Sunteți pe pagina 1din 21

www.hornbach.

ro

Noiembrie

indice de protecţie IP65


Proiector exterior LED
1590 buc.

- 10 W, 850 lm
- material: aluminiu, sticlă
- lumină rece 4612661

De la 1 Pal.
( = 164,41 m2) 17,90 lei/m2
Laminat stejar alb
1890 m2

- 1383 x 193 x 6 mm
- sistem de montare dublu click
- pachet = 2,936 m 6393338

Vată de sticlă VSG42 DUO 5/10


353 m2
De la 1 Pal. ( = 24 role)
3,40 lei/m2
include vizor și sonerie

11 puncte de închidere

475.-
- dimensiune: 7500 x 1200 mm buc.
- grosime 2 x 50 mm, rolă: 18 m2, izolaţie termică şi fonică
- conductivitate termică Lambda 0,042 W/mK
- pentru: izolație acoperiş, izolație interioară,
izolație plafon 7967271 coresp. 63,70 lei/rolă
Ușă metalică Salsa
- 2050 x 860 mm
- deschidere stânga/dreapta
- izolaţie tip fagure
- grosime tablă foaie uşă 0,6 mm
- grosime tablă toc 1 mm
- şilduri cu pastila antidrill
- vopsită în câmp electrostatic
(vopsea mată) 6856581/2
Magazine:
2GYYYJQTPDCEJTQCXGœKCEWORGUVGFGRTQFWUGFKP
Peste ECVGIQTKKNGDCKGőKUCPKVCTGEQPUVTWEœKKNGOPHGTGUVTGőKWőK

40.000 Târg de covoare


RCTFQUGNKITGUKGHCKCPœàHGTQPGTKGőKRTQFWUGFGEWTàœGPKG
XQRUGCőKVCRGVITàFKPàÊPEàN\KTGENKOCVK\CTGőKXGPVKNCœKG
$WEWTGőVK FGEQTCœKWPKKPVGTKQCTGőKVCDNQWTKDWEàVàTKGGNGEVTKEGőKEQTRWTK
FGKNWOKPCVUEWNGOCőKPKWPGNVGőKTCHVWTK\QQőKCEXCTKUVKEà

Berceni
&TWOWN)KNàWNWK de produse online! Spor în toate proiectele! în toate magazinele, între 15.11-17.12
0TUGEVQT
$WEWTGőVK

2QUKDKNKVàœKNG
6GN
Militari
5VT*QTPDCEJ0T
&QOPGőVK+NHQX
6GN
de la online & în magazin
$CNQVGőVK
%CNGC$WEWTGőVK0T#
$CNQVGőVK+NHQX
6GN
%CTF2TQƂ

$TCőQX NUME DELEGAT

5GTXKEKKOQPVCL 5GTXKEKK2TQƂFGNCRTQHGUKQPKőVKRGPVTW 2NCPKƂECVQTFGURCœKW


5VT$WEGIK0T RTQHGUKQPKőVK
$TCőQX
6GN

6KOKőQCTC
%CNGC#TCFWNWK0T
6KOKőQCTC
%WORàTCTGQPNKPGEWNKXTCTG
FKTGEVCECUà
%WORàTCTGQPNKPGEWNKXTCTG
ÊPmagazin
4G\GTXCTGQPNKPGEWRNCVàőK
TKFKECTGFKPmagazin
%QOCPFàQPNKPGEWRNCVC
ÊPOCIC\KP 6¾TIFG%TàEKWP Inaugurare

Magazin
6KOKőQCTC

RGPVTWEGKOCTKőKOKEK  Sibiu


6GN
 /KNKVCTK
Sibiu  $GTEGPK
5GTXKEKKVTCPURQTV (QNQUKTGTGOQTEà 5GTXKEKKVTCPURQTVEW .KXTCTGEW6+4 5GTXKEKKcomenzi
 $CNQVGőVK
%CNGCŐWTKK/CTK0T ITCVKU ECOKQPFQVCVEWOCECTC
5KDKW  $TCőQX
6GN

Program:
5GTXKEKKETQKTG 5GTXKEKKÊPTàOCTG 5GTXKEKKUWTƂNCTG 5GTXKEKKOKZCTG 5GTXKEKKEQPUKNKGTG
Magazin: RGTFGNG XQRUGNGőKNCEWTK
NWPKU¾ODàVà
FWOKPKEà
Drive In:
NWPKU¾ODàVà
#XCPVCLGNG .KXTCTGNCRCNGV 5GTXKEKKFGDKVàTKNGOP 5GTXKEKKƂPCPœCTG 2%%NKGPœK
FWOKPKEà ECPVKVàœKNQTOCTK
Polistiren EXCLUSIV )NGVWTK/QTVCTG Profiluri #EEGUQTKK
la HORNBACH
Glet HP Finish 7őàFGXK\KVCTG
- glet sintetic de finisare,
20
.CODFC9O-
UWRGTHKPEWCFGTGPψ Profiluri CD
ITQUKOGOO 12 - dimensiune
ZOO

16.-
OCTKVàWVKNK\CTGNCKPVGTKQT de la buc. buc.
OCVGTKCNRNCUVKE
EQPUWOMIO2

288
Lungime 2TGķRTQHK 8479414
0T#TV Dim. (mm) 2TGœ Cantitate
OOITQUKOG (m) DWE
MI6602284
34.-
de la m2 sac 265394 60 x 27 x 0,6 2,6 12,60 12,20 12
Polistiren 0T#TV
)TQUKOG 2TGœ 2TGœ &GNC2CN
UCEK NGKUCE 260731 60 x 27 x 0,6 4 19,40 19,00 12
expandat EPS 50 (mm) m2 pac. 2NCEàIKRUECTVQP ŐWTWDWTK
79
5
QRVKOK\CTGCURCķKWNWK
TG\KUVGPķàNC
8497078 20 2,88 36,00
ZOO )NGV8GNXGV CWVQƂNGVCPVG
EQORTGUKWPGM2# 8497079 30 4,39 35,10 ITQUKOGOO INGVXCTKRUQURGPVTW 2TQHKNWTK%9 OODWE
18.-
buc.
RNCEàZOO 8497081
WVKNK\CTGK\QNCķKK
RGTGķKKPVGTKQTK
8497082
50
100
7,09
14,18
35,45
35,45
7356469EQTGUR
NGKDWE
&GNC2CN
DWE NGKO2
m 2 ITGWVCVGTGFWUà ÊPEàTECTGPKXGNCTGHKPKUCTG
WVKNK\CTGNCKPVGTKQT
CFGTGPķàHQCTVGDWPà
ITQUKOG
OO
Lungime
de la
2TGķRTQHK
0251809
EQTGURNGKDWE 2980 pac.

EQPUWOMIO2 0T#TV Dim. (mm) 2TGœ DWE Cantitate


EXCLUSIV OOITQUKOG 265269 50 x 50 x 0,6
(m)
2,6 18,00 17,40 8
la HORNBACH 0T#TV Dimensiuni (mm) Cantitate 2TGœO2
MI6665836 $CPFàFG
36.-
sac 265292 50 x 50 x 0,6 3 20,70 20,00 8
buc. 6,20
.CODFC9O-
8045443 2600 x 1200 x 9,5
- standard palet (80 buc.) 6,06 &GNC2CN
UCEK NGKUCE 265316 100 x 50 x 0,6 3 27,60 26,70 8 GVCPőCTG
OOZO

3360
2000 x 1200 x 9,5 buc. 5,79
03
4 0251774
7356469 - standard palet (80 buc.) 5,63 Chit de rosturi Joint EQTGURNGKO TQNà
de la m2 2600 x 1200 x 12,5 buc. 7,16 Filler Super 2TQHKNWTK79
2150
8045444
Polistiren )TQUKOG 2TGœ 2TGœ
- standard palet (60 buc.) 7,02 RVTQUVWKTGCÊODKPàTKNQT ITQUKOG
0T#TV
(mm) m2 pac. buc. 6,76 RNàEKNQTFGIKRUECTVQPEWDGP\K OO de la buc. Batem palma
expandat EPS 80 8497085 50,40
7356471
2000 x 1200 x 12,5
- standard 6,56 FGCTOCTGNKRKTGCÊPUVTCV
/GTGWRTGœWTKOKEK
20 4,03 palet (60 buc.) Lungime 2TGœ 2TGķRTQHK Cantitate
TG\KUVGPķàNC 0T#TV Dim. (mm)
EQORTGUKWPG
8497086* 30 6,05 48,40
8045445
2600 x 1200 x 12,5 buc. 10,98 UWDķKTGCRNàEKNQTFGIKRUECTVQP (m) DWE
8497087 50 9,51 47,55 CPVKWOG\GCNà palet (60 buc.) 10,77 EQPUWOMIO2 265236 50 x 40 x 0,6 4 21,50 20,80 8
M2#
MI6665835
58.-
8497088 80 16,13 48,40 buc. 10,34 sac 265247 75 x 40 x 0,6 4 25,80 25,00 8
RNCEàZOO
Garantat!
2600 x 1200 x 12,5
8576472 TG\KUVGPVàNCHQE
RVHCķCFà 8497089 100 19,02 47,55 palet (60 buc.) 10,13 &GNC2CN
UCEK NGKUCE 265258 100 x 40 x 0,6 4 29,60 28,70 8

8CVàOKPGTCNàDC\CNVKEà 8CVàOKPGTCNàUGOKTKIKFà 8CVàOKPGTCNàNCTQNà .CODFC9O- .CODFC9O-

8CVàFGUVKENà&QOQ6YKP 8CVàFGUVKENà#MWUVQ
.CODFC9O- .CODFC9O- FKOGPUKWPGZOO FKOGPUKWPGZOO
85
.CODFC9O-

8CVàDC\CNVKEà
.CODFC9O-

33 2NCEà 8CVàFGUVKENà4KQ de la 3 m 2
ITQUKOGZOO
TQNàO2
ITQUKOGOO
TQNàO2

Polistiren
20
PLE 50 de la 10 m2 UGOKTKIKFà
XCVàOKPGTCNà 35
0T#TV
Dimensiuni
(mm)
Cantitate
2TGœ
m2
2TGœ
TQNà
RVK\QNCTGCVGTOKEàőK
HQPKEàCOCPUCTFGK
UCNVGNGTWNCVGRVK\QNCTGCHQPKEàőK
VGTOKEàCRGTGķKNQTFGURàTķKVQTK
expandat EPS 100 de la 13 m2
0T#TV
Dimensiuni
(mm)
Cantitate 2TGœO2 2TGœRCE
)GEUCVJGTO82) 11 m2
(2 x 50) x
7432325 7000 x 1200
TQNC
O2)
RCNGV
TQNG
3,85
3,76
64,80
63,20
8418875EQTGURNGKTQNà

10 &GNC2CN
7551484EQTGURNGKTQNà
&GNC2CN
TG\KUVGPķàNC
EQORTGUKWPG
M2#
0T#TV

RNCEàZOO 7408793
)TQUKOG
(mm)
50
2TGœ
m2
13,20
2TGœ
pac.
66,00
5962328

8866748
1000 x 600 x 50

1000 x 600
pac. (4,8 m2 )
palet (12 pac.)
pac. (2,4 m2)
10,33
10,02
20,08
49,60
48,11
48,20
0T#TV
Dimensiuni
(mm)
Cantitate
pac. (5,76 m2 )
2TGœO2 2TGœRCE
11,04 63,60
7715371 50 x 12000 x TQNC
O )
1200, ALU RCNGV
TQNG
100 x 7500 x TQNC
O )
2
2
8,88
8,61
11,77
128,00
124,00
105,90
4 m2

TQNG NGKO2
720 m 2

TQNG NGKO2

6834418 1200 x 600 x 50 7432324 1200, ALU


7408795 66,00 x 100 palet (12 pac.) 19,67 47,20 10,76 62,00 RCNGV
TQNG 11,47 103,20
RVTGZVGTKQT 100 26,40 palet (12 pac.)
1000 x 600 x pac. (4,8 m2) 20,21 97,00
5962329
50, ALU palet (12 pac.) 19,71 94,60
.CODFC9O- pac. (2,4 m2) 31,00 74,40
1000 x 600 x
5962330
100, ALU 30,21 72,50 .CODFC9O- .CODFC9O- Vario „ KM
2GPVTWQőKOCKDWPà
palet (12 pac.)
.CODFC9O-
Duplex UV”
Polistiren extrudat 2NCEà 8CVàFGUVKENà 8CVàFGUVKENà+UQXGT K\QNCTGVGTOKEà OGODTCPàFKPHKDTG
TG\KUVGPķàNC
.CODFC9O-
UGOKTKIKFà Umiroll Plus (QTVG RQNKCOKFKEG
FKOGPUKWPGZOO FKOGPUKWPGZOO UGKPUVCNGC\àRGUWRTCHCķC
EQORTGUKWPGMRC 8CVà XCVàOKPGTCNà
80 OCVGTKCNWNWKK\QNCPV
RNCEàZOO
7 DC\CNVKEà
1886 )GEUCVJGTO
2256
ITQUKOGZOO
O2TQNà
ITQUKOGZOO
TQNàO2 TQNà CTGQRGTOGCDKNKVCVG

647.-
FGPUKVCVGMIO de la m2 XCTKCDKNàNCXCRQTK
LRB 038 m2 VPG 10 m2 RGPVTWCOGPCLCTGOCPUCTFà RGPVTWCOGPCLCTGOCPUCTFà
0T#TV )TQUKOG 2TGœ 2TGķ 2TGœRTQHK 2TGķRTQHK 2CE COGPCLCTGKPVGTKQCTà COGPCLCTGKPVGTKQCTà OZO5243459
(mm) m2 pac. O2 RCE palet Dimensiuni Dimensiuni EQTGURNGKO2
0T#TV 2TGœO2 2TGœRCE 0T#TV Cantitate 2TGœO2 2TGœRCE CEQRGTKőEWRCPVà CEQRGTKőEWRCPVà
6386723 10 8,06 40,30 7,80 39,00 44 (mm) (mm)
8750263EQTGURNGKTQNà 5962331EQTGURNGKTQNà
8846248 20 9,13 137,00 8,80 132,00 12 pac. 18,86 67,90 1200 x 600 pac. (2,88 m2 ) 22,08 63,60
5574484 6373146 &GNC2CN
16
TQNG NGKO
1037
600 x 1000 x 60
8846249
8846250
EWHCNķ 13,75 139,00 13,25
EWHCNķ 22,49 130,00 21,80
134,00 12
126,00 12
palet (16 pac.) 18,27 65,80 x 100 palet (12 pac.) 21,53 62,00
8 m2
2
m2
&GNC2CN

TQNG NGKO2
5
4 41A*8A CTVKEQNWNPWGUVGFKURQPKDKN %QPFWEVKXKVCVGCVGTOKEà
.CODFC TGRTG\KPVàECRCEKVCVGCWPWKOCVGTKCNFGCVTCPUOKVGEàNFWTàCVWPEKE¾PF 0WWKVCœKEàCXGOOGTGWEGNGOCKOKEKRTGœWTK%WORàT¾PF
ÊPOCIC\KPWNFKP5KDKW GUVGUWRWUWPGKFKHGTGPķGFGVGORGTCVWTà%WE¾VEQPFWEVKXKVCVGCVGTOKEàGUVGOCKOKEàEWCV¾VK\QNCœKCGUVGOCKDWPà WPRCNGVEQORNGVXGœKDGPGHKEKCFGWPRTGœőKOCKCXCPVCLQU
.CEWTKőKXQRUGNGURGEKCNG 8QRUGCFGKPVGTKQT CEQRGTàÊPVTWPUKPIWTUVTCV %JKVWTKRGPVTWTGRCTCœKK
gata de utilizare gata de utilizare

Chit pentru
8QRUGCd/GKUVGT
%JKVFGEWķKV
2QNCT9GKUU
TGRCTCķKKƂUWTK FGPUKVCVGOKEà
Multi Filler 330 g
2NWUqN
XQRUGCCNDàOCVà 5WRGT(KNNGTON

