Sunteți pe pagina 1din 144

PARTEA I

Anul 185 (XXIX) — Nr. 492 LEGI, DECRETE, HOTĂRÂRI ȘI ALTE ACTE Miercuri, 28 iunie 2017

SUMAR

Nr. Pagina

LEGI ȘI DECRETE
153. — Lege-cadru privind salarizarea personalului plătit
din fonduri publice ...................................................... 2–139
580. — Decret pentru promulgarea Legii-cadru privind
salarizarea personalului plătit din fonduri publice ...... 140

DECIZII ALE PRIM-MINISTRULUI


489. — Decizie privind numirea doamnei Simona-Gabriela
Baltag în funcția de consilier de stat în cadrul
aparatului propriu de lucru al prim-ministrului ............ 140

ACTE ALE ORGANELOR DE SPECIALITATE


ALE ADMINISTRAȚIEI PUBLICE CENTRALE
141. — Ordin al președintelui Agenției Naționale pentru
Achiziții Publice privind aprobarea Metodologiei de
selecție și modului de interacțiune a autorităților/
entităților contractante cu Agenția Națională pentru
Achiziții Publice în legătură cu intenția de modificare a
contractelor/acordurilor-cadru de achiziție publică,
respectiv a contractelor/acordurilor-cadru sectoriale, în
condițiile prevăzute la art. 221 alin. (1) lit. c) din Legea
nr. 98/2016 și la art. 238 din Legea nr. 99/2016 .......... 141–143
2 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

LEGI ȘI DECRETE
PARLAMENTUL ROMÂNIEI
C A M E R A D E P U TA Ț I L O R S E N AT U L

LEGE-CADRU
privind salarizarea personalului plătit din fonduri publice

Parlamentul României adoptă prezenta lege.

CAPITOLUL I (3) Intră în categoria personalului din sectorul bugetar


Dispoziții generale personalul încadrat pe baza contractului individual de muncă,
personalul care ocupă funcții de demnitate publică numite sau
SECȚIUNEA 1 alese și personalul care ocupă funcții asimilate funcțiilor de
Dispoziții comune demnitate publică, magistrații, precum și personalul care
beneficiază de statute speciale, inclusiv funcționarii publici și
Obiectul de reglementare funcționarii publici cu statut special.
Art. 1. — (1) Prezenta lege are ca obiect de reglementare Gestionarea sistemului de salarizare
stabilirea unui sistem de salarizare pentru personalul din Art. 3. — (1) Gestionarea sistemului de salarizare a
sectorul bugetar plătit din bugetul general consolidat al statului. personalului din instituțiile și autoritățile publice se asigură de
(2) Prezenta lege creează cadrul legislativ pentru: fiecare ordonator de credite.
a) dezvoltarea unui sistem de fundamentare a politicilor (2) Gestionarea sistemului de salarizare a personalului din
salariale în sectorul bugetar și de supraveghere a aplicării instituțiile de învățământ preuniversitar și universitar de stat se
acestora; asigură de Ministerul Educației Naționale.
b) dezvoltarea unui sistem de distribuire a resurselor
(3) Gestionarea sistemului de salarizare a personalului din
bugetare alocate pentru cheltuielile de personal, prin stabilirea
unitățile sanitare publice, din rețeaua Ministerului Sănătății și a
salariilor de bază în sectorul bugetar, în vederea promovării
autorităților administrației publice locale se asigură de
performanței individuale;
ordonatorii principali de credite și de Ministerul Sănătății.
c) remunerarea persoanelor care ocupă funcții de demnitate
publică. (4) Ordonatorii de credite au obligația să stabilească salariile
(3) Începând cu data intrării în vigoare a prezentei legi, de bază/soldele de funcție/salariile de funcție/soldele de
drepturile salariale ale personalului prevăzut la alin. (1) sunt și grad/salariile gradului profesional deținut, gradațiile, soldele de
rămân, în mod exclusiv, cele prevăzute în prezenta lege. comandă/salariile de comandă, indemnizațiile de
(4) Prin contractele colective de muncă/acordurile colective încadrare/indemnizațiile lunare, sporurile, alte drepturi salariale
de muncă și contractele individuale de muncă nu pot fi negociate în bani și în natură prevăzute de lege, să asigure promovarea
salarii sau alte drepturi de natură salarială în bani sau în natură personalului în funcții, grade și trepte profesionale și avansarea
care excedează sau contravin prevederilor prezentei legi. în gradații, în condițiile legii, astfel încât să se încadreze în
Domeniul de aplicare sumele aprobate cu această destinație în bugetul propriu.
Art. 2. — (1) Dispozițiile prezentei legi se aplică: Controlul aplicării legii
a) personalului din autorități și instituții publice, respectiv Art. 4. — Controlul aplicării prevederilor legale privind
Parlamentul, Administrația Prezidențială, autoritatea salarizarea personalului din sectorul bugetar se realizează de
judecătorească, Guvernul, ministerele, celelalte organe de către Guvern, prin ministere și instituțiile de apărare, ordine
specialitate ale administrației publice centrale, unitățile publică și securitate națională, potrivit atribuțiilor din domeniul
teritoriale, autorități ale administrației publice locale, alte de activitate al acestora, precum și de alte autorități publice
autorități publice, autorități administrative autonome, precum și centrale autonome cu atribuții în domeniu.
instituțiile din subordinea acestora, finanțate integral din bugetul Raportul salarial
de stat, bugetele locale, bugetul asigurărilor sociale de stat și Art. 5. — În sectorul bugetar, raportul dintre cel mai mic
bugetele fondurilor speciale; salariu de bază și cel mai mare salariu de bază, soldă de
b) personalului din autorități și instituții publice finanțate din funcție/salariu de funcție, indemnizație de încadrare,
venituri proprii și subvenții acordate de la bugetul de stat, indemnizație lunară este de 1 la 12.
bugetele locale, bugetul asigurărilor sociale de stat și bugetele
fondurilor speciale; SECȚIUNEA a 2-a
c) personalului din autoritățile și instituțiile publice finanțate Principiile sistemului de salarizare
integral din venituri proprii;
d) persoanelor care sunt conducători ai unor instituții publice Principii
în temeiul unui contract, altul decât contractul individual de Art. 6. — Sistemul de salarizare reglementat prin prezenta
muncă; lege are la bază următoarele principii:
e) persoanelor care ocupă funcții de demnitate publică. a) principiul legalității, în sensul că drepturile de natură
(2) Dispozițiile prezentei legi nu se aplică personalului din salarială se stabilesc prin norme juridice de forța legii, cu
Banca Națională a României, Autoritatea de Supraveghere excepția hotărârilor prevăzute la art. 11 alin. (1), conform
Financiară, Autoritatea Națională de Reglementare în Domeniul principiilor enunțate de art. 120 din Constituția României,
Energiei și Autoritatea Națională pentru Administrare și republicată, dar cu încadrare între limitele minime și maxime
Reglementare în Comunicații. prevăzute prin prezenta lege;
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 3

b) principiul nediscriminării, în sensul eliminării oricăror forme vechime în funcție sau vechime în specialitate, după caz, și
de discriminare și instituirii unui tratament egal cu privire la condiții de muncă;
personalul din sectorul bugetar care prestează aceeași activitate h) funcția de demnitate publică este acea funcție publică care
și are aceeași vechime în muncă și în funcție; se ocupă prin mandat obținut direct, prin alegeri organizate, sau
c) principiul egalității, prin asigurarea de salarii de bază egale indirect, prin numire, în condițiile legii;
pentru muncă cu valoare egală; i) sporul reprezintă un element al salariului lunar/soldei
d) principiul importanței sociale a muncii, în sensul că lunare, acordat ca procent la salariul de bază, solda de
salarizarea personalului din sectorul bugetar se realizează în
funcție/salariul de funcție, indemnizația de încadrare, în condițiile
raport cu responsabilitatea, complexitatea, riscurile activității și
legii, pentru fiecare categorie de personal;
nivelul studiilor;
e) principiul stimulării personalului din sectorul bugetar, în j) gradația reprezintă salariul de bază corespunzător funcției,
contextul recunoașterii și recompensării performanțelor acordat în raport cu vechimea în muncă, în condițiile prezentei
profesionale obținute, pe baza criteriilor stabilite potrivit legii și legi;
regulamentelor proprii; k) treapta profesională reprezintă nivelul de ierarhizare în
f) principiul ierarhizării, pe verticală, cât și pe orizontală, în cadrul funcțiilor cu studii medii;
cadrul aceluiași domeniu, în funcție de complexitatea și l) gradul profesional reprezintă nivelul de ierarhizare în cadrul
importanța activității desfășurate; funcțiilor cu studii superioare, studii superioare de scurtă durată
g) principiul transparenței mecanismului de stabilire a și studii medii, după caz, în condițiile legii;
drepturilor salariale, în sensul asigurării predictibilității salariale m) venitul salarial al personalului din sectorul bugetar
pentru personalul din sectorul bugetar; cuprinde salariile de bază, soldele de funcție/salariile de funcție,
h) principiul sustenabilității financiare, în sensul stabilirii soldele de grad/salariile gradului profesional deținut, gradațiile,
nivelului de salarizare pentru personalul bugetar, astfel încât să soldele de comandă/salariile de comandă, indemnizațiile de
se asigure respectarea plafoanelor cheltuielilor de personal ale încadrare, indemnizațiile lunare și, după caz, compensațiile,
bugetului general consolidat, stabilite în condițiile legii;
indemnizațiile, sporurile, majorările, adaosurile, primele și
i) principiul publicității în sensul transparenței veniturilor de
premiile, precum și alte drepturi în bani și/sau în natură,
natură salarială, precum și a altor drepturi în bani și/sau în
natură pentru toate funcțiile din sectorul bugetar. corespunzătoare fiecărei categorii de personal din sectorul
bugetar.
SECȚIUNEA a 3-a
SECȚIUNEA a 4-a
Definiții
Criterii de performanță
Termeni
Art. 7. — În înțelesul prezentei legi, termenii și expresiile de Criterii generale
mai jos au următoarea semnificație: Art. 8. — (1) Ierarhizarea posturilor în vederea stabilirii
a) salariul de bază reprezintă suma de bani la care are salariilor de bază, a soldelor de funcție/salariilor de funcție și a
dreptul lunar personalul plătit din fonduri publice, corespunzător indemnizațiilor de încadrare, atât între domeniile de activitate,
funcției, gradului/treptei profesionale, gradației, vechimii în cât și în cadrul aceluiași domeniu, are la bază următoarele
specialitate, astfel cum este stabilită în anexele nr. I—IX; criterii generale:
b) solda de funcție/salariul de funcție reprezintă suma de a) cunoștințe și experiență;
bani la care are dreptul lunar personalul militar, polițiștii și b) complexitate, creativitate și diversitate a activităților;
funcționarii publici cu statut special din sistemul administrației c) judecata și impactul deciziilor;
penitenciare, corespunzător funcției îndeplinite, stabilită/stabilit
d) responsabilitate, coordonare și supervizare;
conform anexelor nr. I—IX, care nu poate fi mai mică/mic decât
e) dialog social și comunicare;
nivelul salariului de bază minim brut pe țară garantat în plată;
c) indemnizația de încadrare reprezintă suma de bani f) condiții de muncă;
corespunzătoare funcției, gradului, gradației și vechimii în g) incompatibilități și regimuri speciale.
funcție, prevăzută în anexele nr. I—IX; (2) Criteriile de performanță generale avute în vedere la
d) indemnizația lunară reprezintă suma de bani la care au promovarea în funcție, grade/trepte profesionale a personalului
dreptul persoanele care ocupă funcții de demnitate publică sau plătit din fonduri publice ori în vederea acordării unor premii sunt
asimilate acestora, fiind unica formă de remunerare a activității următoarele:
corespunzătoare funcției acestora; persoanele care ocupă a) cunoștințe profesionale și abilități;
funcții de demnitate publică nu beneficiază de sporuri b) calitatea, operativitatea și eficiența activităților
permanente, sporuri temporare și/sau de doctorat; desfășurate;
e) salariul lunar cuprinde salariul de bază ori, după caz, c) perfecționarea pregătirii profesionale;
indemnizația lunară sau indemnizația de încadrare, d) capacitatea de a lucra în echipă;
compensațiile, indemnizațiile, sporurile, adaosurile, primele, e) comunicare;
premiile, precum și celelalte elemente ale sistemului de f) disciplină;
salarizare corespunzătoare fiecărei categorii de personal din
g) rezistență la stres și adaptabilitate;
sectorul bugetar;
h) capacitatea de asumare a responsabilității;
f) solda lunară/salariul lunar cuprinde solda de funcție/salariul
de funcție, solda de grad/salariul gradului profesional deținut, i) integritate și etică profesională.
gradații și, după caz, solda de comandă/salariul de comandă, (3) Pentru categoriile de personal plătite din fonduri publice
indemnizații, compensații, sporuri, prime, premii și alte drepturi care beneficiază de criterii specifice de performanță
salariale în bani; reglementate prin statute proprii se aplică acestea din urmă.
g) funcția similară reprezintă o funcție de același fel din (4) Conținutul criteriilor de performanță specifice domeniului
cadrul aceleiași instituții sau autorități publice, care implică de activitate, precum și procedura de evaluare se stabilesc
aceleași condiții de studii, grad/treaptă profesională, gradație, potrivit reglementărilor aplicabile fiecărei categorii de personal.
4 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II reprezentative la nivel de unitate sau, după caz, a


Salarizarea reprezentanților salariaților.
(2) Nomenclatorul funcțiilor necesare desfășurării activităților
SECȚIUNEA 1 specifice fiecărei instituții sau autorități a administrației publice
locale, precum și ierarhia funcțiilor sunt prevăzute în anexa
Sistemul de stabilire a salariilor de bază,
nr. VIII cap. I lit. A pct. III și cap. II lit. A pct. IV.
soldelor de funcție/salariilor de funcție,
(3) Stabilirea salariilor lunare potrivit alin. (1) se realizează
indemnizațiilor de încadrare și indemnizațiilor lunare
de către ordonatorul de credite, cu respectarea prevederilor
în sectorul bugetar
art. 25.
Salariile de bază/soldele de funcție/salariile de funcție, (4) Nivelul veniturilor salariale se stabilește, în condițiile
indemnizațiile de încadrare și indemnizațiile lunare prevăzute la alin. (1) și (3), fără a depăși nivelul indemnizației
Art. 9. — Salariile de bază, soldele de funcție/salariile de lunare a funcției de viceprimar sau, după caz, a indemnizației
funcție, soldele de grad/salariile gradului profesional deținut, lunare a vicepreședintelui consiliului județean, sau, după caz, a
gradațiile, soldele de comandă/salariile de comandă, viceprimarului municipiului București, corespunzător nivelului de
indemnizațiile de încadrare și indemnizațiile lunare, sporurile și organizare: comună, oraș, municipiu, sectoarele municipiului
alte drepturi salariale specifice fiecărui domeniu de activitate București, primăria generală a municipiului București, exclusiv
corespunzător celor 7 familii ocupaționale de funcții bugetare, majorările prevăzute la art. 16 alin. (2), cu încadrarea în
pentru personalul din autoritățile și instituțiile publice finanțate cheltuielile de personal aprobate în bugetele de venituri și
integral din venituri proprii, precum și pentru funcțiile de cheltuieli.
demnitate publică, sunt prevăzute în anexele nr. I—IX. (5) Angajarea, promovarea, avansarea în gradație a
Salariile de bază și gradațiile personalului prevăzut la alin. (1) se fac cu respectarea
Art. 10. — (1) Salariile de bază sunt diferențiate pe funcții, prevederilor prezentei legi, precum și a celorlalte reglementări
grade/trepte și gradații. specifice funcționarilor publici și personalului contractual.
(2) Fiecărei funcții, fiecărui grad/treaptă profesională îi Modul de stabilire a salariilor de bază, soldelor de
corespund 5 gradații, corespunzătoare tranșelor de vechime în funcție/salariilor de funcție, a indemnizațiilor de încadrare și
muncă, cu excepția funcțiilor de demnitate publică și funcțiilor a indemnizațiilor lunare
de conducere pentru care gradația este inclusă în indemnizația Art. 12. — (1) Salariile de bază, soldele de funcție/salariile
lunară/salariul de bază prevăzut pentru aceste funcții în anexele de funcție, soldele de grad/salariile gradului profesional deținut,
nr. I—IX, precum și a personalului militar, polițiștilor și gradațiile, soldele de comandă/salariile de comandă,
funcționarilor publici cu statut special din sistemul administrației indemnizațiile de încadrare și indemnizațiile lunare se stabilesc
penitenciare. potrivit prevederilor prezentei legi și anexelor nr. I—IX, astfel
(3) Salariile de bază prevăzute în anexele nr. I—VIII pentru încât, împreună cu celelalte elemente ale sistemului de
funcțiile de execuție sunt la gradația 0. salarizare, să se încadreze în fondurile aprobate de la bugetul
(4) Tranșele de vechime în muncă în funcție de care se de stat, bugetul asigurărilor sociale de stat, bugetele locale și
acordă cele 5 gradații, precum și cotele procentuale bugetele fondurilor speciale pentru cheltuielile de personal, în
corespunzătoare acestora, calculate la salariul de bază avut la vederea realizării obiectivelor, programelor și proiectelor
data îndeplinirii condițiilor de trecere în gradație și incluse în stabilite.
acesta, sunt următoarele: (2) Începând cu anul 2023, salariile de bază, soldele de
a) gradația 1 — de la 3 ani la 5 ani — și se determină prin funcție/salariile de funcție și indemnizațiile de încadrare se
majorarea salariului de bază prevăzut în anexele la prezenta stabilesc prin înmulțirea coeficienților prevăzuți în anexele
lege cu cota procentuală de 7,5%, rezultând noul salariu de nr. I—VIII cu salariul de bază minim brut pe țară garantat în plată
bază; în vigoare.
b) gradația 2 — de la 5 ani la 10 ani — și se determină prin Modul de stabilire a indemnizațiilor lunare pentru
majorarea salariului de bază avut cu cota procentuală de 5%, funcțiile de demnitate publică
rezultând noul salariu de bază; Art. 13. — (1) Indemnizațiile lunare pentru funcțiile de
c) gradația 3 — de la 10 ani la 15 ani — și se determină prin demnitate publică se determină prin înmulțirea coeficienților din
majorarea salariului de bază avut cu cota procentuală de 5%, anexa nr. IX cu salariul de bază minim brut pe țară garantat în
rezultând noul salariu de bază; plată în vigoare.
d) gradația 4 — de la 15 ani la 20 de ani — și se determină (2) Perioada în care persoanele prevăzute la alin. (1) au
prin majorarea salariului de bază avut cu cota procentuală de ocupat funcții de demnitate publică constituie vechime în muncă
2,5%, rezultând noul salariu de bază; și în specialitate.
e) gradația 5 — peste 20 de ani — și se determină prin SECȚIUNEA a 2-a
majorarea salariului de bază avut cu cota procentuală de 2,5%,
Alte drepturi salariale
rezultând noul salariu de bază.
(5) Gradația obținută se acordă cu începere de la data de Drepturi salariale pentru deținerea titlului științific de
întâi a lunii următoare celei în care s-au împlinit condițiile de doctor
acordare. Art. 14. — (1) Personalul care deține titlul științific de doctor
(6) Pentru personalul nou-încadrat, salariul de bază se beneficiază de o indemnizație lunară pentru titlul științific de
determină prin aplicarea succesivă a majorărilor prevăzute la doctor în cuantum de 50% din nivelul salariului de bază minim
alin. (4), corespunzător gradației deținute. brut pe țară garantat în plată, dacă își desfășoară activitatea în
Art. 11. — (1) Pentru funcționarii publici și personalul domeniul pentru care deține titlul. Cuantumul salarial al acestei
contractual din cadrul familiei ocupaționale „Administrație” din indemnizații nu se ia în calcul la determinarea limitei sporurilor,
aparatul propriu al consiliilor județene, primării și consilii locale compensațiilor, primelor, premiilor și indemnizațiilor prevăzută
și din serviciile publice din subordinea acestora, salariile de bază la art. 25.
se stabilesc prin hotărâre a consiliului local, a consiliului (2) În situația cumulului de funcții, indemnizația prevăzută la
județean sau a Consiliului General al Municipiului București, alin. (1) se acordă, la cerere, numai de către angajatorul unde
după caz, în urma consultării organizației sindicale beneficiarul are funcția de bază declarată.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 5

