Documente Academic
Documente Profesional
Documente Cultură
Original Article
$VVHVVPHQWRIWKH7KHUDSHXWLF%HQH¿WRI2UDO3UHGQLVRORQHDQG
Common Adjuvant Therapy in Stage II of Randomized Controlled
Trial Study for Management of Pemphigus Vulgaris
1D¿VHK (VPDLOL 0'1,2,3, Cheyda Chams-Davatchi MD1,2, Mahin Valikhani MD1,2, Maryam Daneshpazhooh MD1,2, Siavash Toosi
MD4, Abbas Karimi PhD5, Hossein Mortazavi MD1,2
Abstract
Background3HPSKLJXVLVDQDXWRLPPXQHEOLVWHULQJPXFRFXWDQHRXVGLVRUGHU&RPPRQWUHDWPHQWVLQFOXGHFRUWLFRVWHURLGVand immu
QRVXSSUHVVLYHGUXJV7KLVVWXG\DLPHGWRDVVHVVWKHWKHUDSHXWLFHIIHFWVRIRUDOSUHGQLVRORQHDORQJZLWKWKHFRPPRQDGMXYDQWWKHUDS\in
SHPSKLJXVYXOJDULV
Methods(LJKW\VHYHQSDWLHQWVZLWKSHPSKLJXVYXOJDULVIURPWKH¿UVWVWDJHRIDSUHYLRXVO\UDQGRPL]HGFOLQLFDOWULDOZHUHHQUROOHGLQWKH
SUHVHQWQRQEOLQGHGFOLQLFDOWULDO7KHSDWLHQWVZHUHGLYLGHGLQWRIRXUJURXSVDQGWUHDWHGDFFRUGLQJO\ZLWKSUHGQLVRORQHDORQH31
SUHGQLVRORQHDQGD]DWKLRSULQH3$1 SUHGQLVRORQHDQGP\FRSKHQRODWHPRIHWLO301 DQGSUHGQLVRORQHDQGF\FORSKRVSKD
PLGH3&1 7KHVHSDWLHQWVZHUHIROORZHGXSIRUDQH[WHQGHGRQH\HDUSHULRG
Results7KHSULPDU\ORFDOL]DWLRQRIWKHUHFXUUHQFHRFFXUUHGLQWKHRUDOFDYLW\RIDQGSDWLHQWVLQWKH33$30DQG3&JURXSV
UHVSHFWLYHO\7KHUHZDVQRVLJQL¿FDQWGLIIHUHQFHEHWZHHQWKHPP 7KH mean total dose of prednisolone administered in groups
P, P$30DQG3&ZDVDFFRUGLQJO\DQGPJGD\0LQRUUHFXUUHQFHRIWKHGLVHDVHLQWKHDERYHPHQWLRQHGJURXSVZDV
REVHUYHGLQDQGRIWKHSDWLHQWVUHVSHFWLYHO\:LWKUHJDUGWRWKHPLQRUUHFXUUHQFHRIWKHGLVHDVH,
WKHUHZDVQRVLJQL¿FDQWGLIIHUHQFHDPRQJWKHIRXUWUHDWPHQWJURXSV (P
Conclusion:6LQFHLQWKLVIROORZXSVWXG\QRWKHUDSHXWLFEHQH¿WRIRUDOSUHGQLVRORQHDQGFRPPRQDGMXYDQWWKHUDS\ was found in terms
RIWKHQXPEHURIPLQRUDQGPDMRUUHFXUUHQFHVWKHH[WHQWWRZKLFKWUHDWPHQWRI39FDQEHLPSURYHGXSRQWUHDWPHQWZLWKWKHVHDJHQWV
remains to beHOXFLGDWHG
Keywords$GMXYDQWGUXJWKHUDS\SHPSKLJXVYXOJDULVSUHGQLVRORQHUDQGRPL]HGcontrolled trial
Cite this article as: Esmaili N, Chams-Davatchi C, Valikhani M, Daneshpazhooh M, Toosi S, Karimi A, et al. Assessment of the therapeutic benefit of oral predniso-
lone and common adjuvant therapy in stage II of randomized controlled trial study for management of pemphigus vulgaris. Arch Iran Med. 2014; 17(9): 626 – 628.