189.-
RVKPVGTKQT - rezistent la WVKNK\CVRVWORNGTGC
RWVGTGHQCTVGOCTG
FGCEQRGTKTG
10 l intemperii
TGRCTCķKKEWCF¾PEKOK
IàWTKNQTőKHKUWTKNQT
OCTKFKPVTQ
TG\KUVGPķàTKFKECVà R¾PàNCOO UKPIWTàCRNKECTG
NCW\WTà RQVTKXKVRGPVTW RGDC\àFGTàőKPà
NRVEECO2 VGPEWKCNàEàTàOKFà CETKNKEàőKUHGTG

1430 1590
RTQVGEķKGÊPFGNWPICVà 7000913EQTGURNGKN RKCVTàDGVQPőKNGOP FGUKNKEGIQCNG
6770478EQTGUR 6770479EQTGUR
8QRUGCRGPVTW &GNC2CN
DWE NGKDWE NGKMI 330 g NGKON 200 ml

34 95
RCTFQUGNKN
RGPVTWKPVGTKQTőKGZVGTKQT gata de utilizare
RGPVTWDGVQPőCRàNGOP
TGEQOCPFCVàRVRGTUQCPGNGCNGTIKEG
RTQFWUGEQNQIKEFKHGTKVGPWCPķG CNDKOCEWNCV
NRVEECO²
%JKVFGEWķKVRV /QTVCTRVTGRCTCķKK
0500254EQTGURNGKN 0,75 l 8QRUGCOKPGTCNà FGPKXGNàTK(KPG
Filler 400 g
EWÊPVàTKTGMI
ÊPVàTKTGÊPOKPWVG
8QRUGC „Silikatfarbe UGWUWEàHàTà
RQVTKXKVRGPVTW
d4GPQXKGTYGKUUqN +PPGPqN UWDUVTCVWTKNGUQNKFGNC ETàRàVWTKUCW
CNDà CNDàOCVà
CURGEVNWEKQU
KPVGTKQTNGOP2#.őK OQFKHKECTGFGXQNWO
RGPVTWTGPQXàTKTGPVCDKNG KPQFQTà KFGCNRGPVTWTGRCTCTGC
ÊPVàTKVEWRQNKWTGVCP
RNàEKHKDTQNGOPQCUG
ECRCEKVCVGOCTG CEQRGTKTGHQCTVGDWPà VGPEWKGNKOKPGTCNG UEWTIGTKNQTCDC\KPGNQT

89 179.-
FGCEQRGTKTG TG\KUVGPVàNCW\WTà őKRKUEKPGNQTUCWRV
90 10 l UGWUWEàÊPOKP
8QRUGCRGPVTWITGUKG
NRVEECO2 NRVEECO2 UGRQCVGHQNQUKRGPVTW HKZCTGCőWTWDWTKNQT
15 l
.CERVRCTEJGVN őKHCKCPķàN
NWEKWOàVàUQUőKUVCDKN EWNQCTGCNDà 6761739EQTGURNGKN 5815342EQTGURNGKN WORNGTGCFGPKXGNàTKNQT UGRQCVGHQNQUKNC

1430 3290
TG\KUVGPVNCCDTC\KWPG FGUVKPCVàFGEQTàTKKRNàEKNQT &GNC2CN
DWE NGKDWE &GNC2CN
DWE NGKDWE FGR¾PàNCOO KPVGTKQTőKGZVGTKQT

39 62
6770481EQTGUR
őKNCOWTFàTKG
JKFTQHQD 95 EGTCOKEGFKPDWEàVàTKKőKDàK
WUECTGTCRKFàőKTG\KUVGPķàNC 90 6770480EQTGUR
NGKMI 400 g NGKMI 2 kg
NRVEECO² 0,75 l WOG\GCNà\I¾TKGVWTKKORCEV 1l
5509705EQTGURNGKN NRVEECO²5961922
RVURCķKKNGKPVGPUEKTEWNCVG

NOU
8QRUGCd5RQTDCKG

+
Chit colorat
őKDWEàVàTKGq
PWUGÊPIàNDGPGőVG XQRUGCNCXCDKNàCNDà %JKVRVNGOP
OCVàFGKPVGTKQT EJKVFGEWœKVRG
ÊPUQTVKOGPV 8QRUGCd.CVGZ RVNGOP
8QRUGCRVECNQTKHGTGN %GCTàRGPVTWRCTFQUGNK EWTG\KUVGPœàHQCTVG 5WRGTYGKUUqN RVGVCPőCTGC DC\àFGCRà
GOCKNCETKNKERGDC\à KPEQNQTà DWPàNCCEœKWPGC CNDà ETàRàVWTKNQT FKURQPKDKNÊPVWDFGIT
FGCRàRVRTQVGEķKCőK EQPHGTàWPNWEKWOàVàUQU OWEGICKWTKNQT NWEKWOàVàUQU FKPNGOP TG\KUVGPķàNCCRàHNGZKDKN
őKCHWPIKNQT HQCTVGTG\KUVGPVàNC EWNQTKFKHGTKVG CFGTGPķàHQCTVGDWPà
2QNKUGRVUQNWķKG
FGEQTCTGCECNQTKHGTGNQT TGUKUVGPķàNCOWTFàTKG
EWTG\KUVGPœàDWPà UQNKEKVCTGőKHTGECTG UVGLCTRKPOCJQP RGUWRTCHGķGNGOPQCUG
CPVKOWEGICKN
TG\KUVGPVNCVGORGTCVWTK JKFTQHWIà

69.- 52 139.- 185.-


NCOWTFàTKG ECRCEKVCVGOCTG VGCMECUVCP EWNQTKFKHGTKVGECTG
FGR¾PàNC°% 0,75 l WUECTGTCRKFà
90 8,5 l 10 l

1450 1590
EWNQCTGCND IRVEECO2 WUECTGTCRKFà FGCEQRGTKTG RCNKUCPFTWYGPIG UGRQVCOGUVGEC
NRVEECO² 5509708EQTGURNGKMI 350 g NRVEECO2 NRVEECO2 MI8822127 6770482EQTGUR
5534418EQTGURNGKN 7733022EQTGURNGKN 3111884EQTGURNGKN EQTGURNGKMI 400 g NGKMI 75 g

3
#EEGUQTKKRVXQRUKV Folie acoperire
 4
4CRKFőKEQOQF
4
6TCHCNGVd*QTPOCNq
2 FKOGPUKWPGZOITQUKOGO[RV NWPIKOGEORVXQRUGC 2KUVQNFGXQRUKV 5GTXKEKKRTQHGUKQPCNG
NWETàTKUKORNGFGTGPQXCVőKXQRUKVNC NCXCDKNàőKNCVGZ RWVGTG9 FG\WITàXKVőK
interior CUKIWTàQCEQRGTKTGHQCTVGDWPà
 
UGRQVCRNKEC
8130620EQTGURNGKO2 2,80 lei 4270155 18,50 lei
TGRCTCœKKRGTGœK
NCEWTKőKNC\WTK
2 )TàVCTFKPRNCUVKE  5GVXQRUKTGőKTGPQXCTGRKGUG XKVG\àFGNWETW )CTCPœKGUGTXKEKKCPK
ZEOEWNQCTGPGITW VàXKķàRVXQRUGCZEO ONOKP 8àNKRUGUEVKORWNEJGHWNUCWHQTķCFGOWPEàPGEGUCTG!

199.-
8470440 2,99 lei RGPUWNGNCVGőKOO ECRCEKVCVG 0QKXàRWVGOCLWVC5RGEKCNKĵVKKPQĵVTKRQVGHGEVWCNWETàTK
3 5GVRGPUWNG VTCHCNGVGEWTQNàRNWőCVàőK rezervor: buc.
FGOQPVCLÊPEGNOCKUEWTVVKORĵKICTCPV¾PFWXàEGNG
EQPķKPGRGPUWNGőKOO EO ON OCKDWPGTG\WNVCVG8GPKķKÊPOCIC\KPGNGPQCUVTGĵKEGTGķK
RàTÊPEJKUNCEWNQCTG3844166 16,90 lei URCVWNà5202064 27,30 lei 5615702 KPHQTOCķKK8GķKHKÊPFTWOCķKEWEGCOCKOCTGRNàEGTG
5GTXKEKKOKZCTGXQRUGNGőKNCEWTK
 41A*8A /KZàOR¾PàNCWPOKNKQPFGPWCPœG2WVGœKCXGCPWCPœCFQTKVàQTKE¾PFFCVQTKVàVGJPQNQIKGKKPQXCVKXGEGRGTOKVG &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG
r#XCPVCLQUr%CNKVCVKXr4CRKF
UECPCTGCőKTGRTQFWEGTGCEWNQTKKEJKCTőKFWRàQOQUVTàFGRGTGVG8àICTCPVàOEGCOCKDWPàECNKVCVG
Tapet tehnic Batem palma:
8QRUGCETGCVKXà Draperii / Perdele
/CKOWNVGOQFGNGFKURQPKDKNGÊPOCIC\KPGőKRGwww.hornbach.ro
/GTGWRTGœWTKOKEK 1 1
8QRUGCETGVCVà 2

Garantat!
6CRGVƂDTàFGUVKENà
ZOOQFGNQUFGRGőVG IO2
5615849 coresp. 6,96 lei/m2 N

174.- 29
RGDC\àFGCRà
TQNà
95
OCKOKEPQKXàQHGTKOCEGNCőK
&CEàCœKIàUKVNCEQPEWTGPœàWPCTVKEQNKFGPVKENCWPRTGœ RVURCķKKKPVGTKQCTG
RTGœRNWUQTGFWEGTGFG RWVGTGFGCEQRGTKTG
WUGNCCTVKEQNGNGEQOGTEKCNK\CVGRTKP RGTHGEVàKPQFQTà
8CNCDKNőKÊPEC\WNQHGTVGNQTRTQOQœKQPCNGőKRTGœWTKNQTTGF NGCTVKEQNGNQTFGUG\QPőKX¾P\àTKNG
GZEGRV ¾PFNKEJ KFàTKNGF GUVQEN KEJKFàTK UGCRNKEàRGNGOP
375 ml
KPVGTOGFKWNKPVG TPGVWNWK
QNGFKUR CTCVG( CEKNKVCVG CGUVGX CNCDKNàG ZENWUKXÊ PEQPFKœKKNGőKNKOKVàTKNGFKPTGIWNCOGPVWN
FGCTVKE IKRUECTVQPVGPEWKCNà
&GNC2CN
TQNG NGKTQNà GZRWURGUKVGWNYYYJQTPDCEJTQICTCPVKCRTGVWNWK
VCRGVDGVQP\KFàTKG
TGEQOCPFCVRV FKXGTUGEWNQTK
OQDKNàCTVKEQNG
Tapet FGEQTCVKXGRGTGķK
ONRVEECO2
1 Draperie Castellano,NàķKOGEOOCVGTKCNRQNKGUVGT
EWNQCTGVWTEQC\FGUKIPOQFGTP6647663 73,90 lei/m 2 Perdea
6280254 coresp. Capri,NàķKOGEOOCVGTKCNRQNKGUVGTTGEQOCPFCV
79,87 lei/l RVNKXKPIőKFQTOKVQTFGUKIPOQFGTP6647656 53,90 lei/m

8QRUGCNC\WTà

49 90
59 90
69 90 RGTNCVàN 1 1

69
CURGEVUKFGHCV
90 6CRGVXNKGU/QFGTP5WTHCEGU
TQNà TQNà TQNà 2
TG\KUVGPķàNCW\WTà
ZOOQFGNNGOPOCTQ 6CRGVXNKGUd5CXQ[q 6CRGVXNKGUUGTVCTG 6CRGVXNKGURCRCICNK őKÊPIàNDGPKTG
TQNà 6110890 coresp. 13,12 lei/m2 - 10,05 x 0,53 m - 10,05 x 0,53 m - 10,05 x 0,53 m TG\KUVGPķàNC
URàNCTGEWCRà
6552429 coresp. 9,37 lei/m2 5966540 coresp. 11,46 lei/m2 6415510 coresp. 13,12 lei/m2
CRNKECDKNRGUWRTCHCķG
FKPVGPEWKGNK
OKPGTCNGDGVQP
IKRUECTVQPGVE
EQPUWOO2/l
FKXGTUGEWNQTK GHGEVVGZVWTCVFGEQTCVKX
CWTKWOGVCNK\CV

84 90
DTQP\OGVCNK\CV
CTIKPVKWOGVCNK\CV 1 Draperie Zelda,NàķKOGEOOCVGTKCNRQNKGUVGTEWNQCTGCNDCUVTW
6689808/09/10 FGUKIPHNQTCN6647652/53 119,00 lei/m 2 Perdea Granada,NàķKOGEO
1,25 l
229.- 29 90 coresp. 67,92 lei/l OCVGTKCNRQNKGUVGTEWNQCTGCNDFGUKIPOQFGTP6647657 38,90 lei/m

64
TQNà
90

2990
TQNà TQNà
6CRGVJ¾TVKGd8KPVCIG
LGVoCKOGq10,05 x 0,53 m TTapet hârtie decor lemn Tapet hârtie perete Tapet hârtie decor
TQNà 6586818EQTGURNGKTQNà - 10,05 x 0,53 m EàTàOKFà10,05 x 0,53 m DWEàVàTKG10,05 x 0,53 m
5674946EQTGURNGKTQNà 6600174 coresp. 5,61 lei/m2 6242955EQTGURNGKTQNà 8QRUGCEWGHGEV 1
OGVCNKEN 2
FGUKIPGZENWUKX
UWRTCHCœCFG
acoperire
cca. 18 m2

225.-
CRNKECDKNRG 2,5 l
VGPEWKGNKőK
\WITàXGNK
KPVGTKQCTGVCRGV

6990 5990 6990


FKPJ¾TVKGUCW
GHGEVOGVCNKEKPVGPU
TG\KUVGPVNCCRàőKNCNWOKPà
UVTWEVWTCV

59
CURGEVUCVKPCV
90 6CRGVXNKGUd8GTOGKNq
TQNà TQNà TQNà
WőQTFGCRNKECV ECRCEKVCVGDWPàFGCEQRGTKTG
ZOOQFGNEW FKXGTUGEWNQTK 1 Draperie Sorrento,NàķKOGEOOCVGTKCNRQNKGUVGTFGUKIPCDUVTCEV
RQVTKXKTGFGECNCVà
6CRGVXNKGUQTPCOGPVG 6CRGVXNKGUQTPCOGPVG 6CRGVXNKGUd5QHVDNWUJq
6505190 110,00 lei/m 2 Perdea Cubix,NàķKOGEOOCVGTKCN
TQNà 6600824 coresp. 11,52 lei/m2 CNDCUVTG10,05 x 0,53 m DCTQE10,05 x 0,53 m - 10,05 x 0,53m 6376030 coresp.
90,00 lei/l RQNKGUVGTEWNQCTGETGOOCTQFGUKIPIGQOGVTKE6505179 75,90 lei/m
6572280 coresp. 13,12 lei/m2 8899472 coresp. 11,24 lei/m2 6591537 coresp. 13,12 lei/m2
Servicii comenzi 0WWKVCœKEàCXGOOGTGWEGNGOCKOKEKRTGœWTK
8 2GN¾PIàCTVKEQNGNGFGRGUVQECXGœKRQUKDKNKVCVGCUàEQOCPFCœK RO_HV_1118 &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 9
EQPHQTOPGEGUKVàœKNQTFXU6KORFGNKXTCTGÊPVTGőKUàRVàO¾PK %WORàT¾PFWPRCNGVEQORNGVXGœKDGPGHKEKCFGWPRTGœőKOCKCXCPVCLQU
6CDNQWTKÊPTàOCVG 6CDNQWTKECPXCU 6CDNQWTKUVKENà 4COGHQVQ
FKXGTUGOQFGNGőKFKOGPUKWPK FKXGTUGOQFGNGőKFKOGPUKWPKFGGZ FKXGTUGOQFGNGőKFKOGPUKWPKFGGZ
4COà
ZEO ZEO ZEO NOU
1995
CPVKSWG
ÊPUQTVKOGPV - 14,7 x 19,7 cm
OQFGNXKPVCIG
5851255 buc.