(3) Personalul didactic de predare care solicită și obține echipele de proiect, inclusiv contribuțiile salariale aferente, pot
gradul didactic I prin echivalare, potrivit prevederilor Ordinului fi rambursate de către autoritatea finanțatoare, în conformitate
ministrului educației, cercetării, tineretului și sportului cu regulile de eligibilitate și procedurile de rambursare aplicabile,
nr. 5561/2011 pentru aprobarea Metodologiei privind formarea precum și cu procentul de cofinanțare stabilit în
continuă a personalului din învățământul preuniversitar, cu contractul/acordul/ordinul de finanțare semnat cu autoritatea
modificările și completările ulterioare, nu primește indemnizația finanțatoare. Pentru persoanele implicate în mai multe echipe
pentru titlul științific de doctor. Cadrele didactice optează pentru de proiecte, rambursarea cheltuielilor se face pentru fiecare
indemnizația pentru titlul științific de doctor sau pentru proiect în parte, proporțional cu timpul efectiv realizat, conform
echivalarea cu gradul didactic I. fișei de pontaj.
Drepturi salariale pentru activitatea de control financiar (10) Prin excepție de la prevederile alin. (1), în cadrul
preventiv instituțiilor și/sau autorităților publice poate fi încadrat personal
Art. 15. — Personalul care exercită activitatea de control cu contract individual de muncă pe durată determinată, pe
financiar preventiv, pe perioada de exercitare a acesteia, posturi în afara organigramei, prin act administrativ al
beneficiază de o majorare a salariului de bază cu 10%. conducătorului instituției. Angajarea se face cu unicul scop de a
Drepturi salariale pentru activitatea prestată în proiecte desfășura numai activități în cadrul proiectelor finanțate în
finanțate din fonduri europene condițiile alin. (1), conform prevederilor contractului/acordului/
Art. 16. — (1) Personalul din instituțiile și/sau autoritățile ordinului de finanțare semnat de către instituția beneficiară cu
publice nominalizat în echipele de proiecte finanțate din fonduri autoritatea finanțatoare și în limita sumelor. Salarizarea se va
europene nerambursabile, beneficiază de majorarea salariilor face la nivelul de salarizare aplicabil pentru funcțiile similare din
de bază, soldelor de funcție/salariilor de funcție, indemnizațiilor instituția/autoritatea publică unde se desfășoară activitatea, cu
de încadrare, cu până la 50%, indiferent de numărul de proiecte suportarea integrală a drepturilor salariale brute și a contribuțiilor
în care este implicat. Această majorare se aplică proporțional sociale aferente, după caz, din bugetul proiectului finanțat din
cu timpul efectiv alocat activităților pentru fiecare proiect și se fonduri europene nerambursabile, conform regulilor privind
acordă numai dacă cheltuielile de personal sunt eligibile a fi eligibilitatea cheltuielilor stabilite. Cheltuielile cu salariile
rambursate din fonduri europene. personalului care își desfășoară activitatea în cadrul proiectelor
(2) Indemnizațiile lunare ale președinților și vicepreședinților finanțate din fonduri externe nerambursabile, pe bază de
consiliilor județene și primarilor/viceprimarilor unităților contract individual de muncă pe durată determinată, se suportă
administrativ-teritoriale care implementează proiecte finanțate din titlul de cheltuieli din care este finanțat proiectul, în limita
din fonduri europene nerambursabile se majorează cu 25%. bugetului aprobat.
(3) Pentru fiecare proiect contractat în condițiile alin. (1), (11) Conducătorul instituției/autorității publice are obligația
conducătorul instituției/autorității publice nominalizează, prin act
de a asigura respectarea condițiilor și limitelor stabilite prin
administrativ, persoanele care fac parte din echipa de proiect.
prevederile prezentei legi la nivelul tuturor echipelor de proiecte
(4) Numărul maxim de persoane la nivelul unei instituții sau
organizate în cadrul instituției/autorității publice pe care o
autorități dintre cele prevăzute la alin. (1) care pot fi nominalizate
conduce.
în echipele de proiect este cel stabilit de prevederile
Drepturi salariale pentru gestionarea de proiecte
contractului/acordului/ordinului de finanțare semnat de către
finanțate din fonduri europene
instituția beneficiară cu autoritatea finanțatoare.
(5) Echipa de proiect din instituția beneficiară este Art. 17. — (1) Personalul prevăzut la art. 1 din Legea
responsabilă de realizarea activităților stabilite a fi efectuate în nr. 490/2004 privind stimularea financiară a personalului care
mod direct în graficul de activități aprobat, precum și a celor care gestionează fonduri comunitare, cu modificările și completările
derivă din obligațiile beneficiarului față de autoritatea ulterioare, personalul din cadrul Direcției pentru Coordonarea
finanțatoare, conform contractului/acordului/ordinului de Agențiilor de Plăți, prevăzut la art. 11 alin. (1) și personalul
finanțare semnat și în conformitate cu sistemul de management prevăzut la art. 16 alin. (1) din Ordonanța de urgență a
și control intern aplicabil. Activitățile prestate de către personalul Guvernului nr. 41/2014 privind înființarea, organizarea și
instituției sau autorității publice nominalizat în echipele de proiect funcționarea Agenției pentru Finanțarea Investițiilor Rurale, prin
în cadrul proiectelor finanțate din fondurile prevăzute la alin. (1) reorganizarea Agenției de Plăți pentru Dezvoltare Rurală și
vor fi reflectate corespunzător în cuprinsul fișei postului, conform Pescuit, aprobată prin Legea nr. 43/2015, cu modificările și
prevederilor legale în vigoare. completările ulterioare, precum și personalul prevăzut la art. 7
(6) Coordonatorul de proiect/managerul de proiect/șeful de alin. (1) din Legea nr. 1/2014 privind înființarea, organizarea și
proiect avizează fișele de pontaj care atestă timpul efectiv lucrat funcționarea Agenției de Plăți și Intervenție pentru Agricultură,
în cadrul fiecărui proiect, pentru fiecare dintre persoanele cu modificările și completările ulterioare, pe durata desfășurării
nominalizate. activității în acest domeniu, în loc de majorarea de până la
(7) Procentele prevăzute la alin. (1) și (2) se acordă de la 25 de clase de salarizare, respectiv de majorarea salariilor de
data implementării contractului/acordului/ordinului de finanțare bază cu până la 75%, beneficiază de majorarea salariului de
de către părțile contractante, respectiv instituția beneficiară și bază, soldei de funcție/salariului de funcție, indemnizației de
autoritatea finanțatoare, începând cu data intrării în vigoare a încadrare cu până la 25%, în baza criteriilor stabilite prin decizia
prezentei legi. Acesta se acordă numai pe perioada de ordonatorului de credite. De majorarea salariilor de bază cu
implementare a proiectului, astfel cum a fost stabilită în până la 25% beneficiază și personalul din structurile cu rol de
contractul/acordul/ordinul de finanțare semnat, pe răspunderea organisme intermediare pentru programele operaționale,
ordonatorului de credite în cadrul căruia este organizată echipa precum și cel din cadrul aparatului propriu al Ministerului
de proiect. Finanțelor Publice.
(8) Prevederile prezentului articol nu sunt aplicabile (2) La finalul desfășurării activității prevăzute la alin. (1),
personalului care beneficiază de prevederile art. 17 și personalul care a beneficiat de salariul de bază, solda de
demnitarilor, cu excepția funcțiilor de președinte/vicepreședinte funcție/salariul de funcție, indemnizația de încadrare mai mare
al consiliului județean și primar/viceprimar. cu până la 25%, revine la salariul de bază, solda de
(9) Cheltuielile cu salariile lunare, soldele lunare/salariile funcție/salariul de funcție, indemnizația de încadrare avute
lunare și indemnizațiile de încadrare ale personalului din anterior desfășurării activității în acest domeniu.
6 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

Indemnizația de hrană reglementările în vigoare, nu se lucrează, va fi plătită în luna


Art. 18. — (1) Începând cu 1 decembrie 2018, ordonatorii de următoare cu un spor de 100% din salariul de bază, solda de
credite acordă obligatoriu, lunar, indemnizații de hrană la nivelul funcție/salariul de funcție, indemnizația de încadrare,
anual a două salarii de bază minime brute pe țară garantate în corespunzător orelor suplimentare efectuate.
plată, cu excepția personalului Ministerului Apărării Naționale, (4) Plata muncii în condițiile alin. (2) și (3) se poate face
Ministerului Afacerilor Interne, Ministerului Justiției — numai dacă efectuarea orelor suplimentare a fost dispusă de
Administrația Națională a Penitenciarelor, Serviciului Român de șeful ierarhic în scris, fără a se depăși 360 de ore anual. În cazul
Informații, Serviciului de Informații Externe, Serviciului de prestării de ore suplimentare peste un număr de 180 de ore
Protecție și Pază și Serviciului de Telecomunicații Speciale, anual, este necesar acordul sindicatelor reprezentative sau,
precum și a personalului poliției locale care, potrivit legii, după caz, al reprezentanților salariaților, potrivit legii.
beneficiază de drepturi de hrană în temeiul Ordonanței (5) La locurile de muncă la care durata normală a timpului
Guvernului nr. 26/1994 privind drepturile de hrană, în timp de de lucru a fost redusă, potrivit legii, sub 8 ore pe zi, depășirea
pace, ale personalului din sectorul de apărare națională, ordine programului de lucru astfel aprobat se poate face numai
publică și siguranță națională, republicată, cu modificările și temporar, fiind obligatorie compensarea cu timp liber
completările ulterioare. corespunzător.
(2) Indemnizațiile de hrană prevăzute la alin. (1) se acordă (6) Prevederile prezentului articol nu se aplică persoanelor
proporțional cu timpul efectiv lucrat în luna anterioară, cu salarizate prin plata cu ora, prin cumul de funcții în cadrul
încadrarea în prevederile art. 25 alin. (1). aceleiași instituții sau autorități publice ori persoanelor angajate
(3) Personalul care, la data intrării în vigoare a prezentei legi, cu timp parțial.
beneficiază de drepturi de hrană potrivit Ordonanței Guvernului Sporul pentru persoanele cu handicap
nr. 26/1994, republicată, cu modificările și completările Art. 22. — Pentru activitatea desfășurată de persoanele cu
ulterioare, și nu este angajat/încadrat în instituțiile și autoritățile handicap grav sau accentuat, în cadrul programului normal de
publice prevăzute la art. 1 din Ordonanța Guvernului lucru se acordă un spor de 15% din salariul de bază/solda de
nr. 26/1994, republicată, cu modificările și completările funcție/salariul de funcție/indemnizația de încadrare. Categoriile
ulterioare, respectiv în cadrul poliției locale, beneficiază exclusiv de persoane cu handicap care vor beneficia de acest spor se
de indemnizația de hrană prevăzută la alin. (1). stabilesc prin hotărâre a Guvernului.
(4) Indemnizația de hrană nu se acordă persoanelor care Sporul pentru condiții de muncă
ocupă funcții de demnitate publică, alese și numite. Art. 23. — Locurile de muncă și categoriile de personal,
Salariul de bază pentru funcțiile de conducere precum și mărimea concretă a sporului pentru condiții de muncă
Art. 19. — (1) Salariul de bază pentru funcțiile de conducere prevăzut în anexele nr. I—VIII și condițiile de acordare a
se stabilește de către conducătorul instituției publice, în raport cu acestuia se stabilesc, în cel mult 60 de zile de la publicarea
responsabilitatea, complexitatea și impactul deciziilor impuse de prezentei legi în Monitorul Oficial al României, Partea I, prin
atribuțiile corespunzătoare activității desfășurate. regulament-cadru elaborat de către fiecare dintre ministerele
(2) În salariul de bază pentru funcțiile de conducere atât la coordonatoare ale celor 6 domenii de activitate bugetară,
gradul I, cât și la gradul II, este inclusă gradația aferentă tranșei respectiv învățământ, sănătate și asistență socială, cultură,
de vechime în muncă, la nivel maxim. diplomație, justiție, administrație, de către instituțiile de apărare,
ordine publică și securitate națională, precum și de către
SECȚIUNEA a 3-a
autoritățile publice centrale autonome, care se aprobă prin
Sporuri hotărâre a Guvernului, la propunerea fiecăruia dintre ministerele
Sporul pentru munca de noapte coordonatoare, a fiecăreia dintre instituțiile de apărare, ordine
Art. 20. — (1) Personalul care, potrivit programului normal publică și securitate națională sau a fiecăreia dintre autoritățile
de lucru, își desfășoară activitatea între orele 22,00 și 6,00 publice centrale autonome, cu avizul Ministerului Muncii și
beneficiază, pentru orele lucrate în acest interval, de un spor Justiției Sociale și al Ministerului Finanțelor Publice și cu
pentru munca prestată în timpul nopții de 25% din salariul de consultarea federațiilor sindicale reprezentative domeniului de
bază, solda de funcție/salariul de funcție, indemnizația de activitate.
încadrare, dacă timpul astfel lucrat reprezintă cel puțin 3 ore de Sporuri și drepturi salariale specifice
noapte din timpul normal de lucru. Art. 24. — Limita maximă a sporurilor, compensațiilor,
(2) Sporul de noapte nu se ia în calcul la determinarea limitei indemnizațiilor, adaosurilor, majorărilor, primelor, premiilor și
sporurilor, compensațiilor, primelor, premiilor și indemnizațiilor a altor elemente ale venitului salarial specific fiecărui
prevăzute la art. 25. domeniu de activitate este prevăzută în prezenta lege și în
Sporul pentru munca suplimentară anexele nr. I – VIII.
Art. 21. — (1) Munca suplimentară prestată peste programul Limitarea sporurilor, compensațiilor, adaosurilor,
normal de lucru, precum și munca prestată în zilele de sărbători primelor, premiilor și indemnizațiilor și a altor drepturi
legale, repaus săptămânal și în alte zile în care, în conformitate Art. 25. — (1) Suma sporurilor, compensațiilor, adaosurilor,
cu legea, nu se lucrează, se compensează prin ore libere plătite primelor, premiilor și indemnizațiilor, inclusiv cele pentru hrană
în următoarele 60 de zile calendaristice după efectuarea și vacanță, acordate cumulat pe total buget pentru fiecare
acesteia. ordonator de credite nu poate depăși 30% din suma salariilor
(2) În cazul în care compensarea prin ore libere plătite nu de bază, a soldelor de funcție/salariilor de funcție, soldelor de
este posibilă în termenul prevăzut la alin. (1), munca grad/salariilor gradului profesional deținut, gradațiilor și a
suplimentară prestată peste programul normal de lucru va fi soldelor de comandă/salariilor de comandă, a indemnizațiilor de
plătită în luna următoare cu un spor de 75% din salariul de bază, încadrare și a indemnizațiilor lunare, după caz.
solda de funcție/salariul de funcție, indemnizația de încadrare, (2) Prin excepție de la prevederile alin. (1), pentru instituțiile
corespunzător orelor suplimentare efectuate. din sistemul sanitar și cele din sistemul de apărare, ordine
(3) În cazul în care compensarea prin ore libere plătite nu publică și securitate națională, suma sporurilor, compensațiilor,
este posibilă în termenul prevăzut la alin. (1), munca adaosurilor, primelor, premiilor și indemnizațiilor, inclusiv cele
suplimentară prestată în zilele de repaus săptămânal, de pentru hrană și vacanță, acordate cumulat pe total buget pentru
sărbători legale și în celelalte zile în care, în conformitate cu fiecare ordonator principal de credite nu poate depăși 30% din
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 7

suma salariilor de bază, a soldelor de funcție/salariilor de funcție, Stabilirea salarizării pentru funcții specifice
soldelor de grad/salariilor gradului profesional deținut, gradațiilor Art. 28. — (1) Autoritățile, instituțiile publice și celelalte unități
și a soldelor de comandă/salariilor de comandă și a bugetare pot include în statele de funcții și unele funcții specifice
indemnizațiilor lunare, după caz. altor domenii de activitate bugetară, prevăzute în anexele la
(3) Începând cu anul 2018, la stabilirea limitei de sporuri prezenta lege, care se dovedesc a fi necesare desfășurării
prevăzute la alin. (2) se includ și drepturile prevăzute la anexa activității.
nr. II cap. II art. 2 alin. (1) și art. 3 alin. (2) și (3). (2) Salariile de bază ale personalului încadrat în funcții
(4) Prevederile alin. (1) nu se aplică personalului trimis în specifice, care nu sunt prevăzute în prezenta lege, se stabilesc
misiune în străinătate. de ordonatorii principali de credite cu avizul Ministerului Muncii
Premii și prime și Justiției Sociale, al Ministerului Finanțelor Publice și al
Art. 26. — (1) Ordonatorii de credite pot acorda lunar premii Agenției Naționale a Funcționarilor Publici pentru funcționarii
de excelență pentru personalul care a participat direct la publici, prin asimilare cu funcțiile și salariile de bază prevăzute
obținerea unor rezultate deosebite în activitatea instituțiilor sau în anexele la prezenta lege și aplicabile categoriei de personal
autorităților publice, în limita a 5% din cheltuielile cu salariile de respective.
bază, soldele de funcție/salariile de funcție, soldele de (3) Salarizarea personalului contractual încadrat potrivit legii
grad/salariile gradului profesional deținut, gradațiile și soldele la cabinetele parlamentare ale deputaților și senatorilor din
de comandă/salariile de comandă, indemnizațiile de încadrare și circumscripțiile electorale se stabilește și se aprobă prin
indemnizațiile lunare aferente personalului prevăzut în statul de hotărâre a birourilor permanente reunite ale Camerei Deputaților
funcții, sub condiția încadrării în fondurile aprobate prin buget. și Senatului, având ca limită minimă salariul minim brut pe țară
(2) Premiile de excelență se pot acorda în cursul anului garantat în plată, iar ca limită maximă salariul de bază al funcției
personalului care a realizat sau a participat direct la obținerea echivalente utilizată în cabinetul demnitarului. Nomenclatorul și
unor rezultate deosebite în activitatea instituției/autorității publice ierarhia funcțiilor sunt prevăzute în anexa nr. VIII cap. II lit. A
sau a sistemului din care face parte, a participat la activități cu pct. I pct. 2.9.
caracter deosebit, a efectuat lucrări cu caracter excepțional ori Cumulul de funcții pentru unele funcții specifice
a avut un volum de activitate ce depășește în mod semnificativ Art. 29. — (1) În cazuri excepționale, posturile vacante și
volumul optim de activitate, în raport de complexitatea sarcinilor, temporar vacante aferente funcțiilor didactice de predare,
ținându-se seama de evaluarea criteriilor prevăzute la art. 8 funcțiilor de specialitate medico-sanitară și asistență socială și
alin. (2). Sumele neutilizate pot fi utilizate în lunile următoare, în funcțiilor de specialitate artistică pot fi ocupate și prin cumul de
cadrul aceluiași an bugetar. funcții de personal angajat, cu respectarea prevederilor legale
(3) Premiile de excelență individuale lunare nu pot depăși, privind cumulul de funcții și a celor referitoare la ocuparea
anual, două salarii de bază minim brute pe țară garantate în posturilor vacante, în condițiile prevăzute la alin. (2).
plată și se stabilesc de către ordonatorii de credite în limita (2) Posturile vacante și temporar vacante aferente funcțiilor
sumelor aprobate în buget cu această destinație, în condițiile didactice de predare, funcțiilor de specialitate medico-sanitară și
legii, avându-se în vedere elementele prevăzute la alin. (2), cu asistență socială și funcțiilor de specialitate artistică, care nu au
consultarea organizațiilor sindicale reprezentative la nivel de putut fi ocupate prin concurs, pot fi ocupate prin cumul și de
unitate sau, după caz, cu consultarea reprezentanților către persoane din aceeași unitate și numai în condițiile în care
salariaților, acolo unde nu sunt constituite astfel de organizații programul funcției cumulate nu se suprapune celui
sindicale. corespunzător funcției de bază. În astfel de situații nu sunt
(4) Începând cu data de 1 decembrie 2018, ordonatorii de aplicabile prevederile art. 16.
credite acordă, obligatoriu, o indemnizație de vacanță. Exercitarea cu caracter temporar a unei funcții de
Modalitatea de acordare se stabilește prin hotărâre a conducere
Guvernului. Art. 30. — (1) Exercitarea cu caracter temporar a unei funcții
(5) Valoarea anuală a indemnizației de vacanță este la nivelul de conducere se realizează prin numirea temporară a unei
unui salariu de bază minim brut pe țară garantat în plată și se persoane angajate/numite care îndeplinește condițiile specifice
acordă proporțional cu timpul efectiv lucrat în cursul anului pentru ocuparea funcției de conducere și care nu a fost
calendaristic. sancționată disciplinar, până la ocuparea prin concurs a postului,
(6) Indemnizația de vacanță prevăzută la alin. (4) și (5) se dacă în statute sau în legi speciale nu se prevede altfel.
acordă cu încadrarea în prevederile art. 25 alin. (1). (2) În perioada în care persoana angajată/numită exercită cu
(7) Indemnizația de vacanță nu se acordă persoanelor care caracter temporar o funcție de conducere, aceasta beneficiază
ocupă funcții de demnitate publică, alese și numite. de drepturile salariale aferente funcției de conducere respective.
Încadrarea și promovarea unor categorii de personal
CAPITOLUL III Art. 31. — (1) Pentru personalul contractual sau alte categorii
Alte dispoziții de personal care nu beneficiază de statute speciale, ocuparea
Salarizarea în caz de suspendare a raportului de muncă unui post vacant sau temporar vacant se face prin concurs sau
sau de serviciu examen, pe baza regulamentului-cadru care se aprobă prin
Art. 27. — (1) Personalul care s-a aflat în concediu plătit hotărâre a Guvernului.
pentru creșterea și îngrijirea copilului în vârstă de până la 2 ani, (2) Încadrarea și promovarea personalului plătit din fonduri
respectiv 7 ani, în cazul copilului cu handicap, precum și publice pe funcții, grade sau trepte profesionale se fac potrivit
personalul ale cărui raporturi de muncă sau raporturi de serviciu prevederilor din statute sau alte acte normative specifice
au fost suspendate din alte cauze, potrivit legii, la reluarea domeniului de activitate, aprobate prin legi, hotărâri ale
activității își păstrează gradul sau treapta profesională în care a Guvernului sau acte administrative ale ordonatorului principal
fost încadrat anterior suspendării, salarizarea urmând a se face de credite, după caz.
la nivelul de salarizare pentru funcții similare. (3) În situația în care promovarea personalului contractual
(2) Pentru personalul prevăzut la alin. (1), gradația se sau a altor categorii de personal bugetar în funcție, grad sau
stabilește luând în considerare și perioadele care, conform treaptă profesională nu este reglementată prin statute proprii,
legilor speciale aplicabile, constituie vechime în muncă care se promovarea se face de regulă pe un post vacant existent în
are în vedere la stabilirea drepturilor salariale. statul de funcții.
8 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