Table 1.0HDQDJHSKHQRW\SLFFKDUDFWHULVWLFVRIGLVHDVHEHIRUHWUHDWPHQW
Gender
Skin and mucous
Group Number of Patients Mean age (SD) Mucosal Skin
Female Male membrane
Table 2.0HDQGDLO\GRVHRISUHGQLVRORQHSUHYDOHQFHRIPLQRUDQGPDMRUUHFXUUHQFHVLGHHIIHFWVDQGSULPDU\ORFDOL]DWLRQRIWKHUHFXUUHQFHLQ
HDFKJURXSRISDWLHQWV
Group P P/A P/M P/C 3YDOXH
Mean prednisolone (mg), (SD) 7.5 (4.9) 8.4 (4.4) 9.2 (4.1) 8.6 (4.6) 0.21
Minor Recurrence (%) 7 (30.4%) 5 (21.7%) 6 (28.6%) 7 (35.0%) 0.80
Major Recurrence (%) 2 (8.7%) 1 (4.3%) 2 (9.5%) 1 (5.0%) -
Number of patients Showed side effects (%) 3 (13.0%) 9 (39.1%) 4 (19.0%) 9 (45.0%) 0.057
Primary localization of the recurrence 0.40
Oral cavity 7 6 2 5
Eye --- --- 1 ---
Scalp --- --- 2 ---
Skin of head and neck --- --- --- 1
KLVWRU\DJHVH[GXUDWLRQRIGLVHDVHDQG¿UVWDQDWRPLFVLWH af- respectively, (Table 2). With regard to the incidence of minor
fected at the onset of the disease), drug intake, complete physical UHFXUUHQFHWKHUHZDVQRVLJQL¿FDQWGLIIHUHQFHEHWZHHQWKH four
examination, and routine laboratory tests. A minor recurrence cor- groups (P = 0.80). Major recurrence was observed in 2 (8.7%), 1
responded to the appearance of less than 20 lesions on less than 3 (4.3%), 2 (9.5%), and 1 (5.0%) patients from groups P, P/A, P/M,
sectors of the body; whereas a major recurrence was noted when and P/C, respectively (Table 2). The mean daily dose of predniso-
more than 20 lesions appeared on 3 or more sectors of the body. lone was 7.9 mg (±4.9), 8.4 mg (±4.4), 9.2 mg (±4.1), and 8.6 mg
Obtained data were subjected to statistical analysis by SPSS (±4.6) in P, P/A, P/M and P/C groups, respectively, (Table 2). The
18, using Chi-square test for categorical variables and analysis of difference between prednisolone doses among the four treatment
variance (ANOVA) for continuous variables. Fisher’s exact test JURXSVZDVQRWVLJQL¿FDQWP = 0.21).
was used when necessary.
Discussion
Results
PV, as an autoimmune mucocutaneous disease, creates bullous
Of the 120 patients admitted to the study of Chams-Davatchi, lesions in mucous and cutaneous membranes by producing IgG
et al.7 90 were enrolled in the second stage of the study and 87 autoantibodies against keratinocytes antigens.8 Similar to other
remained in the study. The 87 patients comprised 23 (26.4%) indi- autoimmune diseases, if not promptly treated, the process of PV
viduals in group P, 23 (26.4%) in group P/A, 21 (24.1%) patients would be progressive providing the opportunity for the spread-
in group P/M, and 20 (23.0%) in group P/C, (Table 1). ing of epitopes and rendering WKHGLVHDVHVLJQL¿FDQWO\PRUHGLI-
There were 56 women (64.4%) and 31 men (35.6%), yielding ¿FXOWWRFRQWURO7,9 It seems that adequate treatment at the onset
a female to male ratio of 1.8:1. The mean age of the patients was of the disease leads to better outcomes in terms of controlling
39.56 (12.88) years, (Table 1). With regard to age and sex, there the disease and preventing recurrences. The main object in pem-
ZDVQRVLJQL¿FDQWGLIIHUHQFHEHWZHHQWKHIRXUgroups (P = 0.17). phigus treatment is development of low steroid regimens or an
The clinical forms of PV observed in the patients were mucosal intervention without using systemic corticosteroid therapy. Due
(24 patients; 27.6%), skin and mucous membrane (59 patients; to the rarity of the disease (i.e. PV), the number of participants
67.8%), and skin phenotypes (4 patients; 4.6%), (Table 1). There is quite low in most clinical trials; thus, many variations may be
ZHUHQRVLJQL¿FDQWGLIIHUHQFHVDPRQJWKHSDWLHQW phenotypes in observed between same treatment regimens in different studies.10
the 4 groups (P = 0.96). The primary localization of the recurrence In this follow-XSVWXG\IROORZLQJWKH¿UVWVWDJHRIWKHVWXG\E\