3490 buc. 2699 buc.


6800983/6800993/6800981/6800974 5593433/6395140/8681216/6395139
4590 buc.
ZEO ZEO 6801009/13/32/6086577/6424096

ZEO 4COà

1130
OWNVKRNà
- material:
buc.
plastic

5GTXKEKKÊPTàOàTK
- culoare:
CNDPGITW
- 30 x 30 cm
8844352/53

#NWOKPKWNGOPEWNQTKRWVGTPKEG!.CPQKCXGœKFGWPFGCNGIG
88.-
buc. 4COà
Profile aluminiu 2TQHKNG/&( Profile:
Pentru fiecare tablou, rama
RQVTKXKVà8àQHGTKOWPUQTVKOGPVFG
6086588/6132431
5869944
69 buc.
90
6791693/6791759/6800999
OWNVKRNà
SWCVVTQ 4990buc.
RGUVGFGRTQHKNGFKP/&(NGOP
őKFKPCNWOKPKW6QVWNFGNCRTQHKNG
VKODGT
FKPNGOPPGHKPKUCVR¾PàNCRTQHKNG ZEO ZEO ZEO

2290
pentru tablouri înnobilate manual - culoare: maro
EWHQKķàFKPCNKCLGOGVCNKEGHQKķàFG 6799389
CTIKPVUCWHQKķàFGCWT buc.
8681160/8681180/8681179/8681182
2CURCTVWWTK
#őG\CķKXàVCDNQWTKNGÊPECFTWN
RQVTKXKV#NGIGķKXàRCURCTVWWN
CUQTVCVVCDNQWNWKFWOPGCXQCUVTàFCT
őKDCIJGVCRQVTKXKVà+PFKHGTGPVEà
GUVGWPRCURCTVWFWDNWEWFGEWRàTK
OWNVKRNGUCWWPWNUVCPFCTF NOU
ÊPUQTVKOGPV

5VKENà
&KXGTUGVKRWTKFGUVKENàVàKCVGGZCEVRGOàUWTà5VKENC
RTQVGLGC\àUWRNKOGPVCTőKÊPRNWUQHGTàQDKGEVWNWK
FWOPGCXQCUVTàRTGHGTCVQUVTàNWEKTGURGEKCNà
6CDNQW
ÊPTàOCV
6WLFODQRUPDOàDYDQWDMHVWUàOXFLUHDEXQàDFXORULORU 4COà
98.-
6WLFODDQWLUHIOH[DYDQWDMHPDLSXķLQHUHIOH[LL CNEàVWKV buc.

145.-
OWNVKRNà
145.- 139.-
FKPTCOG
OQFGNITGGP
buc. buc. buc.
ZEO
kitchen - culoare: alb
6801089 6132405/6132406/6132408 5593500/6424203/6801024 5851249

10 RO_HV_1118 &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 11
6CDNGőKCEEGUQTKK Accesorii
$WTGVG )àUKœKÊPOCIC\KPGNG
magnetic *140$#%*VQVEGGCEG
FKOGPUKWPG
ZEO XàVTGDWKGRGPVTWOKEKKőK
OCTKKRCUKQPCœKFGRKEVWTà
690
WVKNK\CTGVCDNà
OCIPGVKEà
buc. 6736740

Set piuneze
- cantitate:
DWE

695
- culoare:
multicolor
set 6406080

Marker 2KEVWTà
RGPVTWVCDNà
WUECTGTCRKFà 5GVEWNQTKRCUVGNETGVCV 5GVEWNQTKCETKNKEG %WNQTKVGORGTC)KQVVQON %WNQCTGCETKNKEàON
UGRQVCRNKECEWRGPUWNCUCWEWķKVWN FKXGTUGEWNQTKUQNWDKNGÊPCRàUG TG\KUVGPķàQRVKOàNCNWOKPà

17.-
- culori foarte bine pigmentate
buc. őVGTIGTGWUECVà RQVHKCOGUVGECVGÊPVTGGNGUCWEWCRà FGRKEVWTàCFGTàRGTHGEVRGJ¾TVKG EWTàķàWőQTFGRGO¾KPKőKJCKPG RWVGTGOCTGFGCEQRGTKTGCURGEV
- culoare: alb
Vopsea pt. efect de 8366448 KFGCNGCV¾VRVCTVKőVKE¾VőKRV R¾P\àRKCVTàUCWEGTCOKEà WőQTFGCRNKECVEWRGPUWNC UGOKNWEKQUCFGTàRGQTKEGVKR
VCDNàFGUETKUN pictorii amatori 6528279 EQPķKPGVWDWTKZON6528286 6125684/87/89 FGUWRQTVEWNQTKETGCVGRGPVTW
CQDķKPGGHGEVGKPTGNKGH

1520 2380 1340 2410


- culoare: negru mat
FKNWCDKNEWCRàGEQNQIKEőKEWOKTQUTGFWU - ideale pentru tehnicile
NRVEECO2UVTCV ÊPEWķKVőCDNQP
set set 500 ml őKRGPUWNàCURTà 140 ml
5947995EQTGURNGKN

183.-
4QZQNKFDCPFà 7493560/65/76
UGWUWEàTCRKF
2,5 l mascare
EQPHGEķKQPCVà
din hârtie fin
TG\KUVGPVàNC\I¾TKGVWTK ETGRQPCVà
UGWVKNK\GC\à

1050
RGPVTWOCUECTG
UKIKNCTGHKZCTG 5WRQTVRKEVWTà 5WRQTVRKEVWTà)CNNGT[$QZ /CUEàECTVQP
/ UEà
6CDNàFKPRNWVà
6C TQNà ÊORCEJGVàTK UGVDWEàķKZEOEWNQCTGCND ZEOEWNQTKCNDPCVWT ZZEOEQPķKPGDWEàķK
FKOGPUKWPG WőQCTG - material: bumbac 7029821 OCVGTKCNECTVQPTG\KUVGPV

1060
- material:

25 63.-
ZEO
RVWVKNK\àTK
OOZO
5722611EQTGUR
90 DWODCE
lemn
buc. RGPVTWRKEVCVőKFGEQTCV
FKXGTUGOQFGNG set
multiple pe NGKO2 set 7279192 6528307/08/09/10
QTKEGUWRTCHCķà
OVGTKCNTCOà

3790
lemn
- culoare: natural 5GVOCIPGķK
buc. 77332327 - cantitate:

1095
DWE
- culoare: negru
set 6406066/67/68 2KEVWTàRGPWOGTGLWPKQTK 2KEVWTàRGPWOGTGRVCFWNœK ŐGXCNGV0CVWT 2CNGVàFKPRNCUVKERVRKEVWTà
WPUWEEGUNCőEQCNàőKDKTQW - culoare: alb/gri
6CDNà ZEOEQORWUFKPIQFGVG ZEOEQORWUFKPIQFGVG *EO FKURQPKDKNÊPHQTOàQXCNàőK
OCIPGVKEà RKEVWTàECTVQPZEO RKEVWTàECTVQPZEOZRGPUWNC - reglabil FTGRVWPIJKWNCTà7417520/21

4990
ZRGPUWNà FKXGTUGOQFGNG6733709 - din lemn de fag
FKOGPUKWPG FKXGTUG

3360 4290 6390 990


5225334
ZEO buc. /àPWőK modele
CEEGUQTKK 6733714
KPENWUGOCTMGT 6CDNàFGUETKU universale buc. buc. buc. buc.
EWTCFKGTà FKOGPUKWPGZEO din latex

39 34
OCIPGķKőK OàTKOG/.
90 90
- material rama: lemn
CIàķàVQTK WVKNK\CTGRVUETKUEWETGVà DWEUGV
buc. 8205624 6405827 pac. 5683016/17

 41A*8A &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 
5QTVKOGPVWTKCőWőKFGKPVGTKQTUEàTKRQFőKCEEGUQTKKÊPOCIC\KP
KPGőKRGwww.hornbach.ro 7őK28%
7őà28%KPVTCTG
- 86 x 205 cm
- deschidere
interioara stanga/
(QCKGFGWőà dreapta
7őàKPVTCTG28%
(QCKGWőà „Remscheid” PTECOGTG
(QCKGWőà
5ECTàFGRQFd0KQDGq
Yori Larice Pila 04 ÊPàNœKOGCECOGTGKEO - 98 x 198 cm - profil :Id 2000 Eco
Smoke UVKENà - 86 x 198,5 cm FGUEJKFGTGÊPRNCPőGWZEO - deschidere - toc: 60 mm
- 86 x 198,5 cm - 83,4 x - pal perforat - sarcina: 150 kg stânga/dreapta - canat special
- pal perforat 197,2 cm FKURQPKDKNà PWOàTFGVTGRVG - profil multicameral FGWőà<
FKRQPKDKNàőK - geam őKEWNàķKOKNG - grosimea treptei: 2,7 cm PVC - prag de aluminiu
EWNàķKOKNGFG securizat de 73,5 cm - adâncimea treptelor: 8 cm - grosime profil - panel ornamental
őKEO 8 mm őKEO ÊPàNœKOGCRCUWNWKEO 60 mm din PVC cu geam
- toc complet - toc complet - toc complet 8794235 - decupaj geam 1/3 sablat la ochiurile mânere cu shield interior-
ce include ce include ce include - toc inclus superioare
capac de izolare cu grosime: 33 mm 7877507/08 6301617/18
GZVGTKQTőKEKNKPFTWEWEJGK
pervaz pe o pervaz pe o pervaz pe o

519.- 977.-
parte 380 lei parte 300 lei parte 300 lei
XCNQCTG7
XGTKHKECVà 9OK buc. buc.
8863405/06 8523497 3833745/46 ÊPEJKFGTGÊPRWPEVG DCNCOCNG&DTQCUEàOWNVKRWPEV
#8#06#,15 $GPGHKEKCœK
340.- 390.- 445.- 339.-
buc. buc. buc. buc.
FGCPK
%#.+6#6+8 ICTCPœKG 7őàOGVCNKEà
RAPID RVNWETàTK 7őKOGVCNKEG „Modern”
(QCKGFGWőà (QCKGWőà - 88 x 201 cm
8àNKRUGUEVKORWNEJGHWNUCW Yori Larice (QCKGWőà 2KNC 5ECTàFGRQFd5QƂVCq - adâncimea tocului
125 mm
7őàOGVCNKEà
HQTœCFGOWPEàPGEGUCTG!0QKXà %CőOKT UVKENà - 86 x 198,5 cm ÊPàNœKOGCECOGTGKEO
„900 Geamika” KPVGTKQTWNHQKKFGWőà
RWVGOCLWVC5RGEKCNKőVKKPQőVTK - 86 x 198,5 cm - 83,4 x - pal perforat FGUEJKFGTGÊPRNCPőGWZEO
- sarcina: 150 kg - 89,5 x 200 cm EQORCEVVCDNàFG
RQVGHGEVWCNWETàTKFGOQPVCLÊP - pal perforat 197,2 cm FKURQPKDKNà - grosime: 90 mm 0,8 mm, grosime
PWOàTFGVTGRVG
EGNOCKUEWTVVKORőKICTCPV¾PFW FKRQPKDKNàőK - geam őKEWNàķKOKNG
- grosimea treptei: 2,7 cm TCOàWőàFKPVCDNà VCDNàVQEOO
XàEGNGOCKDWPGTG\WNVCVG8GPKœK EWNàķKOKNGFG securizat de 73,5 cm de 1,5 mm, toc din ICTPKVWTàFGGVCPőCTG
őKEO őKEO ÊPàNœKOGCRCUWNWKEO
ÊPOCIC\KPGNGPQCUVTGőKEGTGœK 8 mm
8794229 VCDNàFGOO VQEőKHQKFGWőà
KPHQTOCœKK8GœKHKÊPFTWOCœKEW - toc complet - toc complet - toc complet - MDF de 8 mm HCķCFGWőCTG\KUVGPVà
ce include ce include ce include K\QNCVàEW
EGCOCKOCTGRNàEGTG pervaz pe o pervaz pe o pervaz pe o
capac de izolare cu grosime: 33 mm la interior 3,2 mm
polistiren HDF PVC cu model
parte 380 lei parte 300 lei parte 300 lei expandat - 30 K\QNCVàEW
XCNQCTG7
XGTKHKECVà 9OK
8863433/34 8523499 5146919/20 mm grosime RQNKUVKTGP URWOà

340.- 429.- 450.- 527.-


buc. buc. buc. buc. 5748768/69 6356527/28

680.- 920.-
buc. [CNGRTGXà\WVGEWDTQCUEà buc. UKUVGOFGÊPEJKFGTG
EWDQNķWTKőKEJGK cu 7 puncte

Set de feronerie
7őàINKUCPVà
7őàOGVCNKEà
7őàINKUCPVà RVWőKFGUVKENà exterior „Malva”
lemn de brad 7őàOGVCNKEà - 205 x 88 cm
DNCVWNFGWőà UVKENàUCVKPCVà - utilizabil stânga/
dreapta „Maco Urban 940” - grosime foaie

NOU
- geam securizat
5ECTàRQFEW
este realizat din - aluminiu eloxat - 94 x 205 cm FGWőàOO
őKREKFGDTCF 8 mm, mat 8523496
K\QNCķKGd2CPQUq VCDNàFGQķGN EQPHGEķKQPCVàFKP
- dimensiuni 2050 x 850 ÊPàNķKOGCECOGTGKEO VCDNà\KPECVà

359.-
2134 x 965 x 35 galvanizat de 1,0
OO
NàķKOGZÊPàNķKOG buc. FGUEJKFGTGÊPRNCPőGW OOITQUKOGVCDNà ITQUKOGVCDNàHQCKGFG
ÊPUQTVKOGPV
- sistemul de
glisare TSQ din EQPķKPGHGTQPGTKC 120 x 60 cm toc 1,5 mm WőàOOITQUKOG
QķGNECTDQP FKPCNWOKPKW
őKPà - sarcina 150 kg - deschidere stânga VCDNàVQEOO

őKPàRTQHKN RTQHKNEàTWEKQCTG PWOàTVTGRVG / dreapta K\QNCVàEWXCVà
EàTWEKQCTG 2 opritoare, ghidaj ŐKPàKPQZRVWőà - adâncimea treptei: 8 cm - placaj pe ambele OKPGTCNàDC\CNVKEà
FGRCTFQUGCNàőKUGV ÊPàNķKOGCRCUWNWKEO
opritoare, ghidaj
ECRCEGNCVGTCNG INKUCPVà6KNFTC 8794237
HGķGEW/&(NCOKPCV RTGXC\WVàEWFWDNà
FGRCTFQUGCNà de 2 x 8,5 mm ICTPKVWTàCVCVRGVQE
6599879 790,00 lei RQVTKXKVàRVFGUEJKFGTKFGR¾PàNC
őKUGVECRCEG - feronerie Multipunct- E¾VőKRGHCNķWNWőKK
6599878 870,00 lei EONàķKOGőKEOÊPàNķKOG capac de izolare cu grosime: 60 mm
NCVGTCNG  Multisistem RTGXC\WVàEW
NWPIKOGCőKPGKEO8126763
6814641 DQNķWTK´OO RNàEWķàFGTGINCL
KPENWFGőKPCFGCNWOKPKW XCNQCTG7
XGTKHKECVà 9OK 6531612/13 6726043/44

790.- 969.- 619.- 1490.- 1790.-


include sistemul de glisare
buc. buc. buc. buc. RGPVTWHKGECTGDTQCUEà buc.
ECUGVàOGVCNKEàDNKPFCVà