(4) În situația în care nu există un post vacant, promovarea d) valoarea anuală a indemnizației de hrană care urmează să
personalului plătit din fonduri publice în funcții, grade sau trepte fie acordată pentru o perioadă lucrată de un an, precum și baza
profesionale se va face prin transformarea postului din statul de legală a acordării acesteia;
funcții în care acesta este încadrat într-unul de nivel imediat e) orice alte drepturi în bani și/sau în natură, dacă este cazul,
superior. precum și baza legală a acordării acestora;
(5) Promovarea în funcții, în grade sau trepte profesionale f) orice informații cu privire la posibile limitări ale venitului
imediat superioare se realizează pe baza criteriilor stabilite prin salarial, precum și baza legală a acestora.
regulament-cadru, care se aprobă prin hotărâre a Guvernului, (2) Nerespectarea prevederilor alin. (1) atrage răspunderea
dacă nu este reglementată altfel prin statute sau alte acte contravențională a conducătorului autorității sau instituției
normative specifice. publice în cauză și se sancționează cu amendă între 5.000 și
(6) Promovarea în grade sau trepte profesionale imediat 10.000 lei.
superioare se face din 3 în 3 ani, în funcție de performanțele (3) Inspecția Muncii are competența de a constata și
profesionale individuale, apreciate cu calificativul „foarte bine”, sancționa contravenția prevăzută la alin. (2).
cel puțin de două ori în ultimii 3 ani de activitate, de către (4) Contravenției prevăzute la alin. (2) i se aplică regimul
comisia desemnată prin dispoziție a ordonatorului de credite general stabilit prin Ordonanța Guvernului nr. 2/2001 privind
bugetare, din care fac parte reprezentanții organizațiilor regimul juridic al contravențiilor, aprobată cu modificări și
sindicale reprezentative la nivel de unitate sau, după caz, completări prin Legea nr. 180/2002, cu modificările și
reprezentanții salariaților, dacă în statute sau în legi speciale nu completările ulterioare.
se prevede altfel.
(7) Activitatea profesională se apreciază anual, ca urmare a CAPITOLUL IV
evaluării performanțelor profesionale individuale, de către Dispoziții tranzitorii și finale
conducătorul instituției publice, la propunerea șefului ierarhic, Detașarea, delegarea și alte drepturi
prin acordarea calificativelor „foarte bine”, „bine”, „satisfăcător” Art. 34. — (1) Prevederile din actele normative referitoare la
sau „nesatisfăcător”, dacă în statute sau în legi speciale nu se mutare, acordarea concediilor, cheltuieli de transport, cheltuieli
prevede altfel. cu cazarea și locuința rămân în vigoare.
(8) Ordonatorii de credite pot aproba demararea procedurilor (2) Drepturile și obligațiile personalului autorităților și
privind promovarea pe funcții, grade sau trepte profesionale a instituțiilor publice care îndeplinește unele activități cu caracter
personalului numai cu condiția încadrării în cheltuielile de temporar, în țară și în străinătate, inclusiv cu ocazia delegării
personal aprobate în buget. sau detașării, se stabilesc prin hotărâre a Guvernului, dacă prin
Transferul prezenta lege sau alte acte normative în vigoare nu se
Art. 32. — (1) Ocuparea unui post vacant în sistemul bugetar reglementează altfel.
se poate face și prin transfer, dacă se realizează de pe un post (3) Până la data intrării în vigoare a actelor normative
din sistemul bugetar, similar sau echivalent. prevăzute la alin. (2), rămân aplicabile prevederile referitoare la
(2) Transferul poate avea loc după cum urmează: delegare și detașare din actele normative în vigoare la data
a) în interesul serviciului, numai cu acordul scris al persoanei prevăzută la art. 43.
care se transferă; Caracterul drepturilor salariale
b) la cererea persoanei, în urma aprobării cererii de transfer Art. 35. — Sumele reprezentând drepturile salariale
de către conducătorul autorității sau instituției publice la care se prevăzute de prezenta lege sunt lunare, în formă brută și supuse
solicită transferul și de la care se transferă. impozitării, potrivit legii.
(3) Prevederile din actele normative specifice domeniului de Reîncadrarea personalului
activitate referitoare la transfer rămân în vigoare. Art. 36. — (1) La data intrării în vigoare a prezentei legi,
(4) Ordonatorul de credite, în raport cu cerințele postului, reîncadrarea personalului salarizat potrivit prezentei legi se face
stabilește criterii de selecție proprii de transfer în completarea pe noile funcții, grade/trepte profesionale, gradație
celor prevăzute la alin. (1) și (2), cu consultarea organizațiilor corespunzătoare vechimii în muncă și vechime în
sindicale reprezentative la nivel de unitate sau, după caz, cu specialitate/vechime în învățământ avute, cu stabilirea salariilor
consultarea reprezentanților salariaților, acolo unde nu sunt de bază, soldelor de funcție/salariilor de funcție, indemnizațiilor
astfel de organizații sindicale. de încadrare și indemnizațiilor lunare potrivit art. 38.
Transparența veniturilor salariale (2) În cazul în care funcția deținută nu se regăsește în
Art. 33. — (1) Toate autoritățile și instituțiile publice prezenta lege, reîncadrarea se face pe una dintre funcțiile
enumerate la art. 2 alin. (1) și (3) vor publica la sediul propriu și prevăzute în anexe.
pe pagina proprie de internet, în datele de 31 martie și (3) Salarizarea personalului din autoritățile și instituțiile
30 septembrie ale fiecărui an, și vor menține publicată o listă a publice finanțate integral din venituri proprii, aflate în subordinea,
tuturor funcțiilor din autoritățile sau instituțiile publice respective sub autoritatea, în coordonarea Guvernului, ministerelor și a
ce intră în categoria personalului plătit din fonduri publice, celorlalte organe de specialitate ale administrației publice
cuprinzând următoarele: centrale și locale, din cele aflate în coordonarea prim-ministrului,
a) salariul de bază, solda funcției de bază/salariul funcției de precum și din cele aflate sub controlul Parlamentului se
bază, indemnizația de încadrare sau indemnizația lunară, după realizează potrivit anexei nr. VII, în limita cheltuielilor de personal
caz; aprobate.
b) tipul, baza de calcul, cota procentuală, valoarea brută a (4) Personalul autorităților și instituțiilor publice finanțate
sporurilor, compensațiilor, adaosurilor, primelor și premiilor integral din venituri proprii, nou-înființate, aflate în subordinea,
eligibile pentru fiecare funcție, precum și baza legală a acordării sub autoritatea, în coordonarea Guvernului, ministerelor și a
acestora; celorlalte organe de specialitate ale administrației publice
c) valoarea anuală a voucherelor de vacanță care urmează centrale și locale, din cele aflate în coordonarea prim-ministrului,
să fie acordate pentru o perioadă lucrată de un an, precum și precum și din cele aflate sub controlul Parlamentului beneficiază
baza legală a acordării acestora; de salariile stabilite potrivit anexei nr. VII.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 9

Soluționarea contestațiilor în condițiile reglementate de prezenta lege, utilizând salariul de


Art. 37. — (1) Soluționarea contestațiilor în legătură cu bază stabilit potrivit prezentului articol, fără a depăși limita
stabilirea salariilor de bază/soldelor de funcție/salariilor de prevăzută la art. 25;
funcție/indemnizațiilor de încadrare, a sporurilor, a creșterilor d) prin excepție de la lit. a), începând cu 1 martie 2018,
salariale, a premiilor și a altor drepturi care se acordă potrivit cuantumul brut al salariilor de bază, precum și cuantumul
prevederilor prezentei legi este de competența ordonatorilor de sporurilor, indemnizațiilor, compensațiilor, primelor, premiilor și al
credite. celorlalte elemente ale sistemului de salarizare care fac parte,
(2) Contestația poate fi depusă în termen de 20 de zile potrivit legii, din salariul lunar brut, de care beneficiază
calendaristice de la data comunicării actului administrativ de personalul care ocupă funcții didactice din unitățile de
stabilire a drepturilor salariale, la sediul ordonatorului de credite. învățământ preuniversitar și universitar de stat, se majorează
(3) Ordonatorii de credite soluționează contestațiile în termen cu 20% față de nivelul acordat pentru luna februarie 2018;
de 30 de zile calendaristice. e) prin excepție de la lit. a), salariile lunare ale personalului
(4) Împotriva modului de soluționare a contestației persoana prevăzut la art. 11 se stabilesc în conformitate cu prevederile
nemulțumită se poate adresa instanței de contencios acestui articol;
administrativ sau, după caz, instanței judecătorești competente f) indemnizațiile lunare pentru funcțiile de demnitate publică
potrivit legii, în termen de 30 de zile calendaristice de la data prevăzute în anexa nr. IX se stabilesc pe baza coeficienților și a
comunicării soluționării contestației. Instanța se pronunță de salariului de bază minim brut pe țară garantat în plată;
urgență și cu precădere. g) pentru personalul încadrat în unități sanitare publice aflate
Aplicarea legii în relație contractuală cu casele de asigurări de sănătate,
Art. 38. — (1) Prevederile prezentei legi se aplică etapizat, influențele financiare determinate de creșterile salariale
începând cu data de 1 iulie 2017. prevăzute la lit. a)—c) se asigură prin transferuri din bugetul
(2) Începând cu data de 1 iulie 2017: Fondului național unic de asigurări sociale de sănătate de la o
a) se mențin în plată la nivelul acordat pentru luna iunie 2017, poziție distinctă.
până la 31 decembrie 2017, cuantumul brut al salariilor de bază, (4) În perioada 2019—2022 se va acorda anual o creștere a
soldelor de funcție/salariilor de funcție și indemnizațiilor de salariilor de bază, soldelor de funcție/salariilor de funcție,
încadrare, precum și cuantumul sporurilor, indemnizațiilor, indemnizațiilor de încadrare, fiecare creștere reprezentând 1/4
compensațiilor, primelor și al celorlalte elemente ale sistemului din diferența dintre salariul de bază, solda de funcție/salariul de
de salarizare care fac parte, potrivit legii, din salariul brut lunar, funcție, indemnizația de încadrare prevăzute de lege pentru anul
indemnizația brută de încadrare, solda lunară de care 2022 și cel/cea din luna decembrie 2018. Creșterea respectivă
beneficiază personalul plătit din fonduri publice, în măsura în și data de aplicare se stabilesc prin legea anuală a bugetului de
care personalul ocupă aceeași funcție și își desfășoară stat cu respectarea prevederilor art. 6 lit. h).
activitatea în aceleași condiții; (5) Prin legea privind plafoanele unor indicatori specificați în
b) prin excepție de la lit. a), salariile lunare ale personalului cadrul fiscal-bugetar se pot stabili anual alte majorări salariale
prevăzut la art. 11 se stabilesc în conformitate cu prevederile decât cele prevăzute de prezentul articol.
acestui articol; (6) În situația în care, începând cu 1 ianuarie 2018, salariile
c) prin excepție de la prevederile lit. a), indemnizațiile lunare de bază, soldele de funcție/salariile de funcție, indemnizațiile de
ale personalului care ocupă funcții de demnitate publică se încadrare sunt mai mari decât cele stabilite potrivit prezentei legi
stabilesc prin înmulțirea coeficienților din anexa nr. IX cu salariul pentru anul 2022 sau devin ulterior mai mari ca urmare a
de bază minim brut pe țară garantat în plată; majorărilor salariale reglementate, se acordă cele stabilite
d) până la data de 31 decembrie 2017 se acordă drepturile pentru anul 2022.
de hrană și tichetele de masă de care beneficiază, la data intrării (7) Salariile de bază, soldele de funcție/salariile de funcție și
în vigoare a prezentei legi, unele categorii de personal bugetar, indemnizațiile de încadrare se rotunjesc din leu în leu în
în măsura în care își desfășoară activitatea în aceleași condiții. favoarea salariatului.
(3) Începând cu data de 1 ianuarie 2018 se acordă Aplicarea tranzitorie
următoarele creșteri salariale: Art. 39. — (1) Până la aplicarea integrală a prevederilor
a) cuantumul brut al salariilor de bază, soldelor de prezentei legi, pentru personalul nou-încadrat, pentru personalul
funcție/salariilor de funcție, indemnizațiilor de încadrare, precum numit/încadrat în aceeași instituție/autoritate publică pe funcții
și cuantumul brut al sporurilor, indemnizațiilor, compensațiilor, de același fel, inclusiv pentru personalul promovat în funcții sau
primelor, premiilor și al celorlalte elemente ale sistemului de în grade/trepte profesionale, salarizarea se face la nivelul de
salarizare care fac parte, potrivit legii, din salariul lunar brut, salarizare pentru funcții similare.
indemnizația brută de încadrare, solda lunară/salariul lunar de (2) În situația în care nu există funcție similară în plată, nivelul
care beneficiază personalul plătit din fonduri publice se salariului de bază, soldei de funcție/salariului de funcție,
majorează cu 25% față de nivelul acordat pentru luna decembrie indemnizației de încadrare pentru personalul nou-încadrat,
2017, fără a depăși limita prevăzută la art. 25, în măsura în care pentru personalul numit/încadrat în aceeași instituție/autoritate
personalul respectiv își desfășoară activitatea în aceleași publică pe funcții de același fel se stabilește prin înmulțirea
condiții; coeficientului prevăzut în anexe cu salariul de bază minim brut
b) prin excepție de la lit. a), începând cu 1 martie 2018, pe țară garantat în plată în vigoare, la care se aplică, după caz,
salariile de bază ale personalului care ocupă funcțiile de medici prevederile art. 10 privind gradația corespunzătoare vechimii în
și de asistenți medicali din unitățile sanitare publice, prevăzute muncă.
în anexa nr. II cap. I, se majorează la nivelul salariului de bază (3) Sporul pentru titlul științific de doctor, acordat ca sumă
stabilit potrivit prezentei legi pentru anul 2022; compensatorie sau ca spor la salariul de bază, solda de
c) prin excepție de la lit. a), începând cu data de 1 martie funcție/salariul de funcție, indemnizația de încadrare, după caz,
2018, pentru personalul prevăzut în anexa nr. II, cuantumul de la data aplicării prevederilor prezentei legi nu se mai acordă,
sporurilor, majorărilor, indemnizațiilor, compensațiilor, premiilor și personalul care deține titlul științific de doctor, indiferent de data
al celorlalte elemente ale sistemului de salarizare se determină, obținerii acestuia, beneficiind de prevederile art. 14.
10 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

