Sunteți pe pagina 1din 2

MASTER GENETICĂ MOLECULARĂ

2018 – 2019
GENOMICĂ - BAZE DE DATE

Nume:

Gene
CDK1, CDK2, CDC25A, CDC25C, BRCA1, BRCA2, HRas, KRas, NRas, HER2, TP53, , BCL2, IL-1, IL-6, IL-17, IL-
22, HSP90, ALX1, ATP8A2, CR1, EFCAB1, MMP26, PNOC,
https://cancer.sanger.ac.uk/census
F5 (factor V Leiden)

BLAST (https://blast.ncbi.nlm.nih.gov/Blast.cgi)

1. Utilizând secvența unei gene nucleare:


a) Rulați BLASTn în baza de date cu secvențe umane și altele. Precizați diferențele.

b) Rulați tBLASTx și BLASTx pentru secvența menționată, cu matricile BLOSUM 80 și 45. Precizați
diferențele.

c) Comparați utilitatea rezultatelor obținute. Care comparații sunt mai utile? Între secvențe
nucleotidice sau între secvențe de aminoacizi?

2. Utilizând baza de date UCSC (http://genome.ucsc.edu/) identificați:


a) Care este localizarea în cadrul genomului (cromosom, brat)?
b) Care este dimensiunea genei în perechi de baze?
c) care sunt genele adiacente?
d) Câți exoni are gena?

UniGene (https://www.ncbi.nlm.nih.gov/unigene)
4. Cate regiuni EST are gena în diferite țesuturi (min, max)?
5. Precizați la nivelul căror țesuturi, gena este supraexprimată
6. Precizați dacă gena este supraexprimată în cancer?
7. Câte regiuni EST prezintă gena?
8. În care țesuturi umane se exprimă gena?
9. Concluzii legate de expresia și funcțiile genei

Human Protein Atlas (https://www.proteinatlas.org/)


10. Există dovezi ale expresiei proteinei?
11. Există o corelație între expresia ARN și a proteinei?
12. Precizați daca proteina este supra exprimată în cancer?
13. Pentru a studia implicațiile genei în cancer, ce linii celulare ați utiliza ca model?
14. Pentru a determina localizarea intracelulară a proteinei, ce anticorpi pot fi utilizati?

15. Utilizând modulul BLAST, identificați gene omoloage ortoloage și paraloage


BLAST
16. Utilizând BLAST, identificați proteine cu secvență similară
>query
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDE
PDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTL
TSNTKCKEEGSRSNVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGV
NEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV

a. Care sunt proteinele care prezintă similaritatea cea mai mare?


b. Care sunt diferențele semnificative în aliniere?

17. Identificați gena și mutația:

>query
TGCCTCCTTTGGTGAAGGTGACACATCATGTGACCTCTTCAGTGACCACTCTACGGTGTCGGGCCTTGAACTACTAC
CCCCAGAACATCACCATGAAGTGGCTGAAGGATAAGCAGCCAATGGATGCCAAGGAGTTCGAACCTAAAGACGT
ATTGCCCAATGGGGATGGGACCTACCAGGGCTGGATAACCTTGGCTGTACCCCCTGGGGAAGAGCAGAGATATA
CGTACCAGGTGGAGCACCCAGGCCTGGATCAGCCCCTCATTGTGATCTGGG