1190.-
XQRUKVàÊPE¾ORGNGEVTQUVCVKEEW
buc. ÊPEWVKKFGQœGN XQRUGCTG\KUVGPVàNCKPVGORGTKK

Servicii comenzi
RO_HV_1118 Detalii despre serviciile noastre la paginile 2-3 2GN¾PIàCTVKEQNGNGFGRGUVQECXGœKRQUKDKNKVCVGCUàEQOCPFCœK 15
EQPHQTOPGEGUKVàœKNQTFXU6KORFGNKXTCTGÊPVTGőKUàRVàO¾PK
Parchet laminat Parchet triplustratificat Lambriu antichizat
EXCLUSIV
Parchet laminat la HORNBACH
7.2 Smoke stejar
-1383 x 193 x 9 mm natural
-pachet = 2,402 m2 NGOPTGEQPFKœKQPCVEWQ
6395252
vechime de 120 de ani

3090 m2
De la 1 Pal. ( = 105,69 m2) 29,90 lei/m2

Parchet laminat
stejar Parchet stejar 14.0
- 1383 x 193 x 8 mm - parchet
Parchet laminat

170.-
- pac. = 2,402 m2 triplustratificat
- sistem montare
dublu click
8.0 stejar alb
- 1380 x 193 x 8 mm
- dimensiune 14 x
188 x 2266 mm
whitewash pac.
6662053 - pac. = 2,131 m2 - pac. = 3,41 m2

25
blackwash

90
- sistem montare 6260147

75.-
dublu click 8766512
m
2
Lambriu antic whitewash/
42.-
m2
m 2 blackwash/natural
GHGEV&NWPIKOGEO
De la 1 Pal. ( = 124,90 m2) 25,12 lei/m2 De la 1 Pal. ( = 119,33 m2) 40,00 lei/m2 - pac. = 0,8 m²
6422462/63/6437869
Coresp. 212,50 lei/m²

HORNBACH
Parchet 2NCPKHKECVQTFGURCķKW
laminat 8.0 1PQWàXQRUGCFGKPVGTKQTWPPQWVCRGV
- 1380 x 244 x 8 mm
- pachet = 2,694 m2
QPQWàRCTFQUGCNàQTKEGUEJKODCTG
6087617 KPHNWGPœGC\àCVOQUHGTCÊPEàRGTKK
ªPVTGDCTGCGUVGEWOCPWOG!&GUEQRGTKœK

4290 m2
De la 1 Pal. ( = 113,14 m2) 39,90 lei/m2
aici: hornbach.ro/planificator

Potrivit pentru: Potrivit pentru: Potrivit pentru:


5RCœKKKPFWUVTKCNGEW 5RCœKKKPFWUVTKCNGEW 5RCœKKKPFWUVTKCNGEW
ÊPVTGDWKPœCTGTGFWUà ÊPVTGDWKPœCTGOGFKG ÊPVTGDWKPœCTGTKFKECVà

Parchet stejar
Parchet laminat VTKRNWUVTCVKƂCV Sistemul de
Parchet laminat
10.0 Marmaris 12.0 stejar hella - 1092 x 180 x 14 mm montare dublu 1 2 3
- 1380 x 157 x 10 mm
- pac. = 1,37 m2 ENKEMÊPRCőK
- 1283,5 x 153,7 x 10 mm - strat nobil 2,5 mm
- pac. = 1,293 m2 UKODQNK\GC\àECNKVCVGCRQFGNGNQTFG
- pachet = 1,38 m2 6783469 6013485
HORNBACH RCTEJGVUCWNCOKPCV5RGEVTWNRQTPGőVGFG

35.- 81.-
- sistem de montare

m2 m2
NCQUVGC
RGPVTWECNKVCVGOGFKG őKCLWPIG
Express Clic System
6087614
5KINCECNKVàœKK NCUVGNG
RGPVTWECNKVCVGGZEGRœKQPCNà 

55.-
m2
0WWKVCœKEàCXGOOGTGWEGNGOCKOKEK
RTGœWTK%WORàT¾PFWPRCNGVEQORNGVXGœK
De la 1 Pal. ( = 89,70 m2) 32,00 lei/m2 De la 1 Pal. ( = 52 m2) 53,00 lei/m2 De la 1 Pal. ( = 54,80 m2) 76,95 lei/m2 DGPGHKEKCFGWPRTGœőKOCKCXCPVCLQU
Ferestre de
O C P U C T F
TCOGFGGVCPőCTG
à EQGHKEKGPV7Y9O-
Ferestre
EQGHKEKGPV7Y9O- EQGHKEKGPV7Y9O-

(GTGCUVTà FGUEJKFGTGUKORNà FGUEJKFGTGFWDNà


FGOCPUCTFà
V¾ORNàTKGFKPNGOPUCW28%

780.-
O¾PGTEWVTGRVGFG
buc.
ÊPEJKFGTG
CTVKEWNCTGOGFKCPà de la Ferestre Ferestre
3/4 camere 6 camere
60
96 205.-
Nr. Art. Dimensiuni 6KRV¾ORNàTKG 2TGœDWE
EWNQCTGCNDà EWNQCTGUVGLCTCWTKW
buc.
7769563 55 x 78 cm NGOP
ICTCPœKGCPK 780,00 RTQHKNOO RTQHKNOO
7769582* 55 x 78 cm 28%
ICTCPœKGCPK 1.060,00 ECOGTG de la buc. ECOGTG de la
7769564 55 x 98 cm NGOP
ICTCPœKGCPK 870,00 Nr. Art. Nr. Art Nr. Art. Nr. Art

FGUEJKFGTGUV
FGUEJKFGTGFT Dimensiuni 2TGœDWE
FGUEJKFGTGUV
FGUEJKFGTGFT Dimensiuni 2TGœDWE
7769565 ZEO NGOP
ICTCPœKGCPK 890,00
7769566 ZEO NGOP
ICTCPœKGCPK 970,00 6632246 6632247 ZEO
ECOGTG 96,60 6632221 6632220 56 x 56 cm 205,00
8255988* ZEO NGOP
ICTCPœKGCPK 1.080,00 6632190 6632197 56 x 86 cm 165,00  GHVFKLGHUHEDVFXODQWà ZEO 340,00
7891591 78 x 98 cm NGOP
ICTCPœKGCPK 890,00 GHVFKLGHUHEDVFXODQWà ZEO 185,00 6632216 6632215 ZEO 405,00
8644618 ZEO NWOKPCVQT
ICTCPœKGCPK 440,00 6632191 6632192 75 x 75 cm 199,00 6632226* 6632225* ZEO 419,00
8626431 ZEO NWOKPCVQT
ICTCPœKGCPK 470,00 6632193 6632194 ZEO 215,00 6632219 6632218 ZEO 480,00
6632239 6632228 ZEO 235,00
8901638 8901639 ZEO 239,00
8901634
6632200
8901635
6632201
ZEO
ZEO
ECOGTG
242,00
266,00
7őK28%
6632195 6632196 ZEO 262,00
6632198 6632199 ZEO 274,00
6632217 6632206 ZEO 355,00
4COàFG Set mânere
GVCPőCTG'<8 RGőKNF
RVÊPXGNKVQTK EQGHKEKGPV7Y9O- RGPVTWWőK
QPFWNCVG
R¾PàNCQÊPàNķKOG
CRTQHKNWNWKFG
FGUEJKFGTGFWDNà 3099 set
FKPCNWOKPKW
28%6010863
EO
RVCEQRGTKőWTKEW
Servicii transport cu QRCPVà 7őà28%RNKPà

490.-
camion dotat cu macara FGITCFG Ferestre EWNQCTGCND
buc.
%QOGP\KNGFGFKOGPUKWPKőKXQNWOOCTK RGTOKVQÊODKPCTG
4 camere FGUEJKFGTGUV¾PICFTGCRVCC

270.-
XàRQVHKNKXTCVGEWCLWVQTWNECOKQPWNWK GVCPőà buc.

148.-
buc. RTCIFGCNWOKPKW de la
DCUEWNCDKNEWOCECTC&GVCNKKÊPOCIC\KP EWHGTGCUVTCFG EWNQCTGCNDà
OCPUCTFà de la RTQHKNOO Nr. Art. Nr. Art Dimensiuni 2TGœDWE Model
ECOGTG de la
FGUEJKFGTGUV
FGUEJKFGTGFT
Servicii transport Nr. Art. Dimensiuni 2TGœDWE 6632236 6632237 490,00 UVKENàOCVàCNDà
Nr. Art. Nr. Art 2TGœDWE ZEO
8àNKXTàOÊPEGNOCKUEWTVVKORRQUKDKN 7769600 55 x 78 cm 270,00
FGUEJKFGTGUV
FGUEJKFGTGFT Dimensiuni 6632230 6632231 515,00 RNKPàCNDà
RTQFWUGNGCEJK\KœKQPCVG&GVCNKKÊPOCIC\KP
Montaj ferestre 7769596 55 x 98 cm 270,00 6632203 6632202 56 x 56 cm 148,00 6632238 6632240 530,00 UVKENàOCVàCNDà
8àNKRUGUEVKORWNEJGHWNUCWHQTœCFGOWPEà 7769591 ZEO 330,00 6632205 6632204 52 x 82 cm 198,00 6632232 6632233 ZEO 515,00 RNKPàCNDà
TK
(QNQUKTGTGOQTEàITCVKU PGEGUCTG!0QKXàRWVGOCLWVC5RGEKCNKőVKKPQőV 7891595 78 x 98 cm 330,00 6632266 6632267 ZEO 275,00 6632241 6632242 540,00 UVKENàOCVàCNDà
RQVGHGEVWCNWETàTKFGOQPVCLÊPEGNOCKUEWTV
2WVGœKVTCPURQTVCUKPIWTKRTQFWUGNG VKORőKICTCPV¾PFWXàEGNGOCKDWPGTG\WNVCVG  7769584 ZEO 330,00 6632210 6632209 ZEO 385,00 6632234 6632235 515,00 RNKPàCNDà
XQNWOKPQCUGHàTàEQUVWTKUWRNKOGPVCTG 8GPKœKÊPOCIC\KPGNGPQCUVTGőKEGTGœKKPHQTOCœKK 7784482 ZEO 340,00 6632208 6632207 ZEO 420,00 6632243 6632244
ZEO
554,00 UVKENàOCVà
8GœKHKÊPFTWOCœKEWEGCOCKOCTGRNàEGTG

18 % QPFWEVKXKVCVGCVGTOKEà
.CODFC TGRTG\KPVàECRCEKVCVGCWPWKOCVGTKCNFGCVTCPUOKVGEàNFWTàCVWPEKE¾PF
41A*8A KPFKURQPKDKNÊPOCIC\KPWNFKP5KDKW &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 19
GUVGUWRWUWPGKFKHGTGPķGFGVGORGTCVWTà%WE¾VEQPFWEVKXKVCVGCVGTOKEàGUVGOCKOKEàEWCV¾VK\QNCœKCGUVGOCKDWPà
NOU Plafoniere/Aplice
NOU
d2CUEQCq 1 2 3 4 5
d.KVVNGVQPp OCVGTKCNQķGNUVKENà ÊPUQTVKOGPVV
ÊPUQTVKOGPV - culoare: alb opal 2NCHQPKGTàd(NWUJq
- material: metal, lemn - E27, 2 x maxim 60 W

110.-
- culoare: negru, .WUVTà # R¾PàNC' - IP 44 buc.
lemn natur 2NCHQPKGTà - diametru: 23 cm
- E27, 4 x - E27, 6 x maxim 60 W OCVGTKCNOGVCNUVKENà
# R¾PàNC' maxim
60 W ÊPàNķKOGEO - culoare: alb, crom
ÊPàNķKOG - diametru: 50 cm 8526159 UGRQCVGOQPVCőKÊPDCKG
6836877
116 cm # R¾PàNC'

745.-
6816109 buc.

499.-
2GPFWN
- E27, buc.
maxim
60 W
ÊPàNķKOG
110 cm
6816290

138.-
buc.
2NCHQPKGTà.'&d/QTCXCq
- 18 W, 1850 lumeni

184.-
- IP 44
- diametru: 34 cm buc.
- material: metal, plastic
#RNKEà6836882 - culoare: alb
- E27, maxim 60 W NWOKPàTGEG UGRQCVGOQPVCőKÊPDCKG
- 11 x 11,5 x 33 cm 1 - diametru: 16,5 cm 8867341
6587980 149,00 lei
.WUVTà

165.-
buc. - E27, 3 x maxim 60 W A+
- dim.: 19,5 x 78 x 150 cm 4 2GPFWN
2NCHQPKGTà 6587983 409,00 lei - E27, maxim 60 W
- E27, 3 x 2 2GPFWN ÊPàNķKOGEO
- diametru: 16 cm

NOU
maxim 60 W - E27, maxim 60 W
ÊPàNķKOGEO 6587981 149,00 lei
d6KNKCq ÊPàNķKOGEO
- diametru: 50 cm - diametru: 19,5 cm 5 2NCHQPKGTà
6587985
ÊPUQTVKOGPV
6587982 163,00 lei
#RNKEà.'&d0KCICTCq
- E27, maxim 60 W - E27, 3 x maxim 60 W
- 18 W, 1800 lumeni

719.-
- material: metal, buc. 3 ÊPàNķKOGEO - IP 44

NOU
2GPFWN
plastic - E27, maxim 60 W - diametru: 35 cm - dimensiuni: 5 x 9 x 53 cm
- culoare: alb
.CORCFCT d5CDKPCTq ÊPàNķKOGEO 6587984 449,00 lei - material: metal, plastic
ÊPàNķKOGEO

299.-
ÊPUQTVKOGPV - culoare: alb, crom buc.
# R¾PàNC' - diametru: 45 cm - E27, maxim 60 W
6804380 NWOKPàPGWVTà
OCVGTKCNQķGNNGOP

+400
6233010

299.-
FGCTVKEQNGFKURQPKDKNGUWRNKOGPVCT
buc. - culoare: alb,
lemn natur 2GPFWN .àORKFGDKTQW QPNKPGRGYYYJQTPDCEJTQ A+
ÊPàNķKOG
UGRQCVGOQPVCőKÊPDCKG
# R¾PàNC' 110 cm
- diametru: KPVGPUKVCVG
2GPFWN 40 cm
ÊPàNķKOGEO 6739139
NWOKPQCUà

299.-
XCTKCDKNà
- diametru: 40 cm buc.
6804379
2GPFWN
ÊPàNķKOG

159.-
buc. 110 cm
XCTKCVQTVCEVKN #RNKEà.'&d%QNQTCFQq5840963
- diametru: - 12 W, 1440 lumeni
28 cm ÊPàNķKOGTGINCDKNà - IP 44
NàķKOGEO
TCDCVCDKNà TCDCVCDKNà
6739141

469.-
- material: metal, plastic buc.