Indemnizațiile consilierilor locali și consilierilor județeni 7. art. 23 din Legea nr. 435/2006 privind salarizarea și alte
Art. 40. — Prin derogare de la prevederile art. 34 alin. (2) din drepturi ale personalului care își desfășoară activitatea în
Legea nr. 393/2004 privind Statutul aleșilor locali, cu modificările sistemul sanitar-veterinar, publicată în Monitorul Oficial al
și completările ulterioare, în perioada 1 iulie 2017— României, Partea I, nr. 980 din 7 decembrie 2006, cu
31 decembrie 2021, indemnizația maximă lunară de care modificările ulterioare;
beneficiază consilierii locali pentru participarea la numărul 8. art. 16 alin. (11) și (12) din Legea organizării și funcționării
maxim de ședințe este de până la 10% din indemnizația lunară statisticii oficiale din România nr. 226/2009, publicată în
a primarului, președintelui consiliului județean sau primarului Monitorul Oficial al României, Partea I, nr. 397 din 11 iunie 2009,
general al municipiului București, după caz, exclusiv majorările cu modificările și completările ulterioare;
prevăzute la art. 16 alin. (2). 9. Legea-cadru nr. 284/2010 privind salarizarea unitară a
Echivalarea unor studii personalului plătit din fonduri publice, publicată în Monitorul
Art. 41. — Salarizarea absolvenților ciclului I și/sau II Oficial al României, Partea I, nr. 877 din 28 decembrie 2010, cu
(Bologna) se face la nivelul absolvenților cu studii superioare de modificările și completările ulterioare;
lungă durată (S), potrivit art. 18 alin. (1) și (3) din Legea 10. Ordonanța de urgență a Guvernului nr. 70/2014 privind
nr. 288/2004 privind organizarea studiilor universitare, cu salarizarea personalului din cadrul sistemului public sanitar și
modificările și completările ulterioare. sistemului public de asistență socială în anul 2015, publicată în
Răspunderea aplicării legii Monitorul Oficial al României, Partea I, nr. 811 din 6 noiembrie
Art. 42. — (1) Încălcarea dispozițiilor prezentei legi privind 2014, aprobată cu modificări și completări prin Legea
stabilirea salariilor de bază sau, după caz, a soldelor de nr. 185/2015;
funcție/salariilor de funcție, soldelor de grad/salariilor gradului 11. cap. I, cuprinzând art. 1—13, și art. 32, 321 și 33 din
profesional deținut, gradațiilor, soldelor de comandă/salariilor de Ordonanța de urgență a Guvernului nr. 83/2014 privind
comandă, indemnizațiilor de încadrare, indemnizațiilor lunare, a salarizarea personalului plătit din fonduri publice în anul 2015,
sporurilor, creșterilor și a celorlalte drepturi salariale, precum și precum și alte măsuri în domeniul cheltuielilor publice, publicată
acordarea de drepturi fără respectarea prevederilor acesteia în Monitorul Oficial al României, Partea I, nr. 925 din
atrag, după caz, răspunderea disciplinară sau patrimonială a 18 decembrie 2014, aprobată cu modificări și completări prin
persoanelor vinovate, potrivit legii. Legea nr. 71/2015, cu modificările și completările ulterioare;
(2) Nerespectarea prevederilor art. 25 constituie contravenție 12. art. II din Legea nr. 71/2015 pentru aprobarea Ordonanței
și se sancționează, în funcție de gradul de vinovăție a de urgență a Guvernului nr. 83/2014 privind salarizarea
persoanelor responsabile, cu amendă între 5.000 lei și personalului plătit din fonduri publice în anul 2015, precum și
20.000 lei și recuperarea prejudiciului. alte măsuri în domeniul cheltuielilor publice, publicată în
(3) Constatarea contravențiilor pentru nerespectarea Monitorul Oficial al României, Partea I, nr. 233 din 6 aprilie 2015;
prevederilor art. 25, precum și aplicarea amenzii se fac de către 13. art. 8 alin. (2) din Ordonanța de urgență a Guvernului
organele de control ale Curții de Conturi a României. nr. 13/2015 privind înființarea, organizarea și funcționarea
Intrarea în vigoare Agenției Naționale pentru Achiziții Publice, publicată în Monitorul
Art. 43. — Prezenta lege intră în vigoare la data de 1 iulie Oficial al României, Partea I, nr. 362 din 26 mai 2015, aprobată
2017. prin Legea nr. 244/2015;
Abrogarea unor dispoziții 14. art. II din Ordonanța de urgență a Guvernului nr. 27/2015
Art. 44. — (1) La data intrării în vigoare a prezentei legi se pentru completarea Ordonanței de urgență a Guvernului
abrogă: nr. 83/2014 privind salarizarea personalului plătit din fonduri
1. art. 12 alin. (2) și (3) din Legea nr. 82/1992 privind publice în anul 2015, precum și alte măsuri în domeniul
rezervele de stat, republicată în Monitorul Oficial al României, cheltuielilor publice și pentru stabilirea unor măsuri bugetare,
Partea I, nr. 354 din 11 decembrie 1997, cu modificările și publicată în Monitorul Oficial al României, Partea I, nr. 474 din
completările ulterioare; 30 iunie 2015, aprobată prin Legea nr. 38/2016;
2. art. 18 alin. (2)—(5) din Ordonanța Guvernului nr. 15/1998 15. art. III din Ordonanța de urgență a Guvernului nr. 31/2015
privind Institutul European din România, publicată în Monitorul pentru modificarea și completarea Legii concurenței nr. 21/1996
Oficial al României, Partea I, nr. 40 din 30 ianuarie 1998, și pentru completarea art. 1 din Ordonanța de urgență a
aprobată cu modificări și completări prin Legea nr. 207/1998, cu Guvernului nr. 83/2014 privind salarizarea personalului plătit din
modificările și completările ulterioare; fonduri publice în anul 2015, precum și alte măsuri în domeniul
3. art. 30 alin. (3) din Ordonanța Guvernului nr. 137/2000 cheltuielilor publice, publicată în Monitorul Oficial al României,
privind prevenirea și sancționarea tuturor formelor de Partea I, nr. 474 din 30 iunie 2015, aprobată prin Legea
discriminare, republicată în Monitorul Oficial al României, nr. 347/2015;
Partea I, nr. 166 din 7 martie 2014; 16. art. 4 din Ordonanța de urgență a Guvernului nr. 32/2015
4. art. 7 din Ordonanța de urgență a Guvernului nr. 153/2002 privind înființarea Gărzilor forestiere, publicată în Monitorul
privind organizarea și funcționarea Oficiului Registrului Național Oficial al României, Partea I, nr. 474 din 30 iunie 2015, cu
al Informațiilor Secrete de Stat, publicată în Monitorul Oficial al modificările ulterioare;
României, Partea I, nr. 826 din 15 noiembrie 2002, aprobată prin 17. art. II și III din Legea nr. 293/2015 privind aprobarea
Legea nr. 101/2003, cu modificările și completările ulterioare; Ordonanței de urgență a Guvernului nr. 35/2015 pentru
5. art. 36 lit. f) din Legea nr. 293/2004 privind statutul modificarea și completarea Ordonanței de urgență a Guvernului
funcționarilor publici cu statut special din Administrația Națională nr. 83/2014 privind salarizarea personalului plătit din fonduri
a Penitenciarelor, republicată în Monitorul Oficial al României, publice în anul 2015, precum și alte măsuri în domeniul
Partea I, nr. 264 din 10 aprilie 2014, cu modificările ulterioare; cheltuielilor publice, precum și pentru modificarea și
6. art. 16—19 din Legea nr. 227/2006 privind prevenirea și completarea Legii nr. 152/1998 privind înființarea Agenției
combaterea dopajului în sport, republicată în Monitorul Oficial Naționale pentru Locuințe, publicată în Monitorul Oficial al
al României, Partea I, nr. 156 din 1 martie 2016, cu modificările României, Partea I, nr. 884 din 25 noiembrie 2015, cu
ulterioare; modificările ulterioare;
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 11

18. art. 17 alin. (2) din Ordonanța de urgență a Guvernului domeniul bugetar, publicată în Monitorul Oficial al României,
nr. 86/2014 privind stabilirea unor măsuri de reorganizare la Partea I, nr. 636 din 10 septembrie 2010, aprobată cu modificări
nivelul administrației publice centrale și pentru modificarea și și completări prin Legea nr. 283/2011, cu excepția art. 19;
completarea unor acte normative, publicată în Monitorul Oficial 28. cap. I, cuprinzând art. 1—14 și art. 18 din Ordonanța de
al României, Partea I, nr. 920 din 17 decembrie 2014, aprobată urgență a Guvernului nr. 103/2013 privind salarizarea
cu modificări și completări prin Legea nr. 174/2015, cu personalului plătit din fonduri publice în anul 2014, precum și
modificările și completările ulterioare; alte măsuri în domeniul cheltuielilor publice, publicată în
19. art. 101 alin. (10) din Legea nr. 208/2015 privind alegerea Monitorul Oficial al României, Partea I, nr. 703 din 15 noiembrie
Senatului și a Camerei Deputaților, precum și pentru 2013, aprobată cu completări prin Legea nr. 28/2014, cu
organizarea și funcționarea Autorității Electorale Permanente, modificările și completările ulterioare;
publicată în Monitorul Oficial al României, Partea I, nr. 553 din 29. cap. I, cuprinzând art. 1—5, art. 9 și 10 din Ordonanța
24 iulie 2015, cu modificările și completările ulterioare; de urgență a Guvernului nr. 84/2012 privind stabilirea salariilor
20. cap. I, cuprinzând art. 1—121, art. 13 și 16 din Ordonanța personalului din sectorul bugetar în anul 2013, prorogarea unor
de urgență a Guvernului nr. 57/2015 privind salarizarea termene din acte normative, precum și unele măsuri fiscal-
personalului plătit din fonduri publice în anul 2016, prorogarea bugetare, publicată în Monitorul Oficial al României, Partea I,
unor termene, precum și unele măsuri fiscal-bugetare, publicată nr. 845 din 13 decembrie 2012, aprobată prin Legea nr. 36/2014;
în Monitorul Oficial al României, Partea I, nr. 923 din 30. Legea nr. 285/2010 privind salarizarea în anul 2011 a
11 decembrie 2015, cu modificările și completările ulterioare; personalului plătit din fonduri publice, publicată în Monitorul
21. art. I, II, III și IV din Ordonanța de urgență a Guvernului Oficial al României, Partea I, nr. 878 din 28 decembrie 2010, cu
nr. 43/2016 pentru modificarea și completarea Ordonanței de modificările și completările ulterioare, cu excepția art. 14;
urgență a Guvernului nr. 57/2015 privind salarizarea 31. Ordonanța de urgență a Guvernului nr. 19/2012 privind
personalului plătit din fonduri publice în anul 2016, prorogarea aprobarea unor măsuri pentru recuperarea reducerilor salariale,
unor termene, precum și unele măsuri fiscal-bugetare, pentru publicată în Monitorul Oficial al României, Partea I, nr. 340 din
modificarea și completarea unor acte normative și pentru 18 mai 2012, aprobată prin Legea nr. 182/2012, cu modificările
aplicarea unitară a dispozițiilor legale, publicată în Monitorul ulterioare;
Oficial al României, Partea I, nr. 673 din 31 august 2016, cu 32. Ordonanța de urgență a Guvernului nr. 26/1997 privind
modificările și completările ulterioare;
protecția copilului aflat în dificultate, republicată în Monitorul
22. art. II din Legea nr. 193/2016 pentru completarea Legii-
Oficial al României, Partea I, nr. 276 din 24 iulie 1998, aprobată
cadru nr. 284/2010 privind salarizarea unitară a personalului
cu modificări și completări prin Legea nr. 108/1998, cu
plătit din fonduri publice, precum și pentru stabilirea unor măsuri
modificările și completările ulterioare;
fiscal-bugetare, publicată în Monitorul Oficial al României,
33. alin. (3) și prevederile referitoare la acordarea sporului
Partea I, nr. 876 din 2 noiembrie 2016;
23. art. I, I1, I2 și III din Ordonanța de urgență a Guvernului de importanță națională de 25% din cuprinsul alin. (2) al art. 21
nr. 20/2016 pentru modificarea și completarea Ordonanței de din Legea nr. 752/2001 privind organizarea și funcționarea
urgență a Guvernului nr. 57/2015 privind salarizarea Academiei Române, republicată în Monitorul Oficial al României,
personalului plătit din fonduri publice în anul 2016, prorogarea Partea I, nr. 299 din 7 mai 2009;
unor termene, precum și unele măsuri fiscal-bugetare și pentru 34. art. 16 alin. (2) din Ordonanța de urgență a Guvernului
modificarea și completarea unor acte normative, publicată în nr. 41/2014 privind înființarea, organizarea și funcționarea
Monitorul Oficial al României, Partea I, nr. 434 din 9 iunie 2016, Agenției pentru Finanțarea Investițiilor Rurale, prin
aprobată cu modificări și completări prin Legea nr. 250/2016, cu reorganizarea Agenției de Plăți pentru Dezvoltare Rurală și
modificările ulterioare; Pescuit, publicată în Monitorul Oficial al României, Partea I,
24. art. 291 din Legea nr. 144/2007 privind înființarea, nr. 472 din 26 iunie 2014, aprobată prin Legea nr. 43/2015, cu
organizarea și funcționarea Agenției Naționale de Integritate, modificările și completările ulterioare;
republicată în Monitorul Oficial al României, Partea I, nr. 535 din 35. art. 13 alin. (2) din Hotărârea Guvernului nr. 1.522/2006
3 august 2009, cu modificările și completările ulterioare; privind aprobarea structurii organizatorice și a Regulamentului
25. art. II din Ordonanța de urgență a Guvernului nr. 5/2013 de organizare și funcționare ale Agenției Naționale Anti-Doping,
pentru modificarea și completarea Legii nr. 144/2007 privind republicată în Monitorul Oficial al României, Partea I, nr. 41 din
înființarea, organizarea și funcționarea Agenției Naționale de 19 ianuarie 2010, cu modificările și completările ulterioare;
Integritate, publicată în Monitorul Oficial al României, Partea I, 36. orice alte dispoziții contrare prezentei legi.
nr. 72 din 4 februarie 2013, aprobată prin Legea nr. 132/2013; (2) Începând cu data de 1 ianuarie 2018, prevederile
26. Ordonanța de urgență a Guvernului nr. 19/2012 privind referitoare la acordarea tichetelor de masă salariaților din
aprobarea unor măsuri pentru recuperarea reducerilor salariale, sectorul bugetar prevăzute la art. 1 alin. (1) și (2) din Legea
publicată în Monitorul Oficial al României, Partea I, nr. 340 din nr. 142/1998 privind acordarea tichetelor de masă, publicată în
18 mai 2012, aprobată cu modificări prin Legea nr. 182/2012, Monitorul Oficial al României, Partea I, nr. 260 din 13 iulie 1998,
cu modificările și completările ulterioare; cu modificările și completările ulterioare, se abrogă.
27. art. II din Ordonanța de urgență a Guvernului nr. 80/2010 Anexele
privind reglementarea unor măsuri financiare în domeniul Art. 45. — Anexele nr. I – IX fac parte integrantă din prezenta
bugetar, precum și pentru instituirea altor măsuri financiare în lege.
Această lege a fost adoptată de Parlamentul României, cu respectarea prevederilor art. 75 și ale art. 76 alin. (1) din
Constituția României, republicată.
p. PREȘEDINTELE CAMEREI DEPUTAȚILOR, PREȘEDINTELE SENATULUI
FLORIN IORDACHE CĂLIN-CONSTANTIN-ANTON POPESCU-TĂRICEANU

București, 28 iunie 2017.


Nr. 153.
12 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. I

FA M I L I A O C U PA Ț I O N A L Ă D E F U N C Ț I I B U G E TA R E „ Î N V Ă Ț Ă M Â N T ”

CAPITOLUL I
A. Salarii de bază pentru funcțiile din învățământ
1. Funcțiile de conducere din învățământul superior

6DODULXOGHED]ă
OHL &RHILFLHQW
1U 1LYHOXO
)XQF‫܊‬LD $QXO
FUW VWXGLLORU
*UDG
*UDG, *UDG, *UDG,,
,,
 5HFWRU  6    
 3URUHFWRU  6    
 'LUHFWRUJHQHUDODGPLQLVWUDWLYDOXQLYHUVLWă‫܊‬LL 6    
 'HFDQ  6    
 3URGHFDQ  6    
 'LUHFWRUGHGHSDUWDPHQW  6    
'LUHFWRUJHQHUDODGMXQFWDGPLQLVWUDWLYDO
 6    
XQLYHUVLWă‫܊‬LL'LUHFWRU
*) Salariile de bază pot cuprinde și salariul de bază aferent unei norme didactice.

N O T Ă:
*) Salariile de bază pot cuprinde și salariul de bază aferent unei norme didactice.
N O T Ă:
1. Salarizarea Președintelui Senatului universitar se face la nivel de rector.
2. Stabilirea salariului de bază se face prin hotărârea conducerii, potrivit Cartei universității, după caz, între valorile
corespunzătoare gradului I și gradului II, cu încadrarea în bugetul instituției, în funcție de gradul universității, mărimea și
complexitatea structurii conduse.

2. Funcțiile de conducere, de îndrumare și control din învățământul preuniversitar

6DODULXOGHED]ă
1U 1LYHOXO OHL &RHILFLHQW
)XQF‫܊‬LD $QXO
FUW VWXGLLORU
*UDG, *UDG,, *UDG, *UDG,,
 ,QVSHFWRU‫܈‬FRODUJHQHUDO  6    
 ,QVSHFWRU‫܈‬FRODUJHQHUDODGMXQFW  6    
 'LUHFWRUFDVDFRUSXOXLGLGDFWLF  6    
,QVSHFWRU‫܈‬FRODUGHVSHFLDOLWDWHLQVSHFWRU
6  
 ‫܈‬FRODU   
 'LUHFWRUXQLWDWHGHvQYă‫܊‬ăPkQW   6    
 'LUHFWRUDGMXQFWXQLWDWHGHvQYă‫܊‬ăPkQW   6    
*) Salariile de bază cuprind și salariul de bază aferent unei norme didactice.
**) Nivelul salariilor de bază pentru funcțiile didactice de conducere, respectiv director și director adjunct din învățământul preuniversitar de stat, se va
stabili prin norme metodologice aprobate prin hotărâre a Guvernului.

N O T Ă:
1. Pentru funcțiile didactice de conducere, de îndrumare și control, ocupate cu personal didactic care a absolvit studii
superioare de scurtă durată, salariile de bază se vor stabili prin diminuarea cu un procent de 20% a salariilor de bază prevăzute
la funcțiile de conducere cu studii superioare din tabelul de mai sus.
2. Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 13

3. Funcțiile de conducere pentru funcțiile didactice auxiliare

6DODULXOGHED]ă
1U 1LYHOXO OHL &RHILFLHQW
)XQF‫܊‬LD $QXO
FUW VWXGLLORU
*UDG, *UDG,, *UDG, *UDG,,
ÌQYă‫܊‬ăPkQWVXSHULRU     
 'LUHFWRUFRQWDELO‫܈‬HI 6    
 $GPLQLVWUDWRU‫܈‬HIIDFXOWDWH 6    
 6HFUHWDU‫܈‬HIXQLYHUVLWDWH 6    
 6HFUHWDU‫܈‬HIIDFXOWDWH 6    
 ‫܇‬HIVHUYLFLX 6    
 ‫܇‬HIELURX 6    
ÌQYă‫܊‬ăPkQWSUHXQLYHUVLWDU 
 &RQWDELO‫܈‬HI QLYHOPD[LP 6    
6HFUHWDU‫܈‬HIXQLWDWHGHvQYă‫܊‬ăPkQW 
 6    
QLYHOPD[LP
 &RQWDELO‫܈‬HI QLYHOPD[LP 0    
6HFUHWDU‫܈‬HIXQLWDWHGHvQYă‫܊‬ăPkQW 
 0    
QLYHOPD[LP
*) Salariile de bază cuprind și salariul de bază aferent funcției de execuție.
**) Categoriile de unități de învățământ preuniversitar de stat în care se normează funcțiile de conducere și nivelul salariilor de bază pentru acestea se
stabilesc prin norme metodologice aprobate prin hotărâre a Guvernului.

N O T Ă:
1. Pentru funcțiile didactice auxiliare de conducere, de îndrumare și control, ocupate cu personal didactic auxiliar care a
absolvit studii superioare de scurtă durată, salariile de bază se vor stabili prin diminuarea cu un procent de 20% a salariilor de bază
prevăzute la funcțiile de conducere cu studii superioare din tabelul prevăzut la pct. 3.
2. Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

4. Salarii de bază învățământ universitar



6DODULXOGH
1U ED]ăOHL
)XQF‫܊‬LD  1LYHOXO 9HFKLPHDvQ
FUW *UDGD‫܊‬LD &RHILFLHQW
 VWXGLLORU vQYă‫܊‬ăPkQW

$QXO
6 SHVWHGHDQL  
6 DQL  
3URIHVRU
 6 DQL  
XQLYHUVLWDU
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
&RQIHUHQ‫܊‬LDU 6 DQL  

XQLYHUVLWDU 6 DQL  
6 DQL  
6 DQL  
14 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

6 SHVWHGHDQL  


6 DQL  
‫܇‬HIOXFUăUL 6 DQL  

OHFWRUXQLYHUVLWDU  6 DQL  
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
6 DQL  
 $VLVWHQWXQLYHUVLWDU 6 DQL  
6 DQL  
6 DQL  
6 SkQăODDQL  
*) Funcțiile se ocupă potrivit prevederilor Legii educației naționale nr. 1/2011, cu modificările și completările ulterioare.

N O T Ă:
1. Salariile de bază prevăzute în prezenta anexă la pct. 1, 3 și 4 reprezintă nivelul minim, iar nivelul maxim se stabilește
prin majorarea acesteia în funcție de specificul activității desfășurate și de calitatea acesteia. Sumele pentru aceste majorări se
vor plăti exclusiv din venituri proprii.
2. Încadrarea între limite se face anual, pe baza criteriilor aprobate de consiliul de administrație.