was the oral cavity in 7 patients of group P and 6 patient of group Chams-Davatchi, et al.7 ZH REVHUYHG QR VLJQL¿FDQW GLIIHUHQFH
P/A. In group P/M, recurrence was seen in the oral cavity of 2 among the four treatment groups in terms of the number of minor
patients, the eye of 1 patient, and the scalp of 2 patients (Table recurrences of the disease. Since the total number of the major re-
2). In group P/C, the recurrence was seen in the oral cavity of 5 currence of the disease was small, it was not possible to compare
patients and on the skin of the head and neck of 1 patient. The the four groups with each other and we hesitate to give any com-
difference between the primary localization of recurrence in the ment in this regard. Although mycophenolate mofetilcould may
oral cavity and the four WUHDWPHQWJURXSVZDVQRWVLJQL¿FDQWP = be better in terms of controlling the autoimmune mechanism and
0.40). Minor recurrence was observed in groups P, P/A, P/M, and lowering pemphigus antibody titers,6 WKHVDPH¿QGLQJVZHUHQRW
P/C in 7 (30.4%), 5 (21.7%), 6 (28.6%), and 7 (35.0%) patients, found in the present study, at least in case of the minor and major
recurrence rate. The mean daily dose of prednisolone (even a high 3. Eming R, Rech J, Barth S, et al. Prolonged clinical remission of
dose of 9.2 mg/day in the P/M group) KDGQRVLJQL¿FDQWHIIHFW patients with severe pemphigus upon rapid removal of desmoglein-
reactive autoantibodies by immunoadsorption. Dermatology. 2006;
in cases of the appearance of minor recurrence. Correspondingly, 212(2): 177 – 187.
appearance of primary localization of recurrence in the oral cav- 4. $ULQ0(QJHUW$.ULHJ7+XQ]HOPDQQ1$QWL &'PRQRFORQDO
ity and occurrence of side effects throughout the treatment was antibody (rituximab) in the treatment of pemphigus. British Journal of
not associated with the four groups. In conclusion, in the primary Dermatology. 2005; 153(3): 620 – 625.
5. Bystryn JC, Rudolph JL. IVI g treatment of pemphigus : how it works
stage of this clinical trial, the most HI¿FDFLRXVF\WRWR[LFGUXJWR and how to use it. J Invest Dermatol. 2005; 125(6): 1093 – 1098.
reduce steroid was found to be azathioprine, followed by pulse 6. Mimouni D, Nousari CH, Cummins DL, Kouba DJ, David M, Anhalt
cyclophosphamide, and then mycophenolate mofetil.7 However, GJ. Differences and similarities among expert opinions on the diagno-
sis and treatment of pemphigus vulgaris. J Am Acad Dermatol. 2003;
in the current study, it seems that differences have emerged during
49(6): 1059 – 1062.
the extended follow-up period. Further studies are recommended 7. Chams-Davatchi C, Esmaili N, Daneshpazhooh M, Valikhani M,
to evaluate different protocols in treatment of PV patients with Balighi K, Hallaji Z, et al. Randomized controlled open-label trial of
longer follow-up periods. four treatment regimens for pemphigus vulgaris. J Am Acad Dermatol.
2007; 57(4): 622 – 628.
8. Grando SA. Pemphigus autoimmunity: hypotheses and realities. Auto-
References immunity. 2012; 45(1): 7 – 35.
9. Tuohy VK, Kinkel RP. Epitope spreading: a mechanism for progres-
1. Tsuruta D, Ishii N, Hashimoto T. Diagnosis and treatment of pemphi- sion of autoimmune disease. Arch Immunol Ther Exp (Warsz). 2000;
gus. Immunotherapy. 2012; 4(7): 735 – 745. 48(5): 347 – 351.
2. 6DPL1%KRO.&$KPHG5$,QÀXHQFHRILQWUDYHQRXVLPPXQRJORE- 10. Martin LK, Werth V, Villanueva E, Segall J, Murrell DF. Interventions
ulin therapy on autoantibody titers to desmoglein 3 and desmoglein for pemphigus vulgaris and pemphigus foliaceus. The Cochrane Da-
1 in pemphigus vulgaris. European Journal of Dermatology: EJD. tabase of Systematic Reviews. 2009; 1: Cd006263.
2003; 13(4): 377.