245.-
buc. - culoare: alb, crom

NOU 5790 7950 9490


2NCHQPKGTGd.WEECq NWOKPàTGEG
# R¾PàNC' buc. A buc. A++ buc. A+
- E14, maxim 28 W 6827695/96 ÊPUQTVKOGPV UGRQCVGOQPVCőKÊPDCKG
ÊPàNķKOGEOFKCOGVTWEO .CORàFGDKTQWd<CEMq .CORàFGDKTQW.'&d5VCTVq .CORàFGDKTQW.'&d.CTQCq
- material: metal, plastic - E14, maxim 40 W - 3 W, 200 lumeni - 4,5 W, 550 lumeni
- culoare: alb, gri / negru, auriu - dimensiuni: 16 x 16 x 61 cm ÊPàNķKOGEO - dimensiuni: 12 x 32,5 x 48 cm

280.-
buc. - material: metal, culoare: negru, - material: metal - material: metal
# R¾PàNC' verde, portocaliu, argintiu EWNQCTGQķGNETQO - culoare: alb/negru
6249166/67/68/69 NWOKPàECNFà8822272 NWOKPàPGWVTà6419967/69

20 %NCUCGPGTIGVKEàUGOàUQCTàRGQUECNàFGNC ªPEC\WNÊPECTGPWGUVGCNVHGNRTGEK\CVEQTRWTKNGFGKNWOKPCVUGEQOGTEKCNK\GC\àHàTàDGEWTKUCWVWDWTK
RO_HV_1118 Detalii despre serviciile noastre la paginile 2-3 21
# 
EGCOCKOCTGGHKEKGPœà R¾PàNC'
EGCOCKOKEàGHKEKGPœà 
41Ő7
Iluminat Smart FàXKCœà

90
xOKNKKQCPGFGEWNQTK

14

OKNKQCPG de tonuri coloristice


prin xKPVGPUKVCVGNWOKPQCUàXCTKCDKNà A+ A++
A++
Bec LED
A+
Bec LED
xRQUKDKNKVCVGCUGVàTKKVKORWNWK pac.
Crosslink
4GINGC\àNWOKPCCőCEWOÊœKFQTGőVK
FGCRTKPFGTGUVKPIGTG
Bec LED
TGƃGEVQT
9NO
UQENW)7
FWTCVà
Bec LED
lumânare
9NO
UQENW'
FWTCVà
#
- 11 W,
1300 lm
UQENW'
FWTCVà
TGƃGEVQT
9
800 lm
UQENW'
FWTCVà
Set 3 becuri LED
HQTOà)NWO¾PCTG
9NO
UQENW'
#KPGXQKGFQCTFGFQWàEQORQPGPVG FGXKCķà FGXKCķà FGXKCķà FGXKCķà FWTCVàFGXKCķà
A+
x7PDGE').1%TQUUNKPMWPEQTR J J J J J
50
FGKNWOKPCV').1%TQUUNKPM
x1VGNGEQOCPFà').1%TQUUNKPMUCW
5OCTVRJQPGVCDNGVàEWCRNKECœKCITCVWKVà
GALBEN
KPEKVà
NWOKPàECNFà
6602434 13 buc.
NWOKPàECNFà
5827439 1550 buc.
NWOKPàECNFà
6584048 2990 buc.
NWOKPàECNFà
6602312 2990 buc.
NWOKPàECNFà
6251293/94

$GP\KőKRTQHKNWTK.'&
#YQ:5OCTVEQPVTQN#PFTQKFK15
DGEKPVGPUKVàœKCNGNWOKPKK
Instalare Tehnologie 4GœGC
UKORNà KPVGNKIGPVà RTQVGLCVà A++ A+
A+ A+ A+
Bec LED

www.hornbach.ro/crosslink

VERDE
Bec LED
HQTOà)
- maxim 5 W,
OCZKONO
Bec LED
lumânare
- maxim 5 W,
OCZKONO
Bec LED
HQTOà#
- maxim 8,5 W,
maxim 806 lm
TGƃGEVQT
OCZKO9
OCZKONO
UQENW)7 $CPFà.'&
de la 3490 buc.
UQENW' UQENW' UQENW' FWTCVà 9ONNOOGVTW
GEJKNKDTGC\à FWTCVàFG FWTCVàFG FWTCVàFG FGXKCķà FWTCVàFGXKCķàJ
)COCd%TQUUNKPMq XKCķàJ XKCķàJ XKCķàJ J EWNQCTGECNFàRGPVTWKPVGTKQT+2
$GE.'&HQTOà#
- 9 W, 806 lm 125.-
buc.
OKNKQCPGFGEWNQTK
165.-
buc.
NWOKPàECNFà
6602319 1790 buc.
NWOKPàECNFà
6602318 1790 buc.
NWOKPàECNFà
6602410* 1990 buc.
NWOKPàECNFà
6602317 1990 buc.
TQNàOGVTK8883406NGK
RGPVTWGZVGTKQT+28883407 58,00 lei

UQENW'
NWOKPàCNDàEQNQTCVà $GE.'&HQTOà) A+
VGORGTCVWTàFG - 13 W, 1300 lm Bec LED
EWNQCTGXCTKCDKNà UQENW' HQTOà
NWOKPàECNFàTGEG NWOKPàCNDàEQNQTCVà A+
KPVGPUKVCVGNWOKPQCUà VGORGTCVWTàFGEWNQCTG A++ A++ #
XCTKCDKNà XCTKCDKNàNWOKPàECNFàTGEG
Bec LED - 18,5 W,
UGRQCVGUGVCEW KPVGPUKVCVGNWOKPQCUàXCTKCDKNà
Bec LED Bec LED TGƃGEVQT NO
#.$#5647
UOCTVRJQPGVCDNGVà UGRQCVGUGVCEWUOCTVRJQPG NKPKőVKVQT
ECRUWNà HQTOà# 9 UQENW'
VGNGEQOCPFà6770985 VCDNGVàVGNGEQOCPFà6770986 9NO 9NO 390 lm FWTCVà
UQENW) UQENW' UQENW' FGXKCķà FKHW\QTőKECRGVGKPENWUG
FWTCVà
FGXKCķà
J
FWTCVà
FGXKCķà
J
FWTCVà
FGXKCķà
J
J
NWOKPàECNFà
PGWVTàTGEG
2TQƂNDGP\K.'&
DCTàFGO
de la 2790
buc.

50 174.-
buc. NWOKPàECNFà
5792110 2250 buc.
NWOKPàECNFà
6362724 2490 buc.
NWOKPàECNFà
6756828 3190 buc.
6362903/
6546916/17 3290 buc.
- material: aluminiu, plastic
EWDCPFàCWVQCFG\KXà6501799NGK

84 445.-
buc.
de la DCTàFGO6501809NGK
buc.
5RQVÊPECUVTCDKNd(WGXCq DGEKPVGPUKVàœKCNGNWOKPKK KPVGPUKVCVGXCTKCDKNàCNWOKPKKECNFG
6GNGEQOCPFà 2NCHQPKGTà.'&d%QORGVCq 9NO´EO #NGIGFKPVTG
pentru sistemul 9NO´EO NWOKPàCNDàEQNQTCVà
NWOKPàCNDàEQNQTCVà VGORGTCVWTàFGEWNQCTGXCTKCDKNàNWOKPà VIOLET A+
de iluminat VGORGTCVWTàFGEWNQCTGXCTKCDKNàNWOKPà ECNFàTGEGKPVGPUKVCVGNWOKPQCUàXCTKCDKNà TGIGPGTGC\à A+ Bec LED Philips Bec LED Bec LED Philips A+
inteligent ECNFàTGEGKPVGPUKVCVGNWOKPQCUàXCTKCDKNà UGRQCVGUGVCEWUOCTVRJQPGVCDNGVà SceneSwitch: 9CTO)NQY
UGRQCVGUGVCEWUOCTVRJQPG VGNGEQOCPFà6770781/82NGK HQTOà# A+
Bec LED
Crosslink
VCDNGVàVGNGEQOCPFà6770513 9NO´EO6770783/85NGK
Bec LED - mai multe
9NO
- intensitate
6768093 TGƃGEVQT KPVGPUKVàœKCNGNWOKPKK
UQENW'
Bec LED XCTKCDKNàC HQTOà#
EWCEGNCőKDGE HQTOà2 NWOKPKK
- maxim 5 W, FWTCVàFGXKCķà - 8,5 W,
HWPEķKQPGC\à RàUVTGC\à
OCZKONO J 9NO 806 lm
EO
2CPGN.'&ÊPECUVTCDKNd5CNQDTGPCq
9NOFKOGPUKWPKZEO EWÊPVTGTWRàVQTWN EWNQCTGCECNFà
UQENW)7 NWOKPàECNFà UQENW' UQENW'
NWOKPàCNDàEQNQTCVàVGORGTCVWTàFGEWNQCTG FGLCGZKUVGPV CNWOKPKK
FWTCVàFGXKCķà PGWVTà FWTCVà FWTCVà
buc. XCTKCDKNàNWOKPàECNFàTGEGKPVGPUKVCVG - nu este necesar un - este necesar

735.- NWOKPQCUàXCTKCDKNàUGRQCVGUGVCEW
UOCTVRJQPGVCDNGVàVGNGEQOCPFà6770966
J
NWOKPàECNFà
6416321 3790 buc.
XCTKCVQTUWRNKOGPVCT 6560632
NWOKPàECNFà
6416322 6890 buc.
FGXKCķà
J
5792063 2490 buc.
WPXCTKCVQT
FGXKCķà
J
6065953 3690 buc.
Detalii despre serviciile ROZ %NCUCGPGTIGVKEàUGOàUQCTàRGQUECNàFGNC
 PQCUVTGNCRCIKPKNG 41A*8A # 
EGCOCKOCTGGHKEKGPœà R¾PàNC'
EGCOCKOKEàGHKEKGPœà  ªPNKOKVCUVQEWNWKFKURQPKDKN 
KPURKTà
/CKOWNVGRTQFWUGÊPOCIC\KPGőKRGwww.hornbach.ro
Mobilier baie RKEKQCTGETQOCVGTGINCDKNGKPENWUG
$CVGTKK
(KKO¾PFTWFG Mobilier „Desy”
)COCd#PEQPCp
 Baterie lavoarETQOFGUKIPENCUKE
EQPķKPGDC\àNCXQCT Mobilier Square TCEQTFHNGZKDKNECTVWőEGTCOKE
NCXQCTőKQINKPFà ZZEO OOXGPVKNKPENWU6548208 41,80 lei
QDCKGDKPG - dimensiune: 55 cm DC\àNCXQCTEWWőK  $CVGTKGECFàFWőOQPQEQOCPFà
- culoare: alb NCXQCTRàVTCVEO finisaj crom 6548205 67,00 lei 
- pal melaminat, front lucios QINKPFàCNDNWEKQU $CVGTKGFWőETQOFGUKIPENCUKE
- ambalaj compact 8626421 5514576 TCEQTFHNGZKDKNECTVWőEGTCOKE

198.- 399.-
buc. buc. mm, ventil inclus 6548206 48,00 lei
COGPCLCVà HWTVWPőKRCTà
FGFWőKPENWUG

/CKOWNVGRTQFWUGÊPOCIC\KPG
Mobilier „Gala City” Mobilier „Corallo”
őKRGwww.hornbach.ro EQPķKPGDC\àNCXQCT EQPķKPGDC\àNCXQCTőK  
őKNCXQCTEO NCXQCTEGTCOKEEO
ZZEO ZZEO
FQWàUGTVCTGEWÊPEJKFGTG - sertare cu închidere tip
tip soft-close soft-close, PAL melaminat,t, Gama „Felda“
DCVGTKCPWGUVGKPENWUà decor stejar nordic,  Baterie lavoarETQOECTVWő

Lavoare Vase WC NOU - maro 6736539 590,00 lei


- alb 6736538 575,00 lei
bateria nu este
KPENWUà6729464
EGTCOKEOOTCEQTFWTKHNGZKDKNG
OO)CGTCVQT/O¾PGT

590.- 1015.- NOU


ÊPUQTVKOGPV

NOU
Set vas WC buc. buc. FKPOGVCNICTPKVWTàFGUEWTIGTG
7116590 185,00 lei  Baterie
Lavoar „Repose” d%KV[q%NGCP1P ÊPUQTVKOGPV ÊPUQTVKOGPV
ECFàGECTVCOGPVOO
- ceramic, alb EGTCOKEàUCPKVCTà TCEQTFHWTVWPTCEQTFWTKÊP5őK
- dimensiune: 50 cm + Pachet Combo UEWTIGTGQTK\QPVCNà TQ\GVGTGINCDKNG7116502 222,00 lei
8452837 piedestal Repose, - vas WC ceramic ECRCEKVCVGTG\GTXQTN  $CVGTKGFGFWőTCEQTFWTKÊP5őK
ÊPàNķKOGEO53,13 lei - rezervor plastic - capac WC cu închidere 5GVWTKFWő TQ\GVGTGINCDKNG7116503 180,00 lei
8452836 - capac inclus 8836530 NGPVà6736522 G 55GVFWő$TGPVC
 EOZEO


56.- 215.- 640.-


buc. buc. buc.
RCTàFWőHKZàFKCOGVTW 5GVFWő
HàTàTCOàFGENàVKTG OORCTàFWő - furtun cromat  
OQDKNàHWPEķKK NWPIKOGO

599.- 2030
HWTVWPFWőO set RCTàFWő
HWPEķKG'CU[%NGCP HWPEķKK
55862295 7767061 buc. 
Lavoar 8CU9%UWURGPFCVd/GNKUUCq
ceramic Vas WC compact „Lider” - ceramic, alb
ECRCEGTIQPQOKEETGCV UEWTIGTGQTK\QPVCNà
„City” pe forma vasului WC ZEOZEO Gama „Get“
- dimensiune: CTOCVWTàNKVTK ECRCE9%őKUKUVGO
EODCVGTKCPWG CNDFGQUGDKVCNINC\WTKK de prindere incluse  Baterie lavoarECTVWőEGTCOKE
NOU
5GVFWő'WRJQTKC 5GVFWő0CRQNK
KPENWUà6736520 INC\WTCTGUWDTCOà8541254 6237198 ZEO HWPEķKK OONKOKVCVQTFGFGDKVCLWUVCDKN
HWTVWPFWő

189.- 279.- 665.-


buc. buc. buc.
- baterie cu termostat
OKPNOKP TCEQTFCNKOGPVCTG

1490.- 2990
RCTàFWőHKZàOO
ÊPUQTVKOGPV
buc. EO UGVGXCEWCTGEWVKLà UGV
MKVOQPVCLKPENWU HàTàTCOàFGENàVKTG DCTàFWőOO HWPEķKGCPVK racorduri 8273579 349,00 lei 

399.-
HWTVWPFWő5KNXGTHNGZ calar 6006758 buc. $CVGTKGECFàFWőETQOCVà, racord
set OO8592622 CNKOGPVCTG)ECTVWőOO

NOU
8273582 415,00 lei  $CVGTKGFWő
Lavoar tip
Pachet compact Facile Vas WC ÊPUQTVKOGPV NOU NOU ETQOCVàTCEQTFCNKOGPVCTG)
ECTVWőOO8273581 369,00 lei
EQNQCPàd#UVGTCq XCU9%EWGXCEWCTGNCVGTCNà UWURGPFCVd$CKCPQq 5KUVGOFGFWő ÊPUQTVKOGPV 5GVFGFWő ÊPUQTVKOGPV
- material mineral alb ZEO EGTCOKEàUCPKVCTà #NIGQUGVDCVGTKGFWő6386697
ZZEO
ÊPECUVTCVÊP KIKGPKEd2TGUUQq
TG\GTXQTEGTCOKEN UEWTIGTGQTK\QPVCNà EWUGVFWőHKZőKRCTàFWőOQDKNàDCTà 1 „Square” RCTàFGFWőOQDKNà 
UGOQPVGC\àRGRGTGVG - capac WC duroplast - capac WC din duroplast, OGVCNKEàTGINCDKNàOOFKUVCPķà #WVQ5VQR
- cu sistem RCTàFWőHKZà4CKPHCNN
antibacterian 5533232 ÊPàNķCVEWEO6574173 TGINCDKNàÊPVTGUWRQTķKRCTàFWőHKZà& ZEORCTàFWő HWTVWPFGFWőOO 
UEWTIGTGKPENWU

398.- 780.- 765.- 35.-


buc. buc. OORCTàFWőOQDKNà&OO OQDKNàHWPEķKG set - racord set
MI8612211 ECTVWőEGTCOKEUàRWPKGTàKPENWUà universal

1350.-
HWTVWPFWőEO
buc. UKUVGOCPVKECNECT(GTTQ'CU[%NGCP q6753681 
HàTàTCOàFGENàVKTG
- sistem anticalcar
(GTTQ'CU[%NGCP
6810556
41A*8A &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 
ŐGOKPGG5QDG UVKENàVGTOQTG\KUVGPVàR¾PàNC°%
ŐGOKPGW
ªPEàN\KTGGNGEVTKEà
ŐGOKPGW 2TGFGCN ŐGOKPGW
$WőVGPK
#GTQVGTOà
ŐGOKPGW GEQPQOKE - putere 6 kW
- combustibil: - putere 7 kW
„VK2002” %QPXGEVQT
EWDQNVà mic lemn, brichete - combustibil: lemn, - 3 trepte de reglare d%-q
- putere 9 KW - putere 5 kW de lemn EàTDWPGDTKEJGVG (rece-1000-2000 W) - 650-850
- combustibil - combustibil: - randament - consum 1,9 kg/h HWPEķKGQRTKTG - 1500 W
lemn butuci de lemn 70,5% - randament 73 % CWVQOCVàÊPEC\ - 10 x 50,5 x

38.- 7750
- 970 x 445 x - consum URCķKWFG URCķKWFGÊPEàN\KV FGTàUVWTPCTG buc. 28,5 cm
375 mm 1,8 kg/h ÊPEàN\KVEEC cca. 135 m3 - 13,5 x 22 x 26 cm - greutate 1,8 kg
- consum - 402 x 395 135 m3 - 426 x 524 x 7704586 8438007 buc.
3,4 kg/ h x 940 mm - 390 x 556 x 736 975 mm
5944552 8841335 mm 6479592 6479582
NOU NOU
519.- 579.- 1009.- 1209.- ªPEàN\KTGC
buc. buc. buc. buc.
#GTQVGTOà ÊPUQTVKOGPV #GTQVGTOà ÊPUQTVKOGPV
EGTCOKEàd5CHG FGDCKGd*.