5. Salarii de bază învățământ preuniversitar

6DODULXOGH
1U 1LYHOXO 9HFKLPHDvQ ED]ăOHL
)XQF‫܊‬LDGLGDFWLFă‫܈‬LJUDGXOGLGDFWLF  &RHILFLHQW
FUW VWXGLLORU vQYă‫܊‬ăPkQW *UDGD‫܊‬LD
$QXO
6 SHVWHGHDQL  
6 DQL  
3URIHVRUVWXGLLVXSHULRDUHGHOXQJă 6 DQL  

GXUDWăJUDGGLGDFWLF, 6 DQL  
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
3URIHVRUVWXGLLVXSHULRDUHGHOXQJă 6 DQL  

GXUDWăJUDGGLGDFWLF,, 6 DQL  
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
3URIHVRUVWXGLLVXSHULRDUHGHOXQJă 6 DQL  

GXUDWăJUDGGLGDFWLFGHILQLWLY 6 DQL  
6 DQL  
6 DQL  
3URIHVRUVWXGLLVXSHULRDUHGHOXQJă
 6 SkQăODDQ  
GXUDWăGHEXWDQW
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 15

66' SHVWHGHDQL  


66' DQL  
3URIHVRUVWXGLLVXSHULRDUHGHVFXUWă
 66' DQL  
GXUDWăJUDGGLGDFWLF,
66' DQL  
66' DQL  
66' SHVWHGHDQL  
66' DQL  
3URIHVRUVWXGLLVXSHULRDUHGHVFXUWă 66' DQL  

GXUDWăJUDGGLGDFWLF,, 66' DQL  
66' DQL  
66' DQL  
66' SHVWHGHDQL  
66' DQL  
3URIHVRUVWXGLLVXSHULRDUHGHVFXUWă 66' DQL  

GXUDWăJUDGGLGDFWLFGHILQLWLY 66' DQL  
66' DQL  
66' DQL  
3URIHVRUVWXGLLVXSHULRDUHGHVFXUWă
 66' SkQăODDQ  
GXUDWăGHEXWDQW
6 SHVWHGHDQL  
6 DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
 6 DQL  
VXSHULRDUHOXQJăGXUDWăJUDGGLGDFWLF,
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL 6 DQL  

VXSHULRDUHOXQJăGXUDWăJUDGGLGDFWLF,, 6 DQL  
6 DQL  
6 DQL  
6 SHVWHGHDQL  
6 DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
6 DQL  
 VXSHULRDUHOXQJăGXUDWăJUDGGLGDFWLF
6 DQL  
GHILQLWLY
6 DQL  
6 DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
 6 SkQăODDQ  
VXSHULRDUHOXQJăGXUDWăGHEXWDQW
66' SHVWHGHDQL  
66' DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
 66' DQL  
VXSHULRDUHVFXUWăGXUDWăJUDGGLGDFWLF,
66' DQL  
66' DQL  
66' SHVWHGHDQL  
66' DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
66' DQL  
 VXSHULRDUHVFXUWăGXUDWăJUDGGLGDFWLF
66' DQL  
,,
66' DQL  
66' DQL  
16 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

66' SHVWHGHDQL  


66' DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
66' DQL  
 VXSHULRDUHVFXUWăGXUDWăJUDGGLGDFWLF
66' DQL  
GHILQLWLY
66' DQL  
66' DQL  
,QVWLWXWRUPDLVWUXLQVWUXFWRUVWXGLL
 66' SkQăODDQ  
VXSHULRDUHVFXUWăGXUDWăGHEXWDQW
0 SHVWHGHDQL  
ÌQYă‫܊‬ăWRUHGXFDWRDUHPDLVWUX 0 DQL  
 LQVWUXFWRU FXVWXGLLGHQLYHOOLFHDO  0 DQL  
JUDGGLGDFWLF, 0 DQL  
0 DQL  
0 SHVWHGHDQL  
0 DQL  
ÌQYă‫܊‬ăWRUHGXFDWRDUHPDLVWUX
0 DQL  
 LQVWUXFWRU FXVWXGLLGHQLYHOOLFHDO 
0 DQL  
JUDGGLGDFWLF,,
0 DQL  
0 DQL  
0 SHVWHGHDQL  
0 DQL  
ÌQYă‫܊‬ăWRUHGXFDWRDUHPDLVWUX
0 DQL  
 LQVWUXFWRU FXVWXGLLGHQLYHOOLFHDO 
0 DQL  
JUDGGLGDFWLFGHILQLWLY
0 DQL  
0 DQL  
ÌQYă‫܊‬ăWRUHGXFDWRDUHPDLVWUX
 LQVWUXFWRU FXVWXGLLGHQLYHOOLFHDO  0 SkQăODDQ  
GHEXWDQW
0 SHVWHGHDQL  
0 DQL  
3URIHVRUvQYă‫܊‬ăWRUHGXFDWRDUHPDLVWUX 0 DQL  
 LQVWUXFWRU FXVWXGLLGHQLYHOOLFHDOIăUă 0 DQL  
SUHJăWLUHGHVSHFLDOLWDWH  0 DQL  
0 DQL  
0 SkQăODDQ  
*) Funcțiile se ocupă potrivit prevederilor Legii educației naționale nr. 1/2011.

6. Salarii de bază pentru funcțiile didactice auxiliare


6DODULLGH
1U 1LYHOXO ED]ăOHL
)XQF‫܊‬LDJUDGXOVDXWUHDSWDSURIHVLRQDOă &RHILFLHQW
FUW VWXGLLORU *UDGD‫܊‬LD
$QXO
)XQF‫܊‬LLGHH[HFX‫܊‬LH
 $GPLQLVWUDWRUILQDQFLDUELEOLRWHFDU 
6  
JUDG,
JUDG,, 6  
JUDG,,, 6  
GHEXWDQW 6  
 ,QIRUPDWLFLDQDQDOLVWSURJUDPDWRU
6  
JUDG,$
JUDG, 6  
JUDG,, 6  
GHEXWDQW 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 17

 6HFUHWDULQVWLWX‫܊‬LHXQLWDWHGHvQYă‫܊‬ăPkQW
6  
JUDG,
JUDG,, 6  
JUDG,,, 6  
GHEXWDQW 6  
 3HGDJRJ‫܈‬FRODUODERUDQWPHGLDWRU‫܈‬FRODU
6  
JUDG,$
JUDG, 6  
JUDG,, 6  
GHEXWDQW 6  
 ,QVWUXFWRUDQLPDWRUFRUHSHWLWRULQVWUXFWRU
GHHGXFD‫܊‬LHH[WUD‫܈‬FRODUă 6  
JUDG,
JUDG,, 6  
GHEXWDQW 6  
 $GPLQLVWUDWRUSDWULPRQLX
6  
JUDG,
JUDG,, 6  
JUDG,,, 6  
GHEXWDQW 6  
 $GPLQLVWUDWRUILQDQFLDUELEOLRWHFDU 
66'  
JUDG,
JUDG,, 66'  
JUDG,,, 66'  
GHEXWDQW 66'  
 ,QIRUPDWLFLDQDQDOLVWSURJUDPDWRU
66'  
JUDG,
JUDG,, 66'  
JUDG,,, 66'  
GHEXWDQW 66'  
 6HFUHWDULQVWLWX‫܊‬LHXQLWDWHGHvQYă‫܊‬ăPkQW
66'  
 JUDG,
 JUDG,, 66'  
 JUDG,,, 66'  
GHEXWDQW 66'  
 3HGDJRJ‫܈‬FRODUODERUDQWPHGLDWRU‫܈‬FRODU
66'  
JUDG,
JUDG,, 66'  
JUDG,,, 66'  
GHEXWDQW 66'  
 ,QVWUXFWRUDQLPDWRUFRUHSHWLWRULQVWUXFWRU
GHHGXFD‫܊‬LHH[WUD‫܈‬FRODUă 66'  
JUDG,
JUDG,, 66'  
GHEXWDQW 66'  
 $GPLQLVWUDWRUSDWULPRQLX
66'  
JUDG,
JUDG,, 66'  
JUDG,,, 66'  
GHEXWDQW 66'  
18 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 $GPLQLVWUDWRUILQDQFLDUELEOLRWHFDU 


0  
 WUHDSWD,
 WUHDSWD,, 0  
 WUHDSWD,,, 0  
GHEXWDQW 0  
 ,QIRUPDWLFLDQDQDOLVWSURJUDPDWRU
3/0  
WUHDSWD,$
WUHDSWD, 3/0  
WUHDSWD,, 3/0  
GHEXWDQW 3/0  
 6HFUHWDULQVWLWX‫܊‬LHXQLWDWHGHvQYă‫܊‬ăPkQW
0  
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
 3HGDJRJ‫܈‬FRODU
0  
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
 ,QVWUXFWRUDQLPDWRULQVWUXFWRUHGXFD‫܊‬LH
H[WUD‫܈‬FRODUă 0  
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
 &RUHSHWLWRU
0  
WUHDSWD,
WUHDSWD,, 0  
GHEXWDQW 0  
 ‫܇‬HIDWHOLHU‫܈‬FRDOăWHKQLFLDQDGPLQLVWUDWRU
SDWULPRQLX 0  
WUHDSWD,
WUHDSWD,, 0  
WUHDSWD,,, 0  
GHEXWDQW 0  
 /DERUDQW
3/0  
WUHDSWD,
WUHDSWD,, 3/0  
GHEXWDQW 3/0  
 ,QVWUXFWRUPRGHO
0  
WUHDSWD,
WUHDSWD,, 0  
GHEXWDQW 0  
 0HGLDWRU‫܈‬FRODU
0*  
WUHDSWD,
WUHDSWD,, 0*  
GHEXWDQW 0*  
 6XSUDYHJKHWRUQRDSWH
0*  
WUHDSWD,
WUHDSWD,, 0*  
*) Se utilizează doar în bibliotecile din unitățile de învățământ preuniversitar.

N O T Ă:
Salariile de bază prevăzute la pct. 4, 5 și 6 sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină
prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 19

B. Reglementări specifice personalului didactic din c) pentru 4 clase de elevi/grupe, o creștere cu 15% a
învățământ salariului de bază deținut;
Art. 1. — Pentru funcțiile didactice auxiliare la care d) pentru 5 clase de elevi/grupe, o creștere cu 20% a
gradul/treapta profesională nu mai apare în această anexă, salariului de bază deținut.
salariul de bază se va stabili la gradația corespunzătoare Art. 8. — Personalul didactic care îndeplinește funcția de
vechimii în muncă de la gradul/treapta profesională imediat diriginte, învățătorii, educatoarele, institutorii, profesorii pentru
superior/superioară funcției pe care era încadrată persoana. învățământul primar, profesorii pentru învățământul preșcolar
Art. 2. — Ministerul Educației Naționale, cu consultarea beneficiază de o majorare de 10% a salariului de bază.
instituțiilor, unităților de învățământ și a partenerilor sociali, va Art. 9. — (1) Pentru personalul din instituțiile de învățământ
stabili gradul funcțiilor de conducere din învățământul superior, consiliile de administrație pot stabili salarii diferențiate,
preuniversitar și alte instituții/unități din subordinea acestuia, prin cu o creștere de până la 30% a salariului de bază deținut, în
ordin al ministrului, emis în termen de 60 de zile de la data intrării funcție de specificul activității desfășurate și de calitatea
în vigoare a prezentei legi, în funcție de următoarele criterii: acesteia. Sumele pentru aceste salarii se vor plăti exclusiv din
număr de personal, elevi și categorii de unități. venituri proprii.
Art. 3. — Personalul didactic calificat de predare și (2) De prevederile alin. (1) beneficiază și personalul din
conducere care își desfășoară activitatea în localități izolate învățământul preuniversitar care participă direct la realizarea
primește o indemnizație de până la 20% din salariul de bază, în activităților finanțate din venituri proprii.
raport cu zona geografică respectivă. Diferențierea pe zone și Art. 10. — Personalul didactic de predare din învățământul
localități se aprobă prin hotărâre a Guvernului, care nu se ia în superior poate primi un spor pentru conducătorii de doctorat de
calcul la stabilirea limitei prevăzute la art. 25. până la 1% pentru fiecare student-doctorand, dar nu mai mult de
Art. 4. — Personalul didactic din învățământul special 10% din salariul de bază.
beneficiază de o majorare cu 15% a salariului de bază. Art. 11. — Personalul didactic beneficiază de dreptul la
Art. 5. — (1) Personalul didactic din învățământ, inclusiv concediul de odihnă, potrivit Legii nr. 1/2011, cu modificările și
personalul didactic auxiliar din bibliotecile centrale universitare, completările ulterioare, primind o indemnizație de concediu de
beneficiază de gradație de merit, acordată prin concurs. Această odihnă calculată conform prevederilor legale aplicabile
gradație se acordă pentru 16% din posturile didactice existente personalului plătit din fonduri publice.
la nivelul inspectoratului școlar, bibliotecilor centrale universitare, Art. 12. — Personalul didactic de predare, inclusiv cadrele
respectiv al instituției de nivel superior și reprezintă o creștere cu didactice metodiste din unitățile de învățământ preuniversitar,
poate fi salarizat și prin plata cu ora sau prin cumul, potrivit
25% a salariului de bază deținut. Gradația de merit se atribuie
prevederilor Legii nr. 1/2011, cu modificările și completările
pe o perioadă de 5 ani.
ulterioare. Calculul pentru plata cu ora sau prin cumul se face la
(2) Metodologia și criteriile de acordare a gradației de merit
norma didactică prevăzută de Legea nr. 1/2011, cu modificările
se elaborează de către Ministerul Educației Naționale pentru
și completările ulterioare.
personalul didactic din învățământul preuniversitar, pentru
Art. 13. — (1) În raport cu condițiile de muncă în care se
personalul didactic auxiliar din bibliotecile centrale universitare
desfășoară activitatea, condiții periculoase sau vătămătoare,
și de senatele universitare pentru instituțiile de învățământ
personalul salarizat poate primi un spor de până la 15% din
superior.
salariul de bază, corespunzător timpului lucrat la locurile de
(3) Pentru personalul didactic de predare din învățământul muncă respective, cu respectarea prevederilor legale în vigoare.
universitar, care nu beneficiază de gradația de merit prevăzută (2) Locurile de muncă, categoriile de personal, mărimea
la alin. (1), se acordă, prin concurs, un spor de performanță concretă a sporului, precum și condițiile de acordare a acestora
academică. Acest spor se acordă pentru un număr de până la se stabilesc de către ordonatorul de credite, cu consultarea
15% din posturile didactice de predare existente la nivelul partenerilor sociali, în limita prevederilor din Regulamentul
instituției de învățământ superior și reprezintă 10% din salariul prevăzut la art. 23 din prezenta lege, elaborat potrivit prezentei
de bază deținut. Sporul de performanță academică se atribuie legi, având la bază buletinele de determinare sau, după caz,
pe o perioadă de un an. Numărul de beneficiari, metodologia și expertizare, emise de către autoritățile abilitate în acest sens.
criteriile de acordare a sporului de performanță academică se (3) Personalul didactic care desfășoară activitate de
elaborează de către senatele universitare și se va plăti exclusiv predare — învățare — evaluare în sistemul penitenciar primește
din venituri proprii. un spor de până la 15% din salariul de bază.
Art. 6. — Personalul didactic desemnat să conducă și să Art. 14. — Pentru funcțiile didactice auxiliare, care nu se
realizeze practică pedagogică pentru pregătirea viitoarelor regăsesc în prezenta anexă, se vor utiliza salariile de bază din
educatoare și a viitorilor învățători, institutori și profesori anexele la prezenta lege, corespunzător fiecărui domeniu de
beneficiază de un spor de 10—25% din salariul de bază, în activitate din sistemul bugetar. Ministerul Educației Naționale, în
raport cu timpul efectiv lucrat și calculat în raport cu numărul colaborare cu Ministerul Muncii și Justiției Sociale, va emite, în
elevilor sau al studenților practicanți, potrivit regulamentului de termen de 30 de zile de la publicarea prezentei legi, un nou ordin
practică pedagogică aprobat de Ministerul Educației Naționale, privind reglementarea funcțiilor cu statut de personal didactic
dacă nu beneficiază de reducerea normei didactice cu 2 ore pe auxiliar, aplicându-li-se în mod corespunzător celelalte prevederi
săptămână. aplicabile personalului didactic.
Art. 7. — Personalul didactic care asigură predarea Art. 15. — Salarizarea cadrelor didactice încadrate ca
simultană la 2—5 clase de elevi/grupe în învățământul preșcolar, profesor pentru învățământul preșcolar, respectiv profesor
primar sau gimnazial, primește o majorare a salariului de bază, pentru învățământul primar se face la nivelul încadrării pentru
după cum urmează: un profesor cu studii superioare din învățământul preuniversitar.
a) pentru 2 clase de elevi/grupe, o creștere cu 7% a salariului Art. 16. — Pentru personalul didactic de predare din
de bază deținut; învățământ se acordă un spor de suprasolicitare neuropsihică,
b) pentru 3 clase de elevi/grupe, o creștere cu 10% a de 10% din salariul de bază, începând cu data de 1 decembrie
salariului de bază deținut; 2018.
20 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II
Unități de cercetare științifică, dezvoltare tehnologică și proiectare
a) Salarii de bază funcții de conducere

6DODULXOGHED]ă
OHL &RHILFLHQW
1U 1LYHOXO
)XQF‫܊‬LD $QXO
FUW VWXGLLORU
*UDG
*UDG, *UDG,, *UDG,
,,
'LUHFWRUJHQHUDOLQVWLWXWGHFHUFHWDUH 
 6    
2UGRQDWRUVHFXQGDUGHFUHGLWH 
'LUHFWRUJHQHUDODGMXQFWLQVWLWXWGHFHUFHWDUH 
 6    
2UGRQDWRUVHFXQGDUGHFUHGLWH 
'LUHFWRULQVWLWXWGHFHUFHWDUH
 6    
2UGRQDWRUWHU‫܊‬LDUGHFUHGLWH 
'LUHFWRUDGMXQFWLQVWLWXWGHFHUFHWDUH
 6    
2UGRQDWRUWHU‫܊‬LDUGHFUHGLWH 
'LUHFWRUFHQWUXGHFHUFHWDUHGLUHFWRUVWD‫܊‬LXQHGH
 6    
FHUFHWDUH 2UGRQDWRUWHU‫܊‬LDUGHFUHGLWH 
6HFUHWDU‫܈‬WLLQ‫܊‬LILFLQVWLWXWGHFHUFHWDUHVHFUHWDU
 ‫܈‬WLLQ‫܊‬LILFVHF‫܊‬LH$6$6 2UGRQDWRUWHU‫܊‬LDUGH 6    
FUHGLWH 
'LUHFWRUDGMXQFWFHQWUXGHFHUFHWDUHGLUHFWRU
 DGMXQFWVWD‫܊‬LXQHGHFHUFHWDUH 2UGRQDWRUWHU‫܊‬LDU 6    
GHFUHGLWH 
6HFUHWDU‫܈‬WLLQ‫܊‬LILFFHQWUXGHFHUFHWDUHVHFUHWDU
 ‫܈‬WLLQ‫܊‬LILFVWD‫܊‬LXQHGHFHUFHWDUH 2UGRQDWRUWHU‫܊‬LDU 6    
GHFUHGLWH 
 ‫܇‬HIODERUDWRUFHUFHWDUH 6    
*) Nivelul de salarizare este stabilit de către ordonatorul principal de credite.

