. Separate distribution boards will be provided for lighting
and sockets, HVAC and outdoor usage.
MCCBs having a frame larger than 250A will have an electronic trip release with LSI unit;
long time trip with rating and time adjustable, short time trip with rating and time adjustable
and instantaneous trip with rating adjustable.
The distribution and selection of the breakers will take into account the short circuit
discrimination, redundancy and reliability.
The circuits will be protected against the earth leakage with the aid of earth leakage
interrupters rated as follows:
Up To Four Circuits of Lighting 30 mA
Up To Four Circuits of Sockets 30 mA
Fan Coil Unit 100 mA
Condensing or Package Unit 100-300 mA
Each Water Heater 30 mA
Contactors will be used for general HAVC, motors and lighting control. The Contactors will
comply to IEC 947-5 and will be at least rated Category 3 for inductive loads.
Disconnect switches will be used wherever a load is supplied from an unseen panel and will
be rated AC23 for inductive load.
All cables will be multicore, copper conductors and steel wire armored with XLPE insulation
90C rated, with PVC sheathing.
Life safety cables for fire alarm, fire fighting, maintained exit lighting, fire pump and other
life safety equipment will be fire rated to IEC 60331 and IEC 60332.
Raceways
Heavy gauge PVC conduits will be used in embedded locations while EMT galvanized
conduits, trunking, trays and /or ladders will be used for exposed conditions. Flexible
stainless steel conduits will be used for motors connections and for vibrating equipment.
EMT conduits will be installed in exposed high moisture and humid locations. Raceway
installations will be avoided in inaccessible areas.
Size of raceways will be in accordance with the IEE regulations. A minimum of 40 percent
spare will be provided for conduits and trunking, and 20 percent for trays and ladders.
Electrical outlets for remote electronic equipment such as fire alarm panel, CCTV camera,
motion detector and the like will be spur-fused type.
Earthing Network
Earthing system will consist of TN-S scheme as per the IEE regulations. Thus, a five wire
separate network will be distributed all over. The main earth electrode will consist of earth
rods installed at equidistant points nearby the plant perimeter and connected up to the
electrical room.
The earthing system will ensure proper tripping of 415V distribution breakers in case of
phase to earth faults, and will be designed to trip the earth leakage breakers in case of phase
to contact faults.
Separate clean earth for extra low-voltage systems such as SCADA, CCTV, access control,
fire alarm and the like will be provided and will be totally segregated from the power earthing
equipotential effects, and will be formed of a separate grid with inspection means.
Lightning Protection
The complete plant will be protected against lightning in accordance with a BS6651
compliant lightning protection system consisting of:
Roof conductor grids of 20m by 10m, with bonding to the exposed metallic equipment.
Protection will not cover the heights of the cooling towers as long as the cooling
towers are of fiber type.
Down conductors, each with a test link at accessible and non-harmful height.
Lightning ring electrode with lightning earth rods.
The system design and installations will comply with the NFPA72 requirements. All cabling
will be fire rated and will be Class A configuration. Life safety cables for fire alarm, fire
fighting, maintained exit lighting, fire pump and other life safety equipment will be fire rated
to IEC 60331 and IEC 60332 and will be red color coded.
The systems will comprise the main fire alarm cabinet, system console with PC fire station
and printer, addressable automatic detectors consisting of smoke, heat and rate of rise type,
manual fire stations and alarm devices consisting of bells, sounders as well as provision for
direct connection to the local Fire Station by direct telephone line.
The fire alarm system shall also seize control of the life safety equipment in case of fire and
shall control it according to the cause and effect matrix that will be elaborated for the Plant.
Such control will be ensured via analog addressable relay control modules with line monitor
modules for monitoring and reporting.
It is worth mentioning herein that for the chiller hall, there is a 9.1m height limitation by
NFPA for the installation of smoke detectors, which is not in line with the chiller hall height
that is 10.3m. Therefore, the beam detector is the recommended solution. However, due to
ceiling congestion and crane mobility at the chiller hall, which will create false alarms for the
beam detectors, we will install suspended smoke detectors down to 9.1m. Moreover, in order
to cover the buffer between the 9.1m and the ceiling height, we will reduce the spacing of
detectors to 12 meters.