WPGK
RKEKQCTGFKPQķGN WőQTFGVTCPURQTVCV
%CORq9 8$9q
5QDàVGTCEQVà 5QDàVGTCEQVà - 2 trepte de reglare - 2 trepte de
EWRNKVà 2TGOKWO4 (rece-1500 W)
UKIWTCPķà
putere: 1000-

- putere 7 KW
5QDàVGTCEQVà WőàEWUVKENà UWRTCÊPECN\KTG
2000W
RTQVGEķKGCPVK
T¾PFWTK RQNKķà OQDKNà - putere 9,8 KW VGTOQUVCVőK ÊPIJGķőKNC

ÊPEàRGTK
- combustibil: lemn - putere 7 kW - randament XGPVKNCVQT UWRTCÊPEàN\KTG
FKCOGVTWķGCXà - 1250 x 640 79,8% HWPEķKGQRTKTG CHKUCL.%&

110.- 197.-
GXCEWCTG x 460 mm - 4 rânduri CWVQOCVàÊPEC\ buc. control cu touch buc.
120 mm - greutate 270 kg 5QDàVGTCEQVàVKREK\Oà - combustibil: FGTàUVWTPCTG - programator
- 1080 x 465 TCEQTFEQő - putere 10 KW, 3 rânduri, tip lemn - 18,5 x 18,5 x 28 cm UàRVàO¾PCN
x 465 mm dimensiune combustibil: lemn,1000 x 1000 - 1110 x 400 6836168 24h / 7d
- greutate: 200 kg
8868722
120 mm
6569551
x 465 mm, stânga/dreapta
- greutate: 230 kg 5890219/30
x 505 mm
5898869
FGNCO3 6814391

1095.- 1179.- 1599.- 1985.-


buc. buc. buc. buc.
R¾PàNCO3) ªPEàN\KVQT

NOU 6GTOQőGOKPGW NOU NOU NOU


KPFWUVTKCN ªPEàN\KVQT
KPFWUVTKCN
%C\CPFKPHQPVà 6GTOQőGOKPGW
EGTCOKE
ÊPUQTVKOGPV ÊPUQTVKOGPV ÊPUQTVKOGPV ÊPUQTVKOGPV
6GTOQőGOKPGW
03.10.
GNGEVTKE
*GTEWNGU 5(4241 /KTCPQ2GNNGV
NOU
9
/KTCPQ* - 3 trepte de 9
- putere 18 kW - combustibil solid - putere 24 kW EàNFWTà
TGEG
NOU - termostat

- 02.12..
- putere 22 kW - combustibil: - putere: lemn 24 kw OGPPVV
ÊÊPUQTVKKO - combustibil: inclus
'ZRQ\KœKG 1500-3000 W)
- combustibil: lemn lemn, brichete EàTDWPGMY pelete RTQVGEķKGNC
în magaziPG
- termostat inclus ÊPUQTVKOGPV
FGHQEEàTDWPG EQPķKPWVFGCRàN

265.- 319.-
- consum: - consum 3 kg/h RTQVGEķKGNC buc. UWRTCÊPEàN\KTG buc.
- consum: 2,8 kg/h 6,0 kg/h XQNWOECOGTàFG - randament 92% UWRTCÊPEàN\KTG - 27 x 23 x 25 cm
- randament 76% ardere 42 dm3 URCķKWFG 6438023

2750
- randament őKTàUVWTPCTG
URCķKWFG 71,85% - diametrul racordului ÊPEàN\KVO3 - 38 x 29,5 x 34 cm
ÊPEàN\KVO3 - greutate: 140 kg NCEQőOO - 640 x 620 RCE 6079059
- 460 x 490 x 1050 - 470 x 585 x - 960 x 520 x 700 mm x 1040
6830894 1115 6633675 6830879 6830895 5¾TOàRVE¾TNKIG

1449.- 2450.- 2699.- 7220.-


buc. buc. buc. buc. RTKPFGTGECJNG 4CFKCVQT
NOU
- 3,25 x 450 mm /CUVGT
- 1 pachet are 50 buc.

#EEGUQTKK
de sârme 4611257 ÊPUQTVKOGPV EGTCOKEEW

559.-
%CRCEVGTOKPCN buc.
%QVKPQZ
IC\%4
RWVGTGOCZKOà
$WTNCPKPQZ %QVKPQZ - 45 grade EQőFGHWO 4,2 kW
- dimensiune: 950 mm - 90 grade - material: RTQVGEķKG - consum

5065 31.- 27.- 5430


OCVGTKCNVCDNàFKP OCVGTKCNVCDNàFKP buc. VCDNàFKPKPQZ buc. ÊORQVTKXCRNQKK OCZKOFGIC\

30 84
őK\àRG\KK
90 90
inox cu grosimea inox cu grosimea cu grosimea 0,31 kg/h ŐGOKPGWGNGEVTKEd5KGPCq
de 0,4 mm FGNC buc. de 0,4 mm FGNC de 0,4 mm FGNC material: inox FGNC buc. VKRIC\)2. - negru cu „efect” de
Nr. Art. Diametru 2TGœ Nr. Art. Diametru 2TGœ Nr. Art. Diametru 2TGœ Nr. Art. Diametru 2TGœ FGNC buc. buc. - 3 trepte reglare a flamei
reglare - 11 x 65,3 x 52 cm
5869419 120 mm 50,65 5869428 120 mm 31,00 5869425 120 mm 27,00 5611580 150 mm 54,30 2TQVGEķKGRCTFQUGCNà 5WRQTVNGOPG ÊPVTGTWRàVQT - putere: 0-900-1800 W
QķGNITQUKOGOO OCVGTKCNVCDNàOO

334.-
5869420 130 mm 51,50 5869429 130 mm 33,95 5869426 130 mm 30,15 5611581 160 mm 55,90 analitic buc. UKIWTCPķàUWRTCÊPEàN\KTG
- 50 x 60 cm 3723737 30,90 lei - 30 x 60 x 35 cm TQķKFGRNCUCTG VGNGEQOCPFàUVKENàEWTDCVà
5869421 150 mm 59,90 5869430 150 mm 39,20 5869427 150 mm 34,00 5611582 180 mm 61,45 - 60 x 80 cm 3723748 58,00 lei 5931351 5965250 8169671
Gresie 5GTKCd/GVTQp

(CKCPķàd/GVTQq
- 10 x 20 cm
- alb 8770211 38,30 lei/m2
Gresie „Teris” PGITW8770214 disponibil
- 15 x 90 cm 6786173 NCEQOCPFàNGKO2

54 90
38 30
RQTœGNCPCVà

m 2
m2
De la 1 Pal. ( = 43,92 m2) 52,90 lei/m2 De la 1 Pal. ( = 60 m2) 37,50 lei/m2

/Q\CKEd/GVTQq
EGTCOKERGRNCUà
- culoare verde
FKOGPUKWPGRNCEà
29,55 x 29,1cm
TGEQOCPFCVőK
pentru zonele
cu umiditate (CKCPķàd/GVTQq
Gresie Gresie HQCTVGTKFKECVà - verde
- 10 x 20 cm 6567936
„Pavimento” „Urban” 6509676 coresp.
- 60 x 60 cm - 60 x 60 cm 300,58 lei/m2
6758643 6758644

4099 m2
RQTœGNCPCVà

De la 1 Pal. ( = 43,20 m2) 38,99 lei/m2


4099 m2
RQTœGNCPCVà

De la 1 Pal. ( = 43,20 m2) 38,99 lei/m2 25 85


buc.
5490 m2
De la 1 Pal. ( = 60 m2) 52,90 lei/m2

/Q\CKEd/GVTQq
EGTCOKERGRNCUà
Gresie „Cambia” EWNQCTGITK
FKOGPUKWPGRNCEà
- 59,7 x 59,7 cm
29,55 x 29,1cm
- coeficient abraziune III
(CKCPķàd/GVTQq
TQőW TGEQOCPFCVőK
TG\KUVGPķàNCHTGECTG4
TG\KUV\GPķàNCÊPIJGķ - 10 x 20 cm 8770213 pentru zonele
cu umiditate
6787396
HQCTVGTKFKECVà

7999
RQTœGNCPCVà 6509675 coresp.

5990
300,58 lei/m2

2585
NCRRCVQ
m2 m2
De la 1 Pal. ( = 45,76 m ) 77,99 lei/m
2 2
De la 1 Pal. ( = 60 m2) 57,90 lei/m2 buc.
2QNKœG'VCLGTG4CHVWTK 4CHVFKP
NGOPRGPVTW
$CVGORCNOC: /CKOWNVGRTQFWUGÊPOCIC\KP
őKRGwww.hornbach.ro
/GTGW
G
ÊPEàNœàOKPVG #EEGUQTKKOQDKNKGT
- material: lemn
- material

RTGœWTKOKEK
RQNKķàRKP $WVQPRGPVTW
EWNQCTGTàőKPQU /¾PGTOQDKNà#PVKE OQDKNKGT#PVKE %WKGTRGPVTW
ZZ OCVGTKCN\COCM OCVGTKCN\COCM JCKPà#PVKE
OO ZZOO FKCOGVTWOO OCVGTKCN\COCM

)CTCPVCV
UCTEKPàOCZKOà FKCOVGTWOO NWPIKOGCF¾PEKOGOO ZZOO
RGTRQNKķàMI CURGEVCNCOà - aspect: argintiu brumat, - aspect: argintiu
PWOàTRQNKķG
7247923 5990 buc.
&CEàCœKIàUKVNCEQPEWTGPœàWPCTVKEQNKFGPVKENC
DTWOCVàCTIKPVKW
brumat
8602620/21 870
buc.
CNCOàDTWOCVà
cupru brumat
8602629/28/21 990 buc.
DTWOCVDTQP\CNCOà
DTWOCVàCNWOKPKW
5774358/59/56/57 1490 buc.
WPRTGœOCKOKEPQKXàQHGTKOCEGNCőKRTGœRNWUQ
TGFWEGTGFG
0KMC 8CNCDKNőKÊPEC\WNQHGTVGNQTRTQOQœKQPCNGőKRTGœWTKNQ
TTGFWUG
$WVQP %WKGTRGPVTW
5GVRQNKķGRVEQNķ NCCTVKEQNGNGEQOGTEKCNK\CVGRTKPKPVGTOGFKWNKPVGTP
GVWNWK
GZEGRV¾PFNKEJKFàTKNGFGUVQENKEJKFàTKNGCTVKEQNGNQTF
/¾PGTOQDKNà RGPVTWOQDKNKGT JCKPàőKRàNàTKG
90
47
WVKNK\CTGKPVGTKQTNGOPTàőKPQU GUG\QP OCVGTKCNQķGN OCVGTKCN\COCM OCVGTKCN\COCM
őKX¾P\àTKNGFGCTVKEQNGFKURCTCVG(CEKNKVCVGCGUVGXC
NCDKNà
UWRTCHCķàPGRTGNWETCV FKOGPUKWPGZOO FKCOGVTWOO ZZOO
7499
GZENWUKXÊPEQPFKœKKNGőKNKOKVàTKNGFKPTGIWNCOGPVWNGZ
RWURG
site-ul YYYJQTPDCEJTQICTCPVKCRTGVWNWK NWPIKOGCF¾PEKOGOO
2QNKķàTCHVRGTGVG de la buc. ZZOO
buc.
FKCOGVTWOO CURGEVCNCOàDTWOCVà

990 990 1790


CNDàZZOO ECRCEKVCVGOCZKOà CURGEVETQOCVQķGN - aspect: aluminiu, cromat, aluminiu, cromat,
RGTRQNKķàMI KPQZKFCDKNCNWOKPKWETQO PKEJGNCVCNCOà PKEJGNCVCNCOà
- PFL melaminat CEEGUQTKKKPENWUG CEEGUQTKKKPENWUG 7357668/69/70/5988543
UWUœKPGQITGWVCVGFG 6189834 7357570/71/72/5988526 buc. buc. 7587739/30/28/29/8602577 buc.
R¾PàNCMI7730626 47,90 lei
ZZOO7730622 55,90 lei
ZZOO7730624 67,90 lei 5GVFGOQPVCTGRV
5GVRTQƂNGFWDNG
5GVRQNKœGOGVCNKEGTCHV
NK G TCHV
HV FQWàWőKd6QR.KPGq
HKVKPIWTKWőKINKUCPVG
5KUVGOFGINKUCTG FGTWNCTGőKIJKFCTG
ZZOO
0KMC2QNKķGFKPNGOP
RGPVTWUVKENG
- material: metal, argintiu/alb
UCTEKPàOCZKOàMI7023237/35 5090 set
WőKd6QR.KPGq
OCVGTKCNQœGNICNXCPK\CV
RGPVTWWőKFKP
NGOPÊPFWNCRWTK
d6QR.KPGq
OCVGTKCNQķGNICNXCPK\CV

7999 1390 5790 8490


ITGWVCVGOCZKOà őKEQORCTVKOGPVG NWPIKOGOO
EWNQCTGTàőKOQU WőàMI FGECOGTà - culoare: alb/maro
ZZOO
buc. 8675795 buc. 2462671 buc. 2462659/60EQTGURNGKO buc.
ITGWVCVGRGTRQNKķàMI

5GVGVCLGTGFGEQTCVKXG
7490 set
EQPķKPWVDWECœK6189835
CEEGUQTKKKPENWUG
ŐKPàFWDNàFGRGTGVG 5WRQTVFWDNW $WTIJKW
RGPVTWTCHVWTKOQFWNCTG
$CNCOCCUEWPUà
à
CEEGUQTKKKPENWUG
RQNKķà RGPVTW

1290
ZZOO QķGNICNXCPK\CV
- utilizare: interior
EWUKUVGOFG
FKCOGVTWOO
DCNCOCNG
ZZOOZZOO - material: metal, argintiu/alb OCVGTKCNQœGN
DWEàķK5651884 pac.
CUCODNCTG5NKFG1P

550 3790
UCTEKPàOCZKOàMI - 1995 x 12 x 26 mm EWRCDTCœWNCTVKEWNCV FKCOGVTW
PGITWCNDUKUVGORTKPFGTGKPENWU8666459/60

0K
0KMC
UCTEKPàOCZKOàMI
7023203/7023195 1590 buc.
QœGNRNCECVEWPKEJGN
7781517 buc. 5GVFKDNWTK
FKPNGOP
26 mm
8675827 buc.

5KUVGOTCHVWTK
5K
7
- lemn: fag
5WRQTVENCRà
49
$WTIJKW
FGNGOP
FG
OO ZOO
WPIJKFG 5651854 pac.
RGPVTW
- uutilizare: FGUEJKFGTG DCNCOCNG
iinterior OCZ° OCVGTKCNQœGN
- material: lemn

1390 4290
OCVGTKCNQœGN FKCOGVTW
'VCLGTàFKPUVKENà8799114/16
5990
5GVőWTWDWTKFG
GUGPķàNGOP RNCECVEWPKEJGN OO
UVKENàCNDPGCITàZZOO buc. OQNKF 5800352 buc.
ÊODKPCTGEWECRCE
8675826 buc.