N O T Ă:
1. Pentru conducătorii de doctorat salariul de bază este egal cu cel pentru director adjunct institut de cercetare sau director
centru de cercetare.
2. Pentru funcțiile de conducere din cadrul Academiei Române salariile de bază se majorează cu 15%.
3. Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Salarii de bază funcții de execuție



6DODULLOHGHED]ăOHL
1U 1LYHOXO *UDGD‫܊‬LD
)XQF‫܊‬LD &RHILFLHQW
FUW VWXGLLORU
$QXO
 &HUFHWăWRU‫܈‬WLLQ‫܊‬LILF, 6  
 &HUFHWăWRU‫܈‬WLLQ‫܊‬LILF,, 6  
 &HUFHWăWRU‫܈‬WLLQ‫܊‬LILF,,, 6  
 &HUFHWăWRU‫܈‬WLLQ‫܊‬LILF 6  
 $VLVWHQWGHFHUFHWDUH‫܈‬WLLQ‫܊‬LILFă 6  
$VLVWHQWGHFHUFHWDUH‫܈‬WLLQ‫܊‬LILFă
 
VWDJLDU 6 
 $VLVWHQW, 0  
 $VLVWHQW,, 0  
 $VLVWHQWVWDJLDU 0  
N O T Ă:
1. Pentru conducătorii de doctorat, salariul de bază este egal cu cel pentru director adjunct institut de cercetare sau director
centru de cercetare.
2. Pentru funcțiile de execuție de cercetare științifică fundamentală din cadrul Academiei Române, salariile de bază se
majorează cu 15%.
3. Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 21

CAPITOLUL III
Culte
A. Salarii de bază pentru personalul clerical încadrat în unitățile bugetare
Funcții de execuție

6DODULLOHGHED]ă
1U 1LYHOXO
)XQF‫܊‬LD OHL
FUW VWXGLLORU &RHILFLHQW
*UDGD‫܊‬LD
 3UHRW  $QXO
JUDGXO, 6  
JUDGXO,, 6  
GHILQLWLY 6  
GHEXWDQW 6  
 3UHRW
JUDGXO, 0  
GHILQLWLY 0  
GHEXWDQW 0  
N O T Ă:
1. Condițiile de ocupare a gradelor profesionale se stabilesc prin hotărâre a Guvernului. Secretariatul de Stat pentru Culte
este autorizat să certifice asimilarea funcțiilor de la alte culte cu cea de preot.
2. Salariile de bază sunt prevăzute pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin majorarea
salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

B. Indemnizațiile personalului din conducerea cultelor recunoscute și a unităților centrale de cult, asimilat celui
încadrat pe funcții de demnitate publică

1XPăUXO
1U
)XQF‫܊‬LD PD[LPGH )XQF‫܊‬LDFXFDUHVHDVLPLOHD]ă
FUW
SRVWXUL
3DWULDUKXO%LVHULFLL2UWRGR[H 3UH‫܈‬HGLQWHOH6HQDWXOXL‫܈‬L3UH‫܈‬HGLQWHOH
 
5RPkQH &DPHUHL'HSXWD‫܊‬LORU
$UKLHSLVFRSPDMRUPLWURSROLW
6HFUHWDULL‫܈‬L&KHVWRULL6HQDWXOXL‫܈‬LDL
 %LVHULFD2UWRGR[ă5RPkQă‫܈‬L 
&DPHUHL'HSXWD‫܊‬LORU
%LVHULFD5RPDQR&DWROLFă
$UKLHSLVFRS‫܈‬HIGHFXOW PLWURSROLW
 HSLVFRSPXIWLX‫܈‬HIUDELQSUH‫܈‬HGLQWH  0LQLVWUX
XQLXQHSUH‫܈‬HGLQWH 
9LFHSUH‫܈‬HGLQ‫܊‬LLFRPLVLLORU
 (SLVFRSHSLVFRSYLFDUSDWULDUKDO  SHUPDQHQWHDOH6HQDWXOXL‫܈‬L&DPHUHL
'HSXWD‫܊‬LORU
(SLVFRSYLFDUHSLVFRSFRDMXWRU
  6HQDWRULGHSXWD‫܊‬L
HSLVFRSDX[LOLDUDUKLHUHXYLFDU
C. Personalul din conducerea cultelor și a unităților de cult, altul decât cel asimilat funcțiilor de demnitate publică
1XPăUXOGH
1U SRVWXUL
)XQF‫܊‬LDFOHULFDOăVDXDVLPLODWă )XQF‫܊‬LDGLGDFWLFăFXFDUHVHDVLPLOHD]ă
FUW

 9LFHSUH‫܈‬HGLQWHXQLXQHYLFDU  3URIHVRU FX VWXGLL VXSHULRDUH FX JUDG


DGPLQLVWUDWLYSDWULDUKDOYLFDUJHQHUDO GLGDFWLF , ‫܈‬L YHFKLPH vQ vQYă‫܊‬ăPkQW
VHFUHWDUJHQHUDOFRQVLOLHUSDWULDUKDO SHVWHDQL
SULPUDELQ
 6HFUHWDUSDWULDUKDOLQVSHFWRUJHQHUDO  3URIHVRU FX VWXGLL VXSHULRDUH FX JUDG
ELVHULFHVFYLFDUDGPLQLVWUDWLYHSDUKLDO GLGDFWLF , ‫܈‬L YHFKLPH vQ vQYă‫܊‬ăPkQW
YLFDUHSLVFRSDO vQWUH‫܈‬LDQL
 6HFUHWDU&DQFHODULDSDWULDUKDOă  3URIHVRU FX VWXGLL VXSHULRDUH FX JUDG
FRQVLOLHUHSDUKLDOVHFUHWDUHSDUKLDO GLGDFWLF ,, ‫܈‬L YHFKLPH vQ vQYă‫܊‬ăPkQW
LQVSHFWRUHSDUKLDOH[DUKSURWRSRS vQWUH‫܈‬LDQL
 6WDUH‫܊‬VXSHULRDUăHJXPHQ  3URIHVRU FX VWXGLL VXSHULRDUH FX JUDG
GLGDFWLF ,, ‫܈‬L YHFKLPH vQ vQYă‫܊‬ăPkQW
vQWUH‫܈‬LDQL
22 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

D. Personal clerical angajat în unitățile cultelor recunoscute din România

1XPăUXOGH
SRVWXULSHQWUX
1U
)XQF‫܊‬LDFOHULFDOă FDUHVHDVLJXUă )XQF‫܊‬LDGLGDFWLFăFXFDUHVHDVLPLOHD]ă
FUW
VSULMLQOXQDUOD
VDODUL]DUH
 3UHRWGLDFRQSDVWRUYHVWLWRU 
LPDPUDELQFDQWRU RILFLDQWGH 
FXOW
 &XVWXGLLVXSHULRDUH  3URIHVRUFXVWXGLLVXSHULRDUH
 JUDGXO,  JUDGXOGLGDFWLF,
 JUDGXO,,  JUDGXOGLGDFWLF,,
 GHILQLWLY  GHILQLWLY
 GHEXWDQW  GHEXWDQW
 &XVWXGLLPHGLL  ÌQYă‫܊‬ăWRUHGXFDWRUPDLVWUXLQVWUXFWRU
FXVWXGLLPHGLL
 JUDGXO,  JUDGXOGLGDFWLF,
 JUDGXO,,  JUDGXOGLGDFWLF,,
 GHILQLWLY  GHILQLWLY
 GHEXWDQW  GHEXWDQW
*) Se utilizează la cultul mozaic.

E. Reglementări specifice personalului clerical care își activitatea clericală deținută în cadrul cultelor din România,
desfășoară activitatea în țară, în cadrul cultelor religioase conform asimilărilor.
din România, recunoscute potrivit legii (2) Prin excepție de la prevederile alin. (1) lit. c), personalul
Art. 1. — (1) Statul român sprijină cultele, recunoscute potrivit clerical care își desfășoară activitatea în unitățile de cult cu
Legii nr. 489/2006 privind libertatea religioasă și regimul general venituri reduse poate beneficia de un sprijin lunar la salarizare
al cultelor, republicată, la cererea acestora, pentru salarizarea în cuantum de 80% din salariile de bază stabilite potrivit legii
personalului clerical. pentru cadrele didactice din învățământul preuniversitar de stat,
(2) Personalul clerical care beneficiază de prevederile potrivit nivelului de studii, gradului profesional obținut și vechimii
prezentei legi își păstrează statutul de angajat al cultului religios în activitatea clericală deținută în cadrul cultelor din România,
recunoscut. conform asimilărilor.
(3) Criteriile în baza cărora unitățile de cult sunt considerate
SECȚIUNEA 1
ca fiind cu venituri reduse, potrivit alin. (2), se stabilesc prin ordin
Sprijinul statului pentru salarizarea personalului clerical al secretarului de stat pentru culte.
Art. 2. — (1) Sprijinul statului pentru salarizarea personalului (4) Personalul clerical poate beneficia de prevederile alin. (2)
clerical care își desfășoară activitatea în țară, în cadrul cultelor în procent de 30% din totalul posturilor clericale pentru care se
din România, recunoscute potrivit legii, se stabilește după cum alocă sprijin la salarizare de la bugetul de stat.
urmează: (5) Numărul de posturi stabilite potrivit alin. (4) va fi repartizat
a) personalul din conducerea cultelor asimilat celui încadrat pe culte, în raport cu numărul credincioșilor, conform ultimului
pe funcții de demnitate publică beneficiază de o indemnizație recensământ, și cu nevoile reale.
lunară, conform asimilărilor. Indemnizația lunară este unica (6) Unitățile centrale de cult, în baza numărului de posturi
formă de remunerare pentru personalul respectiv și reprezintă comunicat anual, transmit Secretariatului de Stat pentru Culte
baza de calcul pentru stabilirea drepturilor și obligațiilor care se propuneri motivate cuprinzând nominalizarea unităților de cult
determină în raport cu venitul salarial; pentru al căror personal clerical se dorește acordarea sprijinului
b) personalul din conducerea cultelor, altul decât cel prevăzut lunar prevăzut la alin. (2) și care întrunesc condițiile și criteriile
la lit. a), beneficiază de sprijin lunar la salarizare, potrivit funcțiilor prevăzute la alin. (2) și (3).
pe care le ocupă, la nivelul salariilor de bază stabilite potrivit legii (7) Listele unităților de cult al căror personal clerical
pentru cadrele didactice din învățământul preuniversitar de stat, beneficiază de sprijin lunar în condițiile alin. (2), precum și
conform asimilărilor; modificarea acestora se stabilesc la propunerea unităților
c) personalul clerical care își desfășoară activitatea în centrale de cult și se aprobă anual prin ordin al secretarului de
unitățile de cult beneficiază de sprijin lunar la salarizare în stat pentru culte.
cuantum de 65% din salariile de bază stabilite potrivit legii pentru (8) Nu beneficiază de prevederile alin. (2) personalul clerical
cadrele didactice din învățământul preuniversitar de stat, potrivit de la unitățile de cult care obțin venituri din închirierea,
nivelului de studii, gradului profesional obținut și vechimii în arendarea și concesionarea proprietăților.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 23

SECȚIUNEA a 2-a (2) Unitățile și contribuțiile prevăzute la alin. (1) vor fi


Alte drepturi ale personalului clerical nominalizate de conducerea centrelor de cult, potrivit criteriilor
stabilite de acestea.
Art. 3. — Condițiile de ocupare a gradelor profesionale ale Art. 9. — (1) Sprijinul financiar pentru personalul neclerical
personalului clerical prevăzut la art. 2 alin. (1) lit. c) se aprobă de angajat în unitățile ce aparțin cultelor religioase din România se
Secretariatul de Stat pentru Culte, la propunerea cultelor asigură, la cerere, în limita prevederilor bugetare anuale, după
recunoscute. cum urmează:
Art. 4. — De la bugetul de stat se asigură, prin bugetul a) de la bugetele locale:
Secretariatului General al Guvernului, prin Secretariatul de Stat (i) 19.899 de contribuții pentru personalul neclerical
pentru Culte, numai drepturile stabilite în condițiile prevăzute la angajat în unitățile de cult din țară prevăzute la art. 8
art. 2, inclusiv toate contribuțiile stabilite prin lege. din prezenta anexă. Cuantumul contribuției lunare se
Art. 5. — (1) Pentru sprijinirea așezămintelor religioase stabilește prin legile bugetare anuale sau prin legile
românești din afara granițelor, care desfășoară activități de rectificare a bugetului de stat și nu poate fi
deosebite în vederea menținerii identității lingvistice, culturale și mai mic decât cuantumul stabilit, potrivit legii, pentru
religioase a românilor din afara granițelor, se alocă de la bugetul anul 2017;
de stat, prin unitatea centrală de cult din România, o sumă (ii) sumele aferente, necesare pentru plata tuturor
stabilită prin legile bugetare anuale sau prin legile de rectificare contribuțiilor prevăzute de lege;
a bugetului de stat, care nu poate fi mai mică decât suma b) de la bugetul de stat:
stabilită, potrivit legii, pentru anul 2017. (i) 300 de contribuții pentru personalul neclerical
(2) Suma prevăzută la alin. (1) se alocă unităților centrale ale angajat în unitățile și instituțiile de învățământ
cultelor recunoscute de către Secretariatul de Stat pentru Culte, teologic, respectiv în unitățile de formare a
prin bugetul Secretariatului General al Guvernului. personalului clerical, prevăzute la art. 8 din prezenta
(3) Destinațiile sumei prevăzute la alin. (1) se stabilesc de anexă. Cuantumul contribuției lunare se stabilește
unitățile centrale ale cultelor recunoscute, împreună cu prin legile bugetare anuale sau prin legile de
conducerile unităților de cult din afara granițelor, suma urmând rectificare a bugetului de stat și nu poate fi mai mic
a fi utilizată pentru completarea salariilor personalului clerical al decât cuantumul stabilit, potrivit legii, pentru anul
respectivelor unități, inclusiv pentru plata tuturor contribuțiilor 2017;
prevăzute de lege. Obligația de a justifica modul de utilizare a (ii) 42 de contribuții pentru personalul neclerical trimis
acestei sume revine unității centrale de cult din România, prin să deservească așezămintele din străinătate ale
prezentarea la Secretariatul de Stat pentru Culte a documentelor Bisericii Ortodoxe Române. Contribuția lunară
prevăzute de normele legale în vigoare. reprezintă echivalentul în lei a 50% din drepturile în
(4) Suma prevăzută la alin. (1) poate fi modificată anual, prin valută stabilite în cuantum net, prin asimilare cu
legea bugetului de stat sau prin legile de rectificare a bugetului funcțiile pe care este încadrat personalul român
de stat. trimis să își desfășoare activitatea în cadrul misiunilor
Art. 6. — Drepturile stabilite potrivit dispozițiilor legale în diplomatice, al oficiilor consulare și al altor forme de
vigoare se acordă în continuare personalului angajat în cadrul reprezentare a României în străinătate;
cultelor religioase din România, potrivit legii, pentru care nu sunt (iii) sumele aferente, necesare pentru plata tuturor
aplicabile prevederile prezentei legi. contribuțiilor stabilite de lege.
Art. 7. — (1) Modul de utilizare a fondurilor alocate de la (2) Numărul contribuțiilor prevăzute la alin. (1) poate fi
bugetul de stat, potrivit prezentei legi, este supus controlului modificat prin legile bugetare anuale sau prin legile de rectificare
Secretariatului General al Guvernului, prin Secretariatul de Stat a bugetului de stat.
pentru Culte, și altor organe abilitate de lege. (3) La stabilirea sumelor defalcate din unele venituri ale
(2) Numărul de posturi pentru personalul clerical se poate bugetului de stat în vederea echilibrării bugetelor locale se va
majora anual prin legea bugetului de stat. avea în vedere și alocarea fondurilor pentru aplicarea
(3) Prin excepție de la prevederile alin. (2), Secretariatul de prevederilor alin. (1) lit. a).
Stat pentru Culte poate modifica numărul de posturi prevăzut la (4) Aprobarea suplimentării numărului de posturi pentru
lit. D, prin transformarea unor posturi cu studii medii în studii personalul neclerical angajat în unitățile ce aparțin cultelor
superioare, în funcție de necesități, respectiv diminuarea religioase recunoscute din România, al cărui sprijin financiar se
posturilor de la nr. crt. 2 și majorarea cu același număr la asigură potrivit prevederilor alin. (1) lit. a), se face de către
nr. crt. 1, cu încadrarea în numărul total de posturi aprobate. autoritățile administrației publice locale, ținându-se seama de
SECȚIUNEA a 3-a numărul de adepți ai fiecărui cult religios, și se comunică
Secretariatului de Stat pentru Culte.
Sprijinul statului pentru salarizarea personalului neclerical
(5) Aprobarea suplimentării numărului de posturi pentru
al cultelor recunoscute
personalul neclerical angajat în unitățile ce aparțin cultelor
Art. 8. — (1) Unitățile aparținând cultelor religioase religioase recunoscute din România, al cărui sprijin financiar se
recunoscute din România, precum și unitățile și instituțiile de asigură potrivit prevederilor alin. (1) lit. b), se face de către
învățământ teologic autorizate și acreditate potrivit legii, aflate în Secretariatul de Stat pentru Culte.
subordinea acestora și neintegrate în învățământul de stat, (6) Autoritățile administrației publice locale pot aproba
respectiv unitățile de formare a personalului clerical primesc de suplimentarea numărului de posturi pentru personalul neclerical
la bugetul de stat și de la bugetele locale un sprijin sub formă de angajat în unitățile ce aparțin cultelor religioase recunoscute din
contribuții, care va asigura completarea drepturilor salariale România, ținând seama de numărul de adepți ai fiecărui cult
neacoperite din fondurile proprii ale unităților de cult centrale și religios, sprijinul financiar urmând a se asigura din veniturile
locale respective. proprii ale bugetelor locale.
ANEXA Nr. II

FA M I L I A O C U PA Ț I O N A L Ă D E F U N C Ț I I B U G E TA R E „ S Ă N Ă TAT E Ș I A S I S T E N Ț Ă S O C I A L Ă ” 24
CAPITOLUL I
Unități sanitare, de asistență socială și de asistență medico-socială

1. Salarii de bază pentru funcții de conducere

1.1. Spitale peste 400 de paturi, spitale sub 400 de paturi și servicii de ambulanță

6SLWDOHSHVWHGHSDWXUL 6SLWDOHVXEGHSDWXUL 6HUYLFLLGHDPEXODQ‫܊‬ă


1U 1LYHOXO 6DODULLOHGH 6DODULLOHGH 6DODULLOHGH
)XQF‫܊‬LD
FUW VWXGLLORU ED]ăOHL ED]ăOHL ED]ăOHL
&RHILFLHQW &RHILFLHQW &RHILFLHQW
$QXO $QXO $QXO
*UDG *UDG *UDG *UDG *UDG *UDG
  
*UDG, ,, *UDG, ,, *UDG, ,, *UDG, ,, *UDG, ,, *UDG, ,,
 0DQDJHU 6        
 0DQDJHUJHQHUDO 6    
 'LUHFWRUGHFHUFHWDUH 6        
'LUHFWRUILQDQFLDU
 6        
FRQWDELODGPLQLVWUDWLY    
 'LUHFWRUHFRQRPLF 6    
 'LUHFWRUWHKQLF 6    
 'LUHFWRUGHvQJULMLUL 666'        
 $O‫܊‬LGLUHFWRUL 6        
666'3
 $VLVWHQW‫܈‬HI    
/        
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
1.2. Institutul Național de Hematologie Transfuzională „Prof. Dr. C.T. Nicolau”, Centrul de Transfuzie Sanguină al municipiului București, centre de
transfuzie sanguină regionale și centre de transfuzie sanguină județene


,QVWLWXWXO1D‫܊‬LRQDOGH
&HQWUXOGH7UDQVIX]LH6DQJXLQăDO &HQWUHGHWUDQVIX]LHVDQJXLQă &HQWUHGHWUDQVIX]LHVDQJXLQă
+HPDWRORJLH7UDQIX]LRQDOă
PXQLFLSLXOXL%XFXUH‫܈‬WL UHJLRQDOH MXGH‫܊‬HQH
3URI'U&71LFRODX
1U 1LYHOXO 6DODULLOHGHED]ă 6DODULLOHGHED]ă 6DODULLOHGH 6DODULLOHGH
)XQF‫܊‬LD
FUW VWXGLLORU OHL OHL ED]ăOHL ED]ăOHL
&RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW
$QXO $QXO $QXO $QXO
*UDG *UDG *UDG *UDG *UDG *UDG *UDG *UDG *UDG *UDG *UDG
*UDG, *UDG, *UDG, *UDG, *UDG,
,, , ,, ,, , ,, , ,, ,, ,, ,,
'LUHFWRU
    
JHQHUDO             
'LUHFWRU
GLUHFWRU
 6                
JHQHUDO
DGMXQFW
'LUHFWRU
 DGMXQFW 6    
           
‫܈‬WLLQ‫܊‬LILF
'LUHFWRU
DGMXQFW
 6    
ILQDQFLDU            
FRQWDELOLWDWH
'LUHFWRU
 UHVXUVH 6    
           
XPDQH
 &RQWDELO‫܈‬HI 6            
   
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
25

NOTĂ:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
26 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

1.3. Alte funcții de conducere



6DODULLOHGH
ED]ăOHL &RHILFLHQW
1U 1LYHOXO
$OWHIXQF‫܊‬LLGHFRQGXFHUH $QXO
FUW VWXGLLORU
*UDG *UDG
*UDG, ,, *UDG, ,,
 'LUHFWRUJHQHUDO  6    
'LUHFWRUJHQHUDODGMXQFWGLUHFWRU
 6    
GLUHFWRUH[HFXWLY 
 'LUHFWRUDGMXQFW  6    
'LUHFWRUDGMXQFWILQDQFLDUFRQWDELO
 6    

 &RQWDELO‫܈‬HI  6    

 ‫܇‬HIVHUYLFLXPHGLFDO 6    


‫܇‬HIELURX‫܈‬HIDWHOLHU‫܈‬HIODERUDWRU
 6    
‫܈‬HIRILFLX
666'
 $VLVWHQWPHGLFDO‫܈‬HISHXQLWDWH    
3/
 ‫܇‬HIIRUPD‫܊‬LHPXQFLWRUL    
*) Se utilizează în unitățile sanitare fără paturi.