The voice and data system will consist of structural cabling and connections distributed all
over the plant and at points described in Exhibit C of this report. The horizontal distribution
will consist of Category 6 unshielded twisted pair cabling, with RJ45 outlets.
The vertical and backbone cabling will consist of multipair cables for voice and multimode
fiber-optic cable for the data.
The main voice and data cabinets will consist of wall or free standing 19-inch cabinets
consisting of data patch panels, copper and fiber-optic patch panels, horizontal cross connect,
active switch and mains power supply.
An EPABX and MDF will be installed at the telecom room of the Administration Building.
The EPABX and MDF will be designed and sized to cater for the trunks and extensions with
10 percent spare capacity.
All EPABX, MDFs, patch panels and the like will be designed to be expandable and scalable.
The work will include provisions for the connection with the external services.
The room temperature will be maintained at 20-25C. The room will be provided with
separate clean earth for the use of Q-Tel.
Cameras will be colored CCD, fixed or PTZ (pan/tilt/zoom) type as per the schedule. The
system will be software enabled, with video matrix switching with enough capacity, scalable
and expandable.
Color monitors and operator consoles with intelligent keyboards will be installed in the
control room inside dedicated cabinets, along with select and shoot panel and with digital
video recorders (software enabled) with continuous recording for one week and with
automatic back up.
The system will also ensure the communication with other systems such as the fire alarm and
security access control systems via integrated communication ports.
Access control validation shall be based on time of day, day of week, holiday scheduling, etc.
Magnetic contacts shall be used to detect open/closed status and micro-switches shall be used
to detect locked status.
General
This section of the Design Intent Report includes the narrative description of the control system
for the Integrated District Cooling Plant at The Pearl Project. Discussions between the Owner,
Qatar Cool, PMC, the Contractor, C.A.T. International (CAT), and the Design-Build Engineer,
Stanley Consultants are detailed in Exhibit A Project Correspondence.
Compliance Statement
The Control System design will comply with all portions of the Tender Documents prepared for
Qatar Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, room data sheets, tender drawings, and the appropriate
addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
6.1.2.1 PLC shall be installed in PLC/UPS Room on first floor.
6.10.6 states that all motor controls including VFD will be done through the MCC and
SCADA while 6.1.11.1.(a) states not all control loops or motor controls will reside in the
SCADA environment. Motor control, including VFD, will be done through the MCC and
SCADA. Packaged system controllers will provide control for the motors included within
the respective package. SCADA will be configured to monitor and log run status and run
time of motors controlled by package system controllers.
6.1.11.3.(iv) No secondary pumps are included.
6.1.11.3.(iv) Soft starter for chillers will be controlled by hard wired stop/stop signals
from each respective chiller control panel. SCADA will monitor and log the run status of
each chiller motor.
Control Philosophy
The control system will be a PLC-based Supervisory Control and Data Acquisition (SCADA)
system designed to centralize the monitoring and control of the production and distribution of
chilled water in the District Cooling Plant (DCP), Heat Exchanger Buildings (HEX), and Energy
Transfer Stations (ETS). A SCADA system programmable logic controller (PLC) will perform
monitoring and control functions within the DCP. A local PLC mounted at each HEX or ETS
location will perform monitoring and control functions for that HEX or ETS and utilize Ethernet
communication for communication with the SCADA system.
Operators will monitor and control the DCP, HEX, and ETS processes through SCADA system
operator workstations configured with dynamic graphics for each process. Alarm summaries,
selective input/output trends, and historical data will be stored on application, management, and
information servers.
An engineering workstation will provide SCADA system application and development capability.
Open communication protocols will allow integration with the Island Operation Center and
National Operation Center.
Packaged equipment control will be performed by a local controller mounted in a local control
panel. Each packaged equipment controller will be integrated into the SCADA system through
Modbus or other approved communication protocol.