1390
Z ZOO
ZOO OCVGTKCNQœGN
ICNXCPK\CV5651849 pac.

650
- capacitate
OCZKOàMI
5GVUWRQTœKTGINCDKNK
ŐCDNQPFG
PWOàTFG buc.
RGPVTWGVCLGTà
OCTECTG
RQNKķG
5GVTCEQTFWTK
RTKPFGTGENKRUOCVGTKCN\COCEE ÊPEàTECTG
CEEGUQTKKKPENWUG 5WRQTVUKORNWTCHV ŐKPàFGUWURGPUKG FGEQPGZKWPG RGPVTWICWTà
RGőKPàRGPVTW
34 1050
CTIKPVKWETQOUWRTCHCķàOCVà OCZKOàRG - material: zinc turnat
90
/WNVK$NWG
90
34 169.-
buc. RGPVTWFWNCR
- material: plastic
ZZOOUCTEKPà RQNKķàMI TCHVWTKOQFWNCTG OCVGTKCNQķGN FKCOGVTWOO
3504925
OCZKOàMI3877560/61 set 6186492 ZZOO ICNXCPK\CV5160740 buc. 5800329 pac.

90
 41A*8A &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG
OCVGTKCNQķGCTIKPVKWCND
UCTEKPàOCZKOàRGPVTW
UWRQTķKMI7023183/65 3 buc.
Sortiment bogat!
ªPOCIC\KPWNPQUVTWIàUKœKWPUQTVKOGPVDQICVFG
CEEGUQTKKPGEGUCTG6QVWNOGTGWRGUVQE

(CEGœKCNGIGTGC
(CEGœKCNGIGTGCEQTGEVà

549.-
EQTGEVà
QVTKXKV G
#EGUVGOCőKPK$QUEJUWPV #EGUVGOCőKPK$QUEJUWPVR buc. 2QNK\QTWPIJKWNCTd)#q
EKVCPVG TKE QPV KPW G - putere: 2200 W
RQVTKXKVGRGPVTWUCTEKPKUQNK RGPVTWUCTEKPKITGNGőKWVKNK\à %WCLWVQTWN FKCOGVTWFKUEOO
őKWVKNK\àTKTGIWNCVG

248.-
buc. DCTQOGVTWNWKRGPVTW HKNGVCTDQTG/:
XKVG\àFGTQVCķKGÊPIQNTQVOKP
ITGWVCVGMI7214970
OCőKPKXGœKRWVGC

379.-
%KQECPTQVQRGTEWVQT
buc.
CNGIGGZCEVRTQFWUWN
(GTàUVTàWEKTEWNCTd2-5#q 2QNK\QTWPIJKWNCT 5&5RNWU

399.-
RQVTKXKVRTQKGEVWNWK
RWVGTG9
buc.
d)95q d)$*&q
XKVG\àFGTQVCķKGÊPIQN
FXU
RWVGTG9 RWVGTG9
TQVOKP FKCOGVTWFKUEOOOCPFTKPà/ GPGTIKGFGKORCEV,FKCOGVTWOCZKO 1CNGIGTGDWPàXàUEWVGőVG
CF¾PEKOGVàKGTG
NGOP XKVG\àFGTQVCķKGÊPIQNTQVOKP DWTIJKGTG
QķGNDGVQPNGOP OO FGEQUVWTKUWRNKOGPVCTG
CNWOKPKWQķGN OO WVKNK\CTGNCRGTKGTGÊPFGRàTVCTGTWIKPà XKVG\àFGTQVCķKGÊPIQNOCZKOTQVOKP
ITGWVCVGMI7997219 őNGHWKTGFGITQUCTGVàKGTGFGDKVCTG6094432 ITGWVCVGMI6094349 G
'EJKRCOGPVFGRTQVGEœKGRGPVTWUG\QPWNTGE
UGVDWTIJKGRVRKCVTà

329.- 332.- 399.-


UCEFGCURKTCTGKPVGITCV
buc. buc. buc.

699.- 639.-
buc. buc. ŐCREàRGPVTWKCTPà
d.KQP9KPVGTq

1790
%àOCőàFKPƃCPGN
OCVGTKCNHNGGEG
RQNKGUVGT RGPVTWKCTPà
OàTKOGWPKEà6506167 buc. d,QPCJ9KPVGTq
OCVGTKCN
ŐNGHWKVQTEWXKDTCķKKd)55#'q /CőKPàFGIàWTKV
RWVGTG9 DWODCEIO2
ŐNGHWKVQTEWXKDTCķKK ŐNGHWKVQTEWGZEGPVTKE EWRGTEWķKGd)5$4'q
d255#'q7293299 d2':#'q8470864
7990
FKOGPUKWPKVCNRàZOO RWVGTG9 K[QNCķKG
(GTàUVàWRGPFWNCTd256 /àPWőKFGNWETW
RWVGTG9UWRQTVFG RWVGTG9 2'.%6q8209013 PWOàTQUEKNCķKKÊPIQNXKDTCķKKOKP FKCOGVTWOCZKODWTIJKGTG
NGOP d9KPVGT)TKRq RQNKGUVGTIO2
őNGHWKVZOO FKCOGVTWFKUECDTC\KXOO - putere: 620 W HKZCTGOCVGTKCNCDTC\KXÊPEJKFGTG \KFàTKGQķGN OO RTQVGEķKGTKFKECVà EWNQCTGCNDCUVTW buc.

1290
PWOàTQUEKNCķKKÊPIQN PWOàTQUEKNCķKKÊPIQN VWTCķKGOCZKOàQUEKNCķKK EWUECK
XGNETQ őKVGPUKQPCTG XKVG\àFGTQVCķKGÊPIQNOCZKOTQVOKP RGPVTWUG\QPWNTGEG PGITW
XKDTCķKKOKPITGWVCVG XKDTCķKKOKP OKPIàWTKTGOCZKOàNGOP UGVFGNKXTCTGRGTHQTCVQTEWVKGFG FGUEJKFGTGOCPFTKPàOOOO OàTKOG OàTKOK/:.
MIRCEKPENWFGHQKFGőNGHWKV WVKNK\CTGNCőNGHWKTGRQNKUCTG CNWOKPKWQķGNOO OKETQHKNVTCTGHQKCDTC\KXG%6093724 EWRNWOCZKO0O6094348 8783724/7968733/34/8454657 pereche 5859802/03/04/05/06

ÊPEàTECTGÊPFGOKPWVG

255.- 379.- 390.- 539.- 599.-


,CEJGVàEWINWIà
buc. buc. buc. buc. buc. FGVCőCDKNà
d2JKNKRq
OCVGTKCN
RQNKGUVGT
VàKGTGQDNKEà

219.- 8990
/CőKPàFGIàWTKVEW /CőKPàFGIàWTKVőK OKETQHKDTà buc.
K\QNCœKG
%KQECPTQVQRGTEWVQT /CőKPàFGIàWTKVEW (GTàUVTàW 2QNCTd/KEJCGNq buc.
RQNKGUVGT OCVGTKCNHNGGEG
RGTEWķKGd'CU[+ORCEV d2$*4'q CEWOWNCVQTd'CU[&TKNNq EKTEWNCTd)-5q ÊPőWTWDCVEWCEWOWNCVQTK
q RWVGTG9 CEWOWNCVQT.K+QP8#J RWVGTG9 d)54.Kq FGPUKVCVGIO2 RQNKGUVGT
RWVGTG9 GPGTIKGFGKORCEV, FKCOGVTWOCZKODWTIJKGTG XKVG\àFGTQVCķKGÊPIQNTQVOKP CEWOWNCVQTK.K+QP8#J KORGTOGCDKNKVCVG FGPUKVCVGIO2
FKCOGVTWOCZKODWTIJKGTG FKCOGVTWOCZKODWTIJKGTG
QķGN NGOPOO CF¾PEKOGOCZKOàFGVàKGTGÊPNGOPOO EWRNWOCZKO0O R¾PàNCOO EWNQCTGTQőW

NGOPQķGNDGVQP OO DGVQPNGOP OO XKVG\àFGTQVCķKGÊPIQN FKCOGVTWR¾P\àOO XKVG\àFGTQVCķKGÊPIQNOCZKOTQVOKP EàRVWőGCNà XGTFGCNDCUVTW
XKVG\àFGTQVCķKGÊPIQNOCZKO XKVG\àFGTQVCķKGÊPIQNOCZKO OCZKOTQVOKP UGVFGNKXTCTGR¾P\àFGHGTàUVTàWNKOKVCVQT UGVWNEQPœKPGCEWOWNCVQTKÊPEàTEàVQT OCVNCUCVàFKPPCKNQPPGCITà OàTKOK5:.
TQVOKP6348696 TQVOKP8643081 EWRNWOCZKO0O6141527 RCTCNGNEJGKGJGZCIQPCNà6097608 TCRKFUGVDKķKRKGUG6094345 OàTKOK5:.6483181/82/83/84/85/86 6483168/69/70/71/72/73

2CPVCNQPKFGNWETW $QECPEKFGRTQVGEœKG
#EEGUQTKK &KUERGPVTWFGDKVCV 5GVDWTIJKG &CNVàEW
5GVDWTIJKG KORGTOGCDKNK ÊODNàPKķK

51
NGOPOO RGPVTWNGOP

90 9990
X¾THCUEWķKV d2JCPVQOq
FKCOGVTWGZVOO
RGPVTWOGVCN
OCVGTKCN
d:2TQ.KPGq &CNVàEWX¾TH d(+49+05q
FKCOGVTWKPVOO RKGUG OCVGTKCNRKGNGFGDQXKPà

76
5&5OCZ
90 RQN[GUVGTURCPFGZ
d2TQ$QZq
FKCOGVTW

149.-
ITQUKOGOO RKGUG FKOGPUKWPK
NCV5&5RNWU
OGODTCPà627 buc. VCNRàFKPRQNKWTGVCP pereche
buc. FKPķK6108706 buc. FKOGPUKWPK OO FKCOGVTW OO
TG\KUVGPVàNCCRà FWDNàFGPUKVCVG
 6091812 OO NWPIKOG CPVKUVCVKEàTG\KUVGPVà
NWPIKOGVQVCNà VQVCNà EàRVWőGCNàHNGGEG
 NCWNGKWTKőKEàNFWTàFG

2990
5GVDKķK
&KUEWPKXGTUCN OO OO OKETQRQNCT KORGTOGCDKNKR¾PàNCOO
RKGUGq  RQN[GUVGTIO2 EQPVCEVR¾PàNC°%
WTOàVQCTGNG OO NWPIKOGFG NWPIKOGFG DQODGWOGVCNKEőKNCOGNà
set
FKCOCPVCVOO
FKCOGVTWGZVOO NWETWOO NWETWOO OàTKOK5:::.
VKRWTK6QTZ OCVGTKCN RQN[GUVGTÊP CPVKRGTHQTCœKGOGVCNKEà
2JKNKRU FKCOGVTWKPV *55) 7332433 8498999 RKGNGJKFTQHQDK\CVà
\QPCIGPWPEJKNQT

190.- 119.- 4990 6950


2Q\KFTKX5EJNKV\ OO buc. &+0 set OàTKOK
OCZKOTQVOKP DW\WPCTGEWHGTOQCT
6091815 6091834 6198742-46/5859771-78
QķGNECNKVCVGUWRGTKQCTà
6091845 buc. buc. NWPIKOGCLWUVCDKNà
EWCLWVQTWNWPQT
ECRUGVCNKGGNCUVKEà
 41A*8A &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 6198773/6198774/75/76 
%[ENCOGPRGTUKEWO8298496 5CEKWVà
ķGUàVWTà
RTGHGTàNQEWTKNWOKPQCUGőKTàEQTQCUG
FGEQTCVKXà
VTGDWKGUàHKGHGTKVàFGTC\GNGFKTGEVGCNGUQCTGNWK
pentru protejarea

ÎN FORMĂ
FKHGTKVGEWNQTKTQőWTQ\CND

1999
plantelor
ÊPIJKXGEKEWFKCOGVTWNFGEO
ÊORQVTKXC
buc. ÊPIJGķWNWK

PENTRU IARNĂ
- material:
KWVàPCVWT
ZEO
6541650

1499 buc.

89.-
buc. 2JCNCGPQRUKU #PVJWTKWO
TKKWO 333955599
Floarea Flamingo
OKZV*EO WFCķKPWOCKE¾PFUQNWNUGWUWEàCTGPGXQKGFG
1TJKFGGCHNWVWTG *WUàKCTPà
NWOKPàRGPVTWCÊPHNQTKFCTPWUQCTGFKTGEVFKHGTKVG
RNCPVàWőQT EWNQTKÊPIJKXGEKEWFKCOGVTWNFGEO VTCPFCƂTK
5GVUVGCI
29 99
de crescut în JWUCCEQRGTà
4QOCPKC NCPEG apartament întreaga
FKO:EO CTGPGXQKGFG buc. UWRTCHCķàC
NWOKPàWOKFKVCVG
07.11. – 02.12.
- din poliester trandafirului,
IO őKEàNFWTà RTQVGL¾PF
NCPEGNGOPO VKLàFKXGTUG CUVHGNÊORQVTKXC
6186184 culori ÊPECFTWNFGR)TàFKPà X¾PVWNWKőK

1590
ÊPIJKXGEKEW ÊPIJGķWNWK
FKCOGVTWNFGEO

2NCPVGRGPVTWKPVGTKQT
- material: fleece,
5601025 buc. EWNQCTGXGTFG

PREGĂTIRE A OPTIMĂ
ZEO
KPENWFGőPWT ITGWVCVGI
FGÊPEJKFGTG m 6541664
PENTRU SEZONUL RECE
%%CNCVJGC 2NCPVGUWEWNGPVG %NKXKC/KPKCVC 1TJKFGG&GPFTQDKWO
PFTQDK
2999 buc.
2àO¾PV5QNWœKKÊPVTGœKPGTG
2NCPVCRàWP OKZVGÊP-QMQFCOC %TKPFGECOGTà Polar Fire
HTWP\GGZVTGO ÊPIJKXGEKFKPHKDTà ETGőVGUWD NQEFGCORNCUCTGNWOKPQUHàTàGZRWPGTG
FGFGEQTCVKXG FGEQEQUEO HQTOàFGVWHà FKTGEVàNCUQCTGNGFGCOKC\à
RTGHGTàURCķKKNGEW RNCPVCÊőKIàUGőVG - flori grupate ÊPHNQTGőVGFKPKCTPàR¾PàÊPRTKOàXCTà
ÊPIJKXGEKFGEO7111029

5499
NWOKPàKPFKTGEVà habitatul natural de culoare
- contribuie la ÊPURCķKWKPVGTKQT portocaliu ªPITàőàO¾PV
purificarea - se pot suspenda KPVGPUTQőW buc. 2àO¾PV 2àO¾PV
CGTWNWKÊPECOGTà FGGZGORNW oranj DCVQPQTJKFGG WPKXGTUCNƃQTK QTJKFGG

19 39 49
ÊPIJKXGEK ÊPIJKXGEK GUVGWőQTFG TGRTG\KPVà RàO¾PVFGÊPCNVà
99 99 99
Bromelii, Crassula,
FGEO 'UEJGXGTKCGVE FGEO HQNQUKVCUKIWTà un supliment calitate pentru
7492353 buc. 6560753/4/5/60 buc. 2301635 buc. PWVTKGPķKKFGDC\à PWVTKVKXRGPVTW toate tipurile
őKOKETQGNGOGPVGNG ETGőVGTGCQRVKOà de orhidee

799 1949
0GRJTQNGRKU necesare

1399
a plantelor - la sac de plastic
FG\XQNVàTKKRNCPVGK - în sac plastic FGN1740643
)TGGP.CF[ ECPVKVCVGDWEàķK buc. FGN1720009 5l EQTGURNGKN 5l
(GTKICFGECOGTà 6337524 EQTGURNGKN
RNCPVàFG
interior, 5EJNWODGTIGTC
FGEQTCVKXà %CEVWUWNFG 5VGRJCPQVKU ªPITàőàO¾PVNKEJKF
RTKPHTWP\G %TàEKWP +CUQOKCFG ªPITàőàO¾PV
ªPITàőàO¾PV RGPVTWRNCPVGXGT\K
- contribuie la ÊPHNQTGőVGFKP /CFCICUECT NKEJKFRGPVTW UGWVKNK\GC\àEC
purificarea PQKGODTKGR¾Pà PGEGUKVàOWNVà
QTJKFGG RNCPVGEW UQNWķKGFKNWCVàÊPCKPVG
CGTWNWKÊPECOGTà NWOKPà
RTGHGTà
în februarie
ÊPàNķKOGCRTQZ - florile sunt - conceput special ƃQTK. FGHQNQUKTGUGCIKVà
semiumbra EO grupate pentru orhidee - recomandat DKPGHNCEQPWNőKUG
ÊPIJKXGEKEW ÊPIJKXGEKEW őKHQCTVG EQODKPCķKCFG RGPVTWJTàPKTGC VQCTPàWPECRCEFG
PWVTKGPķKCUKIWTàQ plantelor cu flori ONÊPNCRà

2199 3299 4599


diametrul diametrul parfumate

1499 1999 1999


FGEO FGEO ÊPIJKXGEKEO ÊPHNQTKTGFGFWTCVà CUKIWTàCDWPFGPķC - amestecul format se
8695456 buc. 2300701 buc. 3198127 buc. URQTGőVGTG\KUVGPķC înfloririi CRNKEàDC\CRNCPVGK
.6503697 1l .6503668 1l .6503673 1l

 41A*8A &GVCNKKFGURTGUGTXKEKKNGPQCUVTGNCRCIKPKNG 
$TKEJGVG2GNGķK.GOPFGHQE (TG\GFG\àRCFà
(TG\àFG\àRCFà
2CT¾PI6541594
OQVQTM9
%2 
.WOKPKRGPVTWÊORQFQDKTGC ETGGC\àWPCODKGPVRNàEWV
RGPVTW\KNGNGFGUàTDàVQCTG

ECUGKNCGZVGTKQT
4 timpi, 163 cm3 6WDNWOKPQU
NàķKOGFGNWETWEO

2
FKURQPKDKNÊPFKXGTUGEWNQTKK

45
CF¾PEKOGFGNWETWEO
KPUVCNCTGWőQCTà
IWTàFGGXCEWCTG
FGUKIPURGEKCN
TQVCVKXà°

10 10
NWOKPQ\KVCVGOCTG
99 99 VTCPUOKUKGFKUEHTKEķKWPG
7787381
buc. buc. XKVG\GÊPCKPVG
EQTGURNGKTQNà m
1749.-
$TKEJGVGEKNKPFTKEG XKVG\àÊPCRQK buc.
&GNC2CN &GNC2CN RQTPKTGGNGEVTKEàOCPWCNà
$TKEJGVG47(
DWE FKPNGOPFGHQKQCUG
DWE FKUVCPķCFGTGHWNCTGO
FKPTWOGIWőFGHCI NGKDWE WOKFKVCVGUWD NGKDWE
WOKFKVCVGUWD TGUVEGPWőà
TGUVEGPWőàRWVGTGECNQTKEà/,MI UKNKEKWRWVGTGECNQTKEà/,MI 6WDNWOKPQU.'&
ITGWVCVGMI5976492EQTGURNGKMI ITGWVCVGMI6487949EQTGURNGKMI
(TG\àFG\àRCFà FKURQPKDKNÊPFKXGTUGEWNQTK
.'&WTKOGVTWNKPKCT EQUVWTK
#46+-
499
KPUVCNCTGWőQCTà
- motor 182 cm3, 4 timpi, 6 CP NWOKPQ\KVCVGOCTG
GPGTIGVKEG
NàķKOGFGNWETWEO 8326105 TGFWUG m
CWVQRTQRWNUKG
XKVG\G

ÊPCKPVG ÊPCRQK #EEGUQTKKVWDNWOKPQU
IWTCFGGXCEWCTG
TQVCVKXà°FKPOGVCN %QPVTQNGT
TC\COCZKOàFG
LQENWOKPK
2399.-
FGUEàTECTGO buc.

1935
ITGWVCVGEECMI RGPVTWVWDNWOKPQU
5652996 ON

14 99
17 99 HWPEķKK8873293 buc.

4'-14& buc. buc. Set 2 conectori pt. tubul luminos 7787378 5,99 set
$TKEJGVGCODCNCVGMI &GNC2CN 2GNGVGFKPTWOGIWő
W &GNC2CN Set 10 cleme de fixare pt. tubul luminos

DWE
DWE (TG\àFG\àRCFà 7787379 4,99 set
CODCNCLRTCEVKERQTVCDKN MIGUGPķàNGOP OQVQT.QPEKPVKORK
NGKDWE NGKDWE
ECRCEKVCVGECNQTKEà/, HQKQCUGTàőKPQCUG 1*8M9
%2 
MIEQPķKPWVUWNH RWVGTGECNQTKEàM9JMI
/,MI 163 cm3
TGUVEGPWőà WOKFKVCVGUWDTGUVEGPWőàEECTGUV NàķKOGFGNWETWEO
3219974EQTGURNGKMI UKNKEKWEEC6488010EQTGURNGKMI ÊPàNķKOGFGNWETW
EOITGWVCVGMI
IWTCFGGXCEWCTG
TQVCVKXà°

149.-
FKPOGVCN

149.-
buc. buc.

2490.-
VTCPUOKUKGTQķK

EO
buc.
XKVG\GÊPCKPVGÊPCRQK
6490042 Perdea LED,.'&WTKEWNQCTGCND 5VGCEà\àVQCTG.'&.'&WTK
ECNFW\GZVGTKQTKPVGTKQTFKOGPUKWPK CNDECNFFKOGPUWPG*ZEOW\
+PUVCNCķKG ZONWPIKOGECDNWO6312391 GZVGTKQTNWPIKOGECDNWO6686669
%TàEKWP
(TG\àFG\àRCFà .'&

299.-
2CT¾PI .'&WTK buc.
OQVQT.QPEKPM9
 OWNVKEQNQTG

34
NWPIKOG
99 %2 VKORKEO3
NàķKOGFGNWETWEO VQVCNàO
(KIWTKPà%TàEKWP
buc. CF¾PEKOGFGNWETWEO NWPIKOG EWCRNKECķKGRVUOCTVRJQPG

589.-
IQPƃCDKNà
249.-
KNWOKPCVà buc.
buc. ITGWVCVGMIIWTàFG

149.-
&GNC2CN

499.-
8m buc. TGPKNWOKPCVEW.'&WTK
$TKEJGVG7PKQP-I
ECRCEKVCVGECNQTKEà/,-I

DWE
NGKDWE .GOPFGHQE
GXCEWCTGTQVCVKXà°
VTCPUOKUKGFKUEHTKEķKWPG
XKVG\GÊPCKPVGXKVG\GÊPCRQK
O¾PGTGÊPEàN\KVGGNGEVTKE EWLQEWTK
FGNWOKPK
buc. +PUVCNķKG%TàEKWP.'&.'&WTKVKR
CNDTGEGW\GZVGTKQT
KPVGTKQTFKOGPUKWPK
RNQCKGFGIJGCķàW\GZVGTKQTKPVGTKQT

2779.-
EQPķKPWVUWNH GUGPķàVCTG RQTPKTGGNGEVTKEàNCEJGKG buc. W\GZVGTKQT Ren cu LED,.'&WTKCNDECNFW\ ZZ*EO
TGUVEGPWőà FKOGPUKWPKRCNGV KPVGTKQT CNDECNFFKOGPUKWPKZEO GZVGTKQTKPVGTKQTFKOGPUKWPKZZ NWPIKOGECDNWO
FKUVCPķCFGTGHWNCTGO
3881991EQTGURNGKMI ´EECEO*ECEO6224213 6833613 HWPEVKKNWPIKOGECDNWO6320540 EONWPIKOGECDNWO6689284 6310099
HCT.'&6845067
0WWKVCœKEàCXGOOGTGWEGNGOCKOKEKRTGœWTK%WORàT¾PF 2GPVTWRTQFWEGTGCCTVKEQNGNQTEGRQCTVàUKODQNWN(5%®UCHQNQUKVNGOPRTQXGPKVFKPGZRNQCVàTK
36 WPRCNGVEQORNGVXGœKDGPGHKEKCFGWPRTGœőKOCKCXCPVCLQU HQTGUVKGTGTGURQPUCDKNGEWVTCFKœKG%GTVKHKECTGC(5%®UGHCEGFWRàEGNGOCKUVTKEVGTGIWNK 37
6¾TIWNFG%TàEKWPUG FGUEJKFGÊPEWT¾PF
2TQFWUGXCTKCVGFGNCIJKTNCPFGR¾PàNCFGEQTCœKWPK őKDTC\K6QVWNNCEGCOCKDWPàECNKVCVG

Baterii Mignon Brad Colorado Set globuri


- tip: AA Inaugurare /CIC\KP - material: plastic - globuri din plastic
- pachet 12 buc. - culoare: verde - diametru 6 cm
8169585
02.11 6KOKőQCTC - H 90 x D 55 cm
- 117 ramuri
EWNQCTGCWTKGTQőKG
argintie

1590 Sibiu - interior 6334292 - set 36 buc. 6331431

49 29
04.11
RCE

06.11 Militari 99 99
DWE set
08.11 Berceni
Adaptor pt.
IJKTNCPFà 10.11 $CNQVGőVK
EWHWPEķKKK
$TCőQX
74 99
- uz exterior/interior
- lungime cablu 12.11
10 m 6689631 DWE

1 .WOKPKķGFGEQTCVKXG
- 20 LED-uri, alb cald, interior
- lungime iluminata 95 cm
- lungime cablu 50 cm
RQCVGHKNGICVàÊPUGTKGEWR¾PàNCIJKTNCPFG
1 4999 DWE
HWPEķKQPGC\àEW
baterii tip AA 6320148 5
KPENWFGEQPVTQNGTEWHWPEķKK 1 4GPRNWő
2 %NQRQķGKFGEQTCVKXK

74
EWRàVWTKEà

99
- 40 LED-uri, alb cald )JKTNCPFà.'& - maro
- interior, 28 x 20 cm
- 120 LED 6308185 49,99 lei 5 5GVFGEQTCķKWPK 6
HWPEķKQPGC\àEW

2499 3999
- alb cald ÊPHQTOàFGKPKOà
baterii tip AA 6689276
3 .WOKPKķGFGEQTCVKXG 1 DWE 2 DWE DWE - uz exterior/interior
6689834
2 &GEQTCķKWPG/Qő%TàEKWP
- diverse culori, H30 cm 2 2
- metalice
EWNQCTGTQőKG
.'&WTKÊPHQTOàFGUVGC 6663823/27 49,99 lei/buc - D 8 cm
- alb rece, interior 6660995 12,99 lei
- lungime iluminata 190 cm 3 &GEQTCķKWPG.'&
- lungime cablu 50 cm - peisaj decorativ cu LED 6 $GVGCNàDTCF 7
HWPEķKQPGC\àEW include controler - cu 8 LED-uri, alb cald EWNQCTGTQőKG
baterii tip AA 6320496 EWHWPEķKK - 32 x 10 x H15,5 cm - lungime 10 m
6666056 74,99 lei - uz interior 6666246 11,99 lei
4 .WOKPKķGFGEQTCVKXG 5 +PUVCNCķKG.'&
.'&WTKÊPHQTOàFGÊPIGT - 100 LED-uri 4 Felinar ceramic 7 $TCFCTVKHKEKCN
- alb rece, interior - multicolor 4
- iluminat LED, alb cald ÊPUCEFGKWVà
NWPIKOGKNWOKPCVàEO - uz interior

5999 6499
EWEQPWTKőK\àRCFà

4499
- cu timer
- lungime cablu 150 cm NWPIKOGKNWOKPCVà - 6 modele, D15 x 22,5 cm CTVKHKEKCNà
HWPEķKQPGC\àEW 230 cm 6744282 69,99 lei/buc. - H 30 cm 6334939 24,99 lei
3 DWE 4 DWE 5 DWE 3
baterii tip AA 6689327 6689320

38 RO_HV_1118 Detalii despre serviciile noastre la paginile 2-3 39


Adult Sensitive
- hrană premium
același conținut de proteină ca la mărcile premium

87 89
pentru câini
sensibili
- cu carne de
miel şi orez
- 12,5 kg
8750341 coresp. buc.
7,03 lei/kg De la 1 Pal. ( = 36 buc.) 84,99 lei/buc.

Hrană câini Hrană pisici Snackuri


Hrană uscată
câini Dreamies Mix
- hrană uscată Sterile Pui - delicatesă pentru pisici
completă pentru - hrană uscată completă şi puii de pisică

425
câini adulţi pt. pisici sterilizate - cu pui şi raţă
- cu vitamine - ajută la prevenirea - 60 g 8576376 coresp.
şi minerale problemelor de sănătate 7,08 lei/100 g 60 g
- pentru o dietă ale tractului urinar

1999 1599
optimă - cu aromă de pui
- 10 kg - 1,4 kg 5986989
6119628 2,00 lei/kg 10 kg coresp. 11,42 lei/kg 1,4 kg
De la 1 Pal. ( = 60 buc.) 19,29 lei/buc. Party Mix, Original
- gustări pt. pisică
- cu aromă de pui,
Carnilove Puppy
399
ficat şi curcan
- hrană umedă pt. căţei aproximativ 70% carne Brit Premium - greutate 60 g
de toate rasele cu - hrană umedă 6024960 coresp. 6,65 lei/100 g 60 g
vârsta între 1-12 luni premium
- cu somon şi curcan pentru pisici
- fără cereale şi fără cartofi - cu carne de peşte
- conţine bucăţi de carne - pachet de 4 plicuri:
de origine salbatică, 2 x peşte cod; 2 x Denta Stix
fructe de pădure, legume somon&păstrăv - hrană complementară pt. câini

799
şi plante aromatice

659
- 4 x 100 g - gustare delicioasă
- 400 g 5718549 coresp. care acționează ca o
6102834 coresp. 19,98 lei/kg 400 g 16,48 lei/kg 400 g periuță de dinți

649
De la 1 Pac. ( = 6 buc.) 7,43 lei/buc. De la 1 Pac. ( = 13 buc.) 6,29 lei/buc. - 7 bucăţi / pachet
- greutate 180 g
5004282 coresp. 3,61 lei/100 g 180 g

Hrană pisici, pateu


Rinti - 10 x 100 g
- hrană umedă pentru câini - în conserve practice Snack
- cu bucăţi de carne - un produs natural, - hrană complementară pt. câini
- diverse soiuri, de fără conservanţi - os cu şuncă mare
ex. cu vânat
1149 sau coloranţi
1799 - benefic pt. dantura câinelui

729
- conservă 800 g - 3 feluri diferite - 1 buc.
800 g 1 kg
5158970 coresp. în pachet - 280 g
14,36 lei/kg 8783374 De la 1 Pac. ( = 8 buc.) 16,99 lei/buc. 5798327 coresp. 2,60 lei/100 g 280 g

Preţurile sunt valabile în perioada 30.10.2018 - 26.11.2018, în afara intervalului anterior menționat acestea putând suferi modificări. Nu ne asumăm responsabilitatea pentru greșelile de tipar
care pot afecta oricare dintre informațiile din prospect. Fotografiile din prospect sunt cu titlu de prezentare, astfel încât pot exista diferențe față de produsele comercializate. HORNBACH nu își asumă răspunderea RO_
40 HV_1118
pentru corectitudinea informațiilor cu privire la caracteristicile produselor prezentate în prospect, acestea fiind puse la dispoziție de către furnizori/producători. Prețurile sunt exprimate în LEI și includ TVA aferentă.
Politica comercială/facilitatea „Garanția prețului“ se acordă exclusiv în condițiile și limitările din regulamentul expus pe site-ul www.hornbach.ro/garantia-pretului. Informații despre taxa verde pe hornbach.ro