Local chiller control panel will provide the following control functionality:
Support local and remote control modes by means of Owner's control system.
Maintain leaving water temperature within 0.5F of setpoint.
Maintain internal refrigerant processes and chiller equipment within acceptable operating
bounds through operating range of 25-100 percent of capacity.
Limit chiller electric demand to setpoint within range of 40 percent to 100 percent.
Incorporate protective controls with local alarm status and reset capability for high oil
temperature, low differential oil pressure, high and low refrigerant pressure, low
condenser water and chilled water differential pressure, chilled water low temperature,
and condenser water high and low temperature.
Have demand limit of 10 percent to 100 percent FLA based on setpoint.
Local Operation:
Local-Off-Remote mode selections on HMI: Local, start initiated at chiller;
Remote, start initiated from Owners control system.
Emergency Stop Pushbutton.
Provide local LCD or LED displays for HMI.
Local Alarms:
- Low Chilled Water Differential Pressure
- Low Condenser Water Pressure
- Low Condenser Water Temperature
- High Oil Temperature
- Low Oil Differential Pressure
- High Refrigerant Pressure
- Low Refrigerant Pressure
- Low Refrigerant Temperature
- Starter Fault
- Analog Outputs:
Leaving Chilled Water Temperature Setpoint
Demand Limit Setpoint
Leaving Chilled Water Temperature
Entering Chilled Water Temperature
Chilled Water Differential Pressure
Leaving Condenser Water Temperature
Entering Condenser Water Temperature
Condenser Water Differential Pressure
Evaporator Refrigerant Temperature
Condenser Refrigerant Temperature
Compressor Discharge Refrigerant Temperature
Evaporator Refrigerant Pressure
Evaporator Differential Pressure
Condenser Refrigerant Pressure
Oil Temperature
Oil Pressure
HEX and ETS control will be performed at each remote location by a local PLC with HMI. The
SCADA system will provide supervisory control data to each HEX or ETS PLC and receive
process data from the HEX or ETS PLC through Ethernet communication.
Digital communication connections will utilize UTP copper or fiber-optic media depending on
the distance between each communicating device.
Each chilled water pump is dedicated to a chiller pair. Chilled water pump suction and
chilled water supply discharge piping from each chiller will connect to common headers.
When operating in Automatic Mode, the SCADA system will start and stop chiller pairs
based on the following:
When the sum of the plant energy meter and plant HVAC energy meter indicates that
total demand increases to full capacity of the currently operating chiller pair(s), the
main plant PLC shall start the next chiller in the operator selected pre-defined starting
sequence that has the AUTO mode selected and one of the following occurs:
- Differential pressure between the chilled water supply header and chilled water
return header increases to or above the field adjustable setpoint for a field
adjustable time period.
- Chilled water supply header temperature increases to or above F (field
adjustable) above the current leaving chilled water temperature setpoint for the
currently operating chillers for a field adjustable time period.
- Power input to the currently operating chiller pairs increases to or above the field
adjustable setpoint.
Blowdown System
The control system will monitor and control the blowdown rate based on condenser water
conductivity. The operator will determine and adjust conductivity set point.
Electrical System
The SCADA system will provide hardwired inputs and outputs for motor control. Profibus
DP communication protocol will allow the SCADA system to monitor, store and trend
additional process information from starters, variable frequency drives, and multifunction
relays.
Instrumentation
Field Instruments
DCP field instruments will communicate with the SCADA system utilizing Profibus DP
communication protocol.
ETS and HEX field instruments are 4 to 20-ma dc loop powered inputs and outputs.
General
This section of the Design Intent Report includes the narrative description of the utility services
and work for the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar. Site survey data
obtained during the course of this project will form the basis for the development of the grading
and paving design. Discussions between the Owner, Qatar Cool, PMC, the Contractor, C.A.T.
International (CAT), and the Design-Build Engineer, Stanley Consultants are detailed in
Exhibit A Project Correspondence.
Compliance Statement
The Utility Services design will comply with all portions of the Tender Documents prepared for
Qatar Cool and issued by DAR during the tender phase. These documents include the general
requirements, tender specifications, tender drawings, and the appropriate addendums and tender
circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Site Layout: The latest revisions to the U-07 Plot limits will form the basis of the site
layout, grading, and paving design.
Chilled Water
Codes and Standards
Chilled water piping, valves and fittings will be designed in accordance with American
Society of Mechanical Engineers (ASME), American Water Works Association (AWWA),
and American Society for Testing and Materials (ASTM).
Buried chilled water piping will be constructed of pre-insulated direct-buried carbon steel
pipe system in accordance with Section 60, Part 2 of the Tender Specifications.
Installation of the proposed chilled water lines will require coordination with other utilities in
the area. Permitting will be obtained for the established corridor to route the chilled water
lines.
Potable Water
Codes and Standards
Potable water piping, valves, and fittings will be in accordance with American Water Works
Association (AWWA), and American Society for Testing and Materials (ASTM).
System Description
Potable water service for the IDCP will be connected to the island distribution system and
coordinated with the infrastructure contractor.
Buried potable water lines will match the piping system used by the infrastructure contractor.
Sanitary Sewer
Codes and Standards
Sanitary sewer piping, valves, and fittings will be designed in accordance with American
Water Works Association (AWWA) and American Society for Testing and Materials
(ASTM).
System Description
Sanitary sewer service for the IDCP will be connected to the island distribution system and
coordinated with the infrastructure contractor.
Buried sanitary sewer lines will be constructed of cast iron, in accordance with Section 60,
part 2 of the Tender Specifications.
Storm Sewer
Codes and Standards
Storm sewer piping, valves, and fittings will be designed in accordance with American Water
Works Association (AWWA) and American Society for Testing and Materials (ASTM).
Buried storm sewer lines will be constructed of cast iron, in accordance with Section 60,
part 2 of the Tender Specifications.
General
This section of the Design Intent Report includes the narrative description of the maintenance and
accessibility for the Integrated District Cooling Plant (IDCP) at The Pearl, Qatar. Discussions
between the Owner, Qatar Cool, PMC, the Contractor, C.A.T. International (CAT), and the
Design-Build Engineer, Stanley Consultants are detailed in Exhibit A Project Correspondence.
Compliance Statement
The maintenance and accessibility within the plant will comply with all portions of the Tender
Documents prepared for Qatar Cool and issued by DAR during the tender phase. These
documents include the general requirements, tender specifications, tender drawings, and the
appropriate addendums and tender circulars issued for clarification, except as noted below:
Plant Arrangement: The IDCP will be based upon the plant arrangement from the
Alternate 2 bid proposed by CAT and accepted by Qatar Cool prior to contract award.
Four traveling cranes will be included within the plant. These cranes will allow for the removal
of equipment components such as pump motors and chiller compressors. Sufficient clearance has
been provided for the removal of equipment using the traveling cranes without disturbing other
unaffected equipment and piping. Equipment and/or components that are handled by the
traveling cranes will be transported to the center of the plant between Column Rows H and J.
The component in question can then be lowered to a pallet or skid at the floor level. The pallet or
skid can then be moved from this location using a forklift or pallet jack. The forklift or pallet
jack can be maneuvered from this location down the main access aisle between Column Rows 7
and 9 to the main equipment access door at the south end of the plant. The largest anticipated
load expected to be carried by the traveling crane will be the chiller compressors. According to
manufacturers data, this equipment is anticipated to weigh 4,000 kg.
A vertical equipment access shaft is provided at the center of the plant. The purpose of this shaft
is to provide a means for installation and removal of equipment to and from the first floor as well
as to the roof level. A traveling crane will be located on the roof deck to provide a means of
servicing the condenser water pumps and cooling tower fan motors. This traveling crane will also
be used to move equipment from the ground floor to the first floor (Electrical Equipment or
R.O. components).
The last major feature for maintenance and accessibility is the access hatch located at grade and
outside of the IDCP. The purpose of this hatch is to provide a means of servicing the emergency
generators, fire pumps, and miscellaneous R.O. pumps located in the basement.