N O T Ă:
1. Medicii în specialitatea anatomie patologică și medicină legală care ocupă funcția de medic șef serviciu medicină
legală/anatomie patologică beneficiază de majorarea cu 5% a salariului de bază avut.
2. Personalul de specialitate medico-sanitar care ocupă funcția de șef laborator și altele similare în cadrul institutelor de
medicină legală beneficiază de majorarea cu 5% a salariului de bază avut.
3. Personalul de specialitate medico-sanitar care ocupă funcții în conducerea institutelor de medicină legală beneficiază
de majorarea cu 10% a salariului de bază avut.
4. Medicii în specialitatea anatomie patologică și medicină legală care ocupă funcții de conducere în comitetul director al
unităților sanitare cu paturi beneficiază de majorarea cu 10% a salariului de bază avut.
5. Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

1.4. Persoanele care exercită funcțiile nominalizate în următorul tabel, pe perioada cât exercită aceste funcții,
beneficiază de majorarea salariului de bază avut, după cum urmează:

1U 0DMRUDUHVDODULX
)XQF‫܊‬LD
FUW GHED]ă
 'LUHFWRUSURJUDPGHUH]LGHQ‫܊‬LDWPHGLFLQăGHXUJHQ‫܊‬ă 

 'LUHFWRUPHGLFDO 
 0HGLF‫܈‬HIDPEXODWRULXGHVSHFLDOLWDWH‫܈‬LDOWHOHVLPLODUH 

0HGLF IDUPDFLVWELRORJELRFKLPLVWFKLPLVWSVLKRORJ 
 
‫܈‬HIVHF‫܊‬LH‫܈‬HIODERUDWRU‫܈‬LDOWHOHVLPLODUH
5HVSRQVDELOGHIRUPDUHvQUH]LGHQ‫܊‬LDWPHGLFLQăGH
 
XUJHQ‫܊‬ă
)DUPDFLVW‫܈‬HIVHUYLFLX‫܈‬HIVHF‫܊‬LHIDUPDFLVW‫܈‬HISXQFWGH
 
OXFUX RILFLQă 
$VLVWHQWPHGLFDO WHKQLFLDQVDQLWDUVRUăPHGLFDOă
 RILFLDQWPHGLFDOPRD‫܈‬ăODERUDQW‫܈‬LDOWHOHVLPLODUH ‫܈‬HI 
DVLVWHQWFRRUGRQDWRU
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 27

&KLPLVWELRORJIDUPDFLVWELRFKLPLVWDVLVWHQWPHGLFDO
 
FXJHVWLXQH
 6SăOăWRUHDVăFXJHVWLXQH 
 ‫܇‬HIHFKLSă 
3HUVRQDOFDUHGHVIă‫܈‬RDUăFRQWUROvQVăQăWDWHSXEOLFă
 
GLUHF‫܊‬LDGHVăQăWDWHSXEOLFă
0HGLFFRRUGRQDWRUVXEVWD‫܊‬LHVHFWRUPXQLFLSLXO%XFXUH‫܈‬WL
 
VXEVWD‫܊‬LHVHUYLFLXOGHDPEXODQ‫܊‬ă

$VLVWHQWPHGLFDOFRRUGRQDWRUVXEVWD‫܊‬LHVHFWRU
 
PXQLFLSLXO%XFXUH‫܈‬WLVXEVWD‫܊‬LHVHUYLFLXOGHDPEXODQ‫܊‬ă
$PEXODQ‫܊‬LHUFXDWULEX‫܊‬LLGHDYL]DUHWHKQLFăVXEVWD‫܊‬LH
 VHFWRUPXQLFLSLXO%XFXUH‫܈‬WLVXEVWD‫܊‬LHVHUYLFLXOGH 
DPEXODQ‫܊‬ă
$VLVWHQWPHGLFDOUHVSRQVDELOSHWXUăFXVWRFXOGH
 
PHGLFDPHQWH

1.5. Membrii comisiilor de avizare medico-legală, ai comisiilor de expertiză și recuperare a capacității de muncă
și ai comisiilor medicale, pentru activități prestate în afara obligațiilor funcției de bază, beneficiază, în cursul unei luni,
de indemnizații de cel mult 10% din salariul de bază al funcției de execuție îndeplinite, care nu fac parte din salariul de
bază.

2. Salarii de bază pentru personalul de specialitate medico-sanitar și auxiliar sanitar din unități sanitare și unități
de asistență medico-socială
Unitățile clinice cuprind: spitale clinice județene de urgență, spitale județene de urgență, spitale regionale, spitale clinice
de specialitate de urgență, spitale clinice, spitale de urgență, spitale de specialitate, Spitalul Universitar de Urgență „Elias”*),
Institutul Național de Sănătate Publică, institute și centre medicale, institute de medicină legală, centre de transfuzie sanguină
județene și al municipiului București, Centrul Medical de Diagnostic, Tratament Ambulatoriu și Medicină Preventivă din subordinea
Academiei Române*), Institutul Național de Expertiză Medicală și Recuperare a Capacității de Muncă.
a) Salarii de bază pentru personalul de specialitate medico-sanitar
a.1. Unități clinice

8QLWă‫܊‬LFOLQLFH
1U 1LYHOXO 6DODULXOGHED]ăOHL
)XQF‫܊‬LD *UDGD‫܊‬LD
FUW VWXGLLORU &RHILFLHQW
$QXO
 0HGLFSULPDU 6  
 0HGLFSULPDUGHQWLVW 6  
 0HGLFVSHFLDOLVW 6  
 0HGLFVSHFLDOLVWGHQWLVW 6  
 0HGLFUH]LGHQWDQXO9,9,, 6  
 0HGLFUH]LGHQWDQXO,99 6  
 0HGLFGHQWLVWUH]LGHQWDQXO,99 6  
 0HGLFUH]LGHQWDQXO,,, 6  
 0HGLFGHQWLVWUH]LGHQWDQXO,,, 6  
 0HGLFUH]LGHQWDQXO,, 6  
 0HGLFGHQWLVWUH]LGHQWDQXO,, 6  
 0HGLFUH]LGHQWDQXO, 6  
 0HGLFGHQWLVWUH]LGHQWDQXO, 6  
 0HGLF 6  
 0HGLFGHQWLVW 6  
28 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 )DUPDFLVWSULPDU   6  
 )DUPDFLVWVSHFLDOLVW 6  
 )DUPDFLVW 6  
 )DUPDFLVWUH]LGHQWDQXO,,, 6  
 )DUPDFLVWUH]LGHQWDQXO,, 6  
 )DUPDFLVWUH]LGHQWDQXO, 6  
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6
 
SULQFLSDO
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6
 
VSHFLDOLVW
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6  
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6 

GHEXWDQW 
 $VLVWHQW PHGLFDO WHKQLFLDQ GH UDGLRORJLH 6  
‫܈‬LLPDJLVWLFăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDOGH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQGHQWDUOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ăSULQFLSDO
 $VLVWHQW PHGLFDO WHKQLFLDQ GH UDGLRORJLH 6  
‫܈‬LLPDJLVWLFăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDOGH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQGHQWDUOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ă
 $VLVWHQW PHGLFDO WHKQLFLDQ GH UDGLRORJLH 6  
‫܈‬LLPDJLVWLFăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDOGH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQGHQWDUOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ăGHEXWDQW
 'HQWLVWSULQFLSDO 66'  
 'HQWLVW 66'  
 'HQWLVWGHEXWDQW 66'  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 29

 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  
VSHFLDOLVW WHKQLFLDQ VXSHULRU GH
LPDJLVWLFă UDGLRORJLH UDGLRWHUDSLH ‫܈‬L
UDGLRGLDJQRVWLF FRVPHWLFLDQ PHGLFDO
VSHFLDOLVW DVLVWHQW PHGLFDO VSHFLDOL]DW
WHKQLFLDQGHODERUDWRUFOLQLFWHKQLFLDQGH
IDUPDFLH DVLVWHQW GH IL]LRNLQHWRWHUDSLH
DVLVWHQW PHGLFDO GH XUJHQ‫܊‬H PHGLFR
FKLUXUJLFDOH DVLVWHQW PHGLFRVRFLDO
WHKQLFLDQ GHQWDU VSHFLDOL]DW DVLVWHQW GH
SURILOD[LH VWRPDWRORJLFă DVLVWHQW LJLHQLVW
SHQWUX FDELQHW VWRPDWRORJLF DVLVWHQW
SHQWUX VWRPDWRORJLH DVLVWHQW PHGLFDO
JHQHUDOLVW WHKQLFLDQ GH UDGLRORJLH ‫܈‬L
LPDJLVWLFă WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUHDXGLWLYăWHKQLFLDQGHSURWH]DUH
RFXODUă DVLVWHQW PHGLFDO GH JHULDWULH
JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă SHQWUX
YkUVWQLFL DVLVWHQW PHGLFDO GH LJLHQă ‫܈‬L
VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUSULQFLSDO
 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  
VSHFLDOLVW WHKQLFLDQ VXSHULRU GH
LPDJLVWLFă UDGLRORJLH UDGLRWHUDSLH ‫܈‬L
UDGLRGLDJQRVWLF FRVPHWLFLDQ PHGLFDO
VSHFLDOLVW DVLVWHQW PHGLFDO VSHFLDOL]DW
WHKQLFLDQGHODERUDWRUFOLQLFWHKQLFLDQGH
IDUPDFLH DVLVWHQW GH IL]LRNLQHWRWHUDSLH
DVLVWHQW PHGLFDO GH XUJHQ‫܊‬H PHGLFR
FKLUXUJLFDOH DVLVWHQW PHGLFRVRFLDO
WHKQLFLDQ GHQWDU VSHFLDOL]DW DVLVWHQW GH
SURILOD[LH VWRPDWRORJLFă DVLVWHQW LJLHQLVW
SHQWUX FDELQHW VWRPDWRORJLF DVLVWHQW
SHQWUX VWRPDWRORJLH DVLVWHQW PHGLFDO
JHQHUDOLVW WHKQLFLDQ GH UDGLRORJLH ‫܈‬L
LPDJLVWLFă WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUHDXGLWLYăWHKQLFLDQGHSURWH]DUH
RFXODUă DVLVWHQW PHGLFDO GH JHULDWULH
JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă SHQWUX
YkUVWQLFL DVLVWHQW PHGLFDO GH LJLHQă ‫܈‬L
VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDU
30 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  


VSHFLDOLVW WHKQLFLDQ VXSHULRU GH
LPDJLVWLFă UDGLRORJLH UDGLRWHUDSLH ‫܈‬L
UDGLRGLDJQRVWLF FRVPHWLFLDQ PHGLFDO
VSHFLDOLVW DVLVWHQW PHGLFDO VSHFLDOL]DW
WHKQLFLDQGHODERUDWRUFOLQLFWHKQLFLDQGH
IDUPDFLH DVLVWHQW GH IL]LRNLQHWRWHUDSLH
DVLVWHQW PHGLFDO GH XUJHQ‫܊‬H PHGLFR
FKLUXUJLFDOH DVLVWHQW PHGLFRVRFLDO
WHKQLFLDQ GHQWDU VSHFLDOL]DW DVLVWHQW GH
SURILOD[LH VWRPDWRORJLFă DVLVWHQW LJLHQLVW
SHQWUX FDELQHW VWRPDWRORJLF DVLVWHQW
SHQWUX VWRPDWRORJLH DVLVWHQW PHGLFDO
JHQHUDOLVW WHKQLFLDQ GH UDGLRORJLH ‫܈‬L
LPDJLVWLFă WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUHDXGLWLYăWHKQLFLDQGHSURWH]DUH
RFXODUă DVLVWHQW PHGLFDO GH JHULDWULH
JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă SHQWUX
YkUVWQLFL DVLVWHQW PHGLFDO GH LJLHQă ‫܈‬L
VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUGHEXWDQW
 $VLVWHQWPHGLFDOSULQFLSDO   3/  
 $VLVWHQWPHGLFDO   3/  
 $VLVWHQWPHGLFDOGHEXWDQW   3/  
 $VLVWHQWPHGLFDOSULQFLSDO   0  
 $VLVWHQWPHGLFDO   0  
 $VLVWHQWPHGLFDOGHEXWDQW   0  
 7HKQLFLDQGHQWDUSULQFLSDO   0  
 7HKQLFLDQGHQWDU   0  
 7HKQLFLDQGHQWDUGHEXWDQW   0  
 6RUăPHGLFDOăSULQFLSDO   0  
 6RUăPHGLFDOă   0  
 6RUăPHGLFDOăGHEXWDQW   0  
 $XWRSVLHUSULQFLSDO 0  
 $XWRSVLHU 0  
 $XWRSVLHUGHEXWDQW 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
SULQFLSDO
 6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
GHEXWDQW


MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 31

a.2. Anatomia patologică și medicina legală



$QDWRPLDSDWRORJLFă‫܈‬LPHGLFLQD
1U 1LYHOXO OHJDOă
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULXOGHED]ăOHL

  *UDGD‫܊‬LD &RHILFLHQW
$QXO
 0HGLFSULPDU 6  
 0HGLFVSHFLDOLVW 6  
 0HGLFUH]LGHQWDQXO,99 6  
 0HGLFUH]LGHQWDQXO,,, 6  
 0HGLFUH]LGHQWDQXO,, 6  
 0HGLFUH]LGHQWDQXO, 6  
 )DUPDFLVWSULPDU   6  
 )DUPDFLVWVSHFLDOLVW 6  
 )DUPDFLVW 6  
$VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH
 6  
SULQFLSDO
 $VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH 6  
$VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH
 6  
GHEXWDQW
$VLVWHQWPHGLFDODVLVWHQWPHGLFDO
 66'  
VSHFLDOLVWSULQFLSDO
$VLVWHQWPHGLFDODVLVWHQWPHGLFDO
 66'  
VSHFLDOLVW
$VLVWHQWPHGLFDODVLVWHQWPHGLFDO
 66'  
VSHFLDOLVWGHEXWDQW
 $VLVWHQWPHGLFDOSULQFLSDO   3/  
 $VLVWHQWPHGLFDO   3/  
 $VLVWHQWPHGLFDOGHEXWDQW   3/  
 $VLVWHQWPHGLFDOSULQFLSDO   0  
 $VLVWHQWPHGLFDO   0  
 $VLVWHQWPHGLFDOGHEXWDQW   0  
 6RUăPHGLFDOăSULQFLSDO   0  
 6RUăPHGLFDOă   0  
 6RUăPHGLFDOăGHEXWDQW   0  
 $XWRSVLHUSULQFLSDO 0  
 $XWRSVLHU 0  
 $XWRSVLHUGHEXWDQW 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
SULQFLSDO
 6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
GHEXWDQW

32 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

a.3. Servicii de ambulanță, compartimente de primire urgențe: UPU-SMURD, UPU, CPU, secții/compartimente cu
paturi de ATI/TI, unitate de transport neonatală

6HUYLFLLGHDPEXODQ‫܊‬ăFRPSDUWLPHQWH
GHSULPLUHXUJHQ‫܊‬H8386085'
838&38VHF‫܊‬LLFRPSDUWLPHQWHFX
1U 1LYHOXO
)XQF‫܊‬LD SDWXULGH$7,7,XQLWDWHGHWUDQVSRUW
FUW VWXGLLORU
 QHRQDWDOă
 
6DODULXOGHED]ăOHL
*UDGD‫܊‬LD &RHILFLHQW
$QXO
 0HGLFSULPDU 6  
 0HGLFGHQWLVWSULPDU 6  
 0HGLFVSHFLDOLVW 6  
 0HGLFGHQWLVWVSHFLDOLVW 6  
 0HGLFUH]LGHQWDQXO,99 6  
 0HGLFUH]LGHQWDQXO,,, 6  
 0HGLFUH]LGHQWDQXO,, 6  
 0HGLFUH]LGHQWDQXO, 6  
 0HGLF 6  
 0HGLFGHQWLVW 6  
 )DUPDFLVWSULPDU   6  
 )DUPDFLVWVSHFLDOLVW 6  
 )DUPDFLVWUH]LGHQWDQXO,,, 6  
 )DUPDFLVWUH]LGHQWDQXO,, 6  
 )DUPDFLVWUH]LGHQWDQXO, 6  
 )DUPDFLVW 6  
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO

SULQFLSDO 6 
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO

VSHFLDOLVW 6 
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6  
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO

GHEXWDQW 6 
 $VLVWHQW PHGLFDO WHKQLFLDQ GH UDGLRORJLH 6  
‫܈‬LLPDJLVWLFăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDOGH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQGHQWDUOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
PRD‫܈‬ăSULQFLSDO
 $VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH‫܈‬L 6  
LPDJLVWLFă OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO GH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQ GHQWDU OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUHDXGLWLYăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHSURILOD[LHGHQWDUăOLFHQ‫܊‬LDWPRD‫܈‬ă
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 33
S ‫܊‬ ‫܈‬
 $VLVWHQW PHGLFDO WHKQLFLDQ GH UDGLRORJLH 6  
‫܈‬LLPDJLVWLFăOLFHQ‫܊‬LDWDVLVWHQWPHGLFDOGH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQGHQWDUOLFHQ‫܊‬LDWDVLVWHQWPHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
PRD‫܈‬ăGHEXWDQW
 'HQWLVWSULQFLSDO 66'  
 'HQWLVW 66'  
 'HQWLVWGHEXWDQW 66'  
 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  
VSHFLDOLVWWHKQLFLDQVXSHULRUGHLPDJLVWLFă
UDGLRORJLH UDGLRWHUDSLH ‫܈‬L UDGLRGLDJQRVWLF
FRVPHWLFLDQ PHGLFDO VSHFLDOLVW DVLVWHQW
PHGLFDO VSHFLDOL]DW WHKQLFLDQ GH ODERUDWRU
FOLQLF WHKQLFLDQ GH IDUPDFLH DVLVWHQW GH
IL]LRNLQHWRWHUDSLH DVLVWHQW PHGLFDO GH
XUJHQ‫܊‬H PHGLFRFKLUXUJLFDOH DVLVWHQW
PHGLFRVRFLDO WHKQLFLDQ GHQWDU VSHFLDOL]DW
DVLVWHQW GH SURILOD[LH VWRPDWRORJLFă
DVLVWHQW LJLHQLVW SHQWUX FDELQHW
VWRPDWRORJLF DVLVWHQW SHQWUX VWRPDWRORJLH
DVLVWHQW PHGLFDO JHQHUDOLVW WHKQLFLDQ GH
UDGLRORJLH ‫܈‬L LPDJLVWLFă WHKQLFLDQ GH
DXGLRORJLH ‫܈‬L SURWH]DUH DXGLWLYă WHKQLFLDQ
GH SURWH]DUH RFXODUă DVLVWHQW PHGLFDO GH
JHULDWULH JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă
SHQWUXYkUVWQLFLDVLVWHQWPHGLFDOGHLJLHQă
‫܈‬L VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW ‫܈‬L GLHWHWLFLDQ WHKQLFLDQ GHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUSULQFLSDO
 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  
VSHFLDOLVWWHKQLFLDQVXSHULRUGHLPDJLVWLFă
UDGLRORJLH UDGLRWHUDSLH ‫܈‬L UDGLRGLDJQRVWLF
FRVPHWLFLDQ PHGLFDO VSHFLDOLVW DVLVWHQW
PHGLFDO VSHFLDOL]DW WHKQLFLDQ GH ODERUDWRU
FOLQLF WHKQLFLDQ GH IDUPDFLH DVLVWHQW GH
IL]LRNLQHWRWHUDSLH DVLVWHQW PHGLFDO GH
XUJHQ‫܊‬H PHGLFRFKLUXUJLFDOH DVLVWHQW
PHGLFRVRFLDOWHKQLFLDQGHQWDUVSHFLDOL]DW
DVLVWHQW GH SURILOD[LH VWRPDWRORJLFă
DVLVWHQW LJLHQLVW SHQWUX FDELQHW
VWRPDWRORJLFDVLVWHQWSHQWUXVWRPDWRORJLH
DVLVWHQW PHGLFDO JHQHUDOLVW WHKQLFLDQ GH
UDGLRORJLH ‫܈‬L LPDJLVWLFă WHKQLFLDQ GH
DXGLRORJLH ‫܈‬L SURWH]DUH DXGLWLYă WHKQLFLDQ
GH SURWH]DUH RFXODUă DVLVWHQW PHGLFDO GH
JHULDWULH JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă
SHQWUXYkUVWQLFLDVLVWHQWPHGLFDOGHLJLHQă
‫܈‬L VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW ‫܈‬L GLHWHWLFLDQ WHKQLFLDQ GHQWDU
VSHFLDOLVWDVLVWHQWGHQWDU
34 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 $VLVWHQW PHGLFDO DVLVWHQW PHGLFDO 66'  


VSHFLDOLVW WHKQLFLDQ VXSHULRU GH
LPDJLVWLFă UDGLRORJLH UDGLRWHUDSLH ‫܈‬L
UDGLRGLDJQRVWLF FRVPHWLFLDQ PHGLFDO
VSHFLDOLVW DVLVWHQW PHGLFDO VSHFLDOL]DW
WHKQLFLDQGHODERUDWRUFOLQLFWHKQLFLDQGH
IDUPDFLH DVLVWHQW GH IL]LRNLQHWRWHUDSLH
DVLVWHQW PHGLFDO GH XUJHQ‫܊‬H PHGLFR
FKLUXUJLFDOH DVLVWHQW PHGLFRVRFLDO
WHKQLFLDQ GHQWDU VSHFLDOL]DW DVLVWHQW GH
SURILOD[LH VWRPDWRORJLFă DVLVWHQW LJLHQLVW
SHQWUX FDELQHW VWRPDWRORJLF DVLVWHQW
SHQWUX VWRPDWRORJLH DVLVWHQW PHGLFDO
JHQHUDOLVW WHKQLFLDQ GH UDGLRORJLH ‫܈‬L
LPDJLVWLFă WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUHDXGLWLYăWHKQLFLDQGHSURWH]DUH
RFXODUă DVLVWHQW PHGLFDO GH JHULDWULH
JHURQWRORJLH ‫܈‬L DVLVWHQ‫܊‬ă VRFLDOă SHQWUX
YkUVWQLFL DVLVWHQW PHGLFDO GH LJLHQă ‫܈‬L
VăQăWDWH SXEOLFă IL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQ PHGLFDO DVLVWHQW PHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUGHEXWDQW
 $VLVWHQWPHGLFDOSULQFLSDO   3/  
 $VLVWHQWPHGLFDO   3/  
 $VLVWHQWPHGLFDOGHEXWDQW   3/  
 $VLVWHQWPHGLFDOSULQFLSDO   0  
 $VLVWHQWPHGLFDO   0  
 $VLVWHQWPHGLFDOGHEXWDQW   0  
 7HKQLFLDQGHQWDUSULQFLSDO   0  
 7HKQLFLDQGHQWDU   0  
 7HKQLFLDQGHQWDUGHEXWDQW   0  
 6RUăPHGLFDOăSULQFLSDO   0  
 6RUăPHGLFDOă   0  
 6RUăPHGLFDOăGHEXWDQW   0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
RSHUDWRUUHJLVWUDWRUGHXUJHQ‫܊‬ăSULQFLSDO
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
RSHUDWRUUHJLVWUDWRUGHXUJHQ‫܊‬ă
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
RSHUDWRUUHJLVWUDWRUGHXUJHQ‫܊‬ăGHEXWDQW

MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 35

a.4. Unități sanitare, cu excepția celor cuprinse în unități clinice, și unități de asistență medico-socială


8QLWă‫܊‬LVDQLWDUH, cu excepаia celor
cuprinse în unităаi clinice,‫܈‬LXQLWă‫܊‬LGH
1U 1LYHOXO DVLVWHQ‫܊‬ăPHGLFRVRFLDOă
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULXOGHED]ăOHL

  *UDGD‫܊‬LD &RHILFLHQW
$QXO
 0HGLFSULPDU 6  
 0HGLFGHQWLVWSULPDU 6  
 0HGLFVSHFLDOLVW 6  
 0HGLFGHQWLVWVSHFLDOLVW 6  
 0HGLF 6  
 0HGLFGHQWLVW 6  
 )DUPDFLVWSULPDU   6  
 )DUPDFLVWVSHFLDOLVW 6  
 )DUPDFLVW 6  
)L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO
 6  
SULQFLSDO
)L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO
 6  
VSHFLDOLVW
 )L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO 6  
)L]LRNLQHWRWHUDSHXWELRLQJLQHUPHGLFDO
 6  
GHEXWDQW
 $VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH‫܈‬L 6  
LPDJLVWLFă OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO GH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQ GHQWDU OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ăSULQFLSDO
 $VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH‫܈‬L 6  
LPDJLVWLFă OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO GH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQ GHQWDU OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ă
36 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
‫܈‬
 $VLVWHQWPHGLFDOWHKQLFLDQGHUDGLRORJLH‫܈‬L 6  
LPDJLVWLFă OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO GH
ODERUDWRU FOLQLF OLFHQ‫܊‬LDW OLFHQ‫܊‬LDW vQ
EDOQHRIL]LRNLQHWRWHUDSLH ‫܈‬L UHFXSHUDUH
WHKQLFLDQ GHQWDU OLFHQ‫܊‬LDW DVLVWHQW PHGLFDO
GHQWDU OLFHQ‫܊‬LDW WHKQLFLDQ GH IDUPDFLH
OLFHQ‫܊‬LDW WHKQLFLDQ GH DXGLRORJLH ‫܈‬L
SURWH]DUH DXGLWLYă OLFHQ‫܊‬LDW DVLVWHQW
PHGLFDO GH SURILOD[LH GHQWDUă OLFHQ‫܊‬LDW
DVLVWHQW PHGLFDO OLFHQ‫܊‬LDW vQ QXWUL‫܊‬LH ‫܈‬L
GLHWHWLFăPRD‫܈‬ăGHEXWDQW
 'HQWLVWSULQFLSDO 66'  
 'HQWLVW 66'  
 'HQWLVWGHEXWDQW 66'  
 $VLVWHQWPHGLFDODVLVWHQWPHGLFDO 66'  
VSHFLDOLVWWHKQLFLDQVXSHULRUGHLPDJLVWLFă
UDGLRORJLHUDGLRWHUDSLH‫܈‬LUDGLRGLDJQRVWLF
FRVPHWLFLDQPHGLFDOVSHFLDOLVWDVLVWHQW
PHGLFDOVSHFLDOL]DWWHKQLFLDQGHODERUDWRU
FOLQLFWHKQLFLDQGHIDUPDFLHDVLVWHQWGH
IL]LRNLQHWRWHUDSLHDVLVWHQWPHGLFDOGH
XUJHQ‫܊‬HPHGLFRFKLUXUJLFDOHDVLVWHQW
PHGLFRVRFLDOWHKQLFLDQGHQWDUVSHFLDOL]DW
DVLVWHQWGHSURILOD[LHVWRPDWRORJLFă
DVLVWHQWLJLHQLVWSHQWUXFDELQHW
VWRPDWRORJLFDVLVWHQWSHQWUXVWRPDWRORJLH
DVLVWHQWPHGLFDOJHQHUDOLVWWHKQLFLDQGH
UDGLRORJLH‫܈‬LLPDJLVWLFăWHKQLFLDQGH
DXGLRORJLH‫܈‬LSURWH]DUHDXGLWLYăWHKQLFLDQ
GHSURWH]DUHRFXODUăDVLVWHQWPHGLFDOGH
JHULDWULHJHURQWRORJLH‫܈‬LDVLVWHQ‫܊‬ăVRFLDOă
SHQWUXYkUVWQLFLDVLVWHQWPHGLFDOGHLJLHQă
‫܈‬LVăQăWDWHSXEOLFăIL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQPHGLFDODVLVWHQWPHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUSULQFLSDO
 $VLVWHQWPHGLFDODVLVWHQWPHGLFDO 66'  
VSHFLDOLVWWHKQLFLDQVXSHULRUGHLPDJLVWLFă
UDGLRORJLHUDGLRWHUDSLH‫܈‬LUDGLRGLDJQRVWLF
FRVPHWLFLDQPHGLFDOVSHFLDOLVWDVLVWHQW
PHGLFDOVSHFLDOL]DWWHKQLFLDQGHODERUDWRU
FOLQLFWHKQLFLDQGHIDUPDFLHDVLVWHQWGH
IL]LRNLQHWRWHUDSLHDVLVWHQWPHGLFDOGH
XUJHQ‫܊‬HPHGLFRFKLUXUJLFDOHDVLVWHQW
PHGLFRVRFLDOWHKQLFLDQGHQWDUVSHFLDOL]DW
DVLVWHQWGHSURILOD[LHVWRPDWRORJLFă
DVLVWHQWLJLHQLVWSHQWUXFDELQHW
VWRPDWRORJLFDVLVWHQWSHQWUXVWRPDWRORJLH
DVLVWHQWPHGLFDOJHQHUDOLVWWHKQLFLDQGH
UDGLRORJLH‫܈‬LLPDJLVWLFăWHKQLFLDQGH
DXGLRORJLH‫܈‬LSURWH]DUHDXGLWLYăWHKQLFLDQ
GHSURWH]DUHRFXODUăDVLVWHQWPHGLFDOGH
JHULDWULHJHURQWRORJLH‫܈‬LDVLVWHQ‫܊‬ăVRFLDOă
SHQWUXYkUVWQLFLDVLVWHQWPHGLFDOGHLJLHQă
‫܈‬LVăQăWDWHSXEOLFăIL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQPHGLFDODVLVWHQWPHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDU
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 37

 $VLVWHQWPHGLFDODVLVWHQWPHGLFDOVSHFLDOLVW 66'  


WHKQLFLDQVXSHULRUGHLPDJLVWLFăUDGLRORJLH
UDGLRWHUDSLH‫܈‬LUDGLRGLDJQRVWLFFRVPHWLFLDQ
PHGLFDOVSHFLDOLVWDVLVWHQWPHGLFDO
VSHFLDOL]DWWHKQLFLDQGHODERUDWRUFOLQLF
WHKQLFLDQGHIDUPDFLHDVLVWHQWGH
IL]LRNLQHWRWHUDSLHDVLVWHQWPHGLFDOGH
XUJHQ‫܊‬HPHGLFRFKLUXUJLFDOHDVLVWHQW
PHGLFRVRFLDOWHKQLFLDQGHQWDUVSHFLDOL]DW
DVLVWHQWGHSURILOD[LHVWRPDWRORJLFăDVLVWHQW
LJLHQLVWSHQWUXFDELQHWVWRPDWRORJLFDVLVWHQW
SHQWUXVWRPDWRORJLHDVLVWHQWPHGLFDO
JHQHUDOLVWWHKQLFLDQGHUDGLRORJLH‫܈‬L
LPDJLVWLFăWHKQLFLDQGHDXGLRORJLH‫܈‬L
SURWH]DUHDXGLWLYăWHKQLFLDQGHSURWH]DUH
RFXODUăDVLVWHQWPHGLFDOGHJHULDWULH
JHURQWRORJLH‫܈‬LDVLVWHQ‫܊‬ăVRFLDOăSHQWUX
YkUVWQLFLDVLVWHQWPHGLFDOGHLJLHQă‫܈‬L
VăQăWDWHSXEOLFăIL]LRNLQHWRWHUDSHXW
FRVPHWLFLDQPHGLFDODVLVWHQWPHGLFDO
QXWUL‫܊‬LRQLVW‫܈‬LGLHWHWLFLDQWHKQLFLDQGHQWDU
VSHFLDOLVWDVLVWHQWGHQWDUGHEXWDQW
 $VLVWHQWPHGLFDOSULQFLSDO   3/  
 $VLVWHQWPHGLFDO   3/  
 $VLVWHQWPHGLFDOGHEXWDQW   3/  
 $VLVWHQWPHGLFDOSULQFLSDO   0  
 $VLVWHQWPHGLFDO   0  
 $VLVWHQWPHGLFDOGHEXWDQW   0  
 7HKQLFLDQGHQWDUSULQFLSDO   0  
 7HKQLFLDQGHQWDU   0  
 7HKQLFLDQGHQWDUGHEXWDQW   0  
 6RUăPHGLFDOăSULQFLSDO   0  
 6RUăPHGLFDOă   0  
 6RUăPHGLFDOăGHEXWDQW   0  
 $XWRSVLHUSULQFLSDO 0  
 $XWRSVLHU 0  
 $XWRSVLHUGHEXWDQW 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
SULQFLSDO
 6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO 0  
6WDWLVWLFLDQPHGLFDOUHJLVWUDWRUPHGLFDO
 0  
GHEXWDQW

38 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

b) Salarii de bază pentru personalul de specialitate din compartimentele paraclinice medico-sanitare


b.1. Unități clinice

8QLWă‫܊‬LFOLQLFH
1U 1LYHOXO 6DODULXOGHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL
 &RHILFLHQW
  *UDGD‫܊‬LD
$QXO
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQSULQFLSDOH[SHUW
 6  
vQIL]LFăPHGLFDOă
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQVSHFLDOLVW
 6  
IL]LFLDQPHGLFDO
 %LRORJELRFKLPLVWFKLPLVWIL]LFLDQ 6  
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQIL]LFLDQPHGLFDO
 6  
GHEXWDQW
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOSULQFLSDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOGHEXWDQW
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
SULQFLSDO  
 3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO   66'  
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
GHEXWDQW  
 3VLKRORJSULQFLSDO 6  
 3VLKRORJVSHFLDOLVW 6  
 3VLKRORJSUDFWLFDQW 6  
 3VLKRORJVWDJLDU 6  

b.2. Anatomia patologică și medicina legală



$QDWRPLDSDWRORJLFă‫܈‬L
PHGLFLQDOHJDOă
1U 1LYHOXO
)XQF‫܊‬LD 6DODULXOGHED]ă
FUW VWXGLLORU
 ±OHL
  &RHILFLHQW
*UDGD‫܊‬LD
$QXO
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQSULQFLSDOH[SHUW
 6  
vQIL]LFăPHGLFDOă
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQVSHFLDOLVW
 6  
IL]LFLDQPHGLFDO
 %LRORJELRFKLPLVWFKLPLVWIL]LFLDQ 6  
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQIL]LFLDQPHGLFDO
 6  
GHEXWDQW
 3VLKRORJSULQFLSDO 6  
 3VLKRORJVSHFLDOLVW 6  
 3VLKRORJSUDFWLFDQW 6  
 3VLKRORJVWDJLDU 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 39

b.3. Servicii de ambulanță, compartimente de primire urgențe: UPU-SMURD, UPU, CPU, secții/compartimente cu
paturi de ATI/TI, unitate de transport neonatală
6HUYLFLLGHDPEXODQ‫܊‬ă
FRPSDUWLPHQWHGHSULPLUH
XUJHQ‫܊‬H8386085'838
&38VHF‫܊‬LLFRPSDUWLPHQWHFX
1U 1LYHOXO
)XQF‫܊‬LD SDWXULGH$7,7,XQLWDWHGH
FUW VWXGLLORU
 WUDQVSRUWQHRQDWDOă
 
6DODULXOGHED]ă
OHL
&RHILFLHQW
*UDGD‫܊‬LD
$QXO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOSULQFLSDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOGHEXWDQW
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
SULQFLSDO  
 3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO   66'  
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
GHEXWDQW  
 3VLKRORJSULQFLSDO 6  
 3VLKRORJVSHFLDOLVW 6  
 3VLKRORJSUDFWLFDQW 6  
 3VLKRORJVWDJLDU 6  
b.4. Unități sanitare, cu excepția celor cuprinse în unități clinice, și unități de asistență medico-socială

8QLWă‫܊‬LVDQLWDUHcu excepаia
celor cuprinse în unităаi
clinice‫܈‬LXQLWă‫܊‬LGHDVLVWHQ‫܊‬ă
1U 1LYHOXO PHGLFRVRFLDOă
)XQF‫܊‬LD
FUW VWXGLLORU
 6DODULXOGHED]ă
 
OHL
*UDGD‫܊‬LD &RHILFLHQW
$QXO
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQSULQFLSDO
 6  
H[SHUWvQIL]LFăPHGLFDOă
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQVSHFLDOLVW
 6  
IL]LFLDQPHGLFDO
 %LRORJELRFKLPLVWFKLPLVWIL]LFLDQ 6  
%LRORJELRFKLPLVWFKLPLVWIL]LFLDQIL]LFLDQ
 6  
PHGLFDOGHEXWDQW
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOSULQFLSDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDO
/RJRSHGVRFLRORJSURIHVRU&)0NLQHWRWHUDSHXW
 6  
DVLVWHQWVRFLDOGHEXWDQW
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
SULQFLSDO  
 3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO   66'  
3URIHVRU&)0ELRORJFKLPLVWDVLVWHQWVRFLDO
 66'  
GHEXWDQW  
 3VLKRORJSULQFLSDO 6  
 3VLKRORJVSHFLDOLVW 6  
 3VLKRORJSUDFWLFDQW 6  
 3VLKRORJVWDJLDU 6  
40 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

c) Salarii de bază pentru personalul auxiliar sanitar


c.1. Unități clinice

8QLWă‫܊‬LFOLQLFH
1U 1LYHOXO 6DODULXOGHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL
 &RHILFLHQW
  *UDGD‫܊‬LD
$QXO
 ,QILUPLHUăDJHQW''' 0*  
 ,QILUPLHUăDJHQW'''GHEXWDQW 0*  
 %UDQFDUGLHUEăLH‫܈‬QăPRODUVSăOăWRUHDVăvQJULMLWRDUH  
 %XFăWDU  
 ‫܇‬RIHUDXWRVDQLWDUă,,   0  
 ‫܇‬RIHUDXWRVDQLWDUă,,,   0*  

c.2. Anatomia patologică și medicina legală

$QDWRPLDSDWRORJLFă‫܈‬L
PHGLFLQDOHJDOă
1U 1LYHOXO 6DODULXOGHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL

  *UDGD‫܊‬LD &RHILFLHQW
$QXO
 %UDQFDUGLHUEăLH‫܈‬QăPRODUVSăOăWRUHDVăvQJULMLWRDUH   

c.3. Servicii de ambulanță, compartimente de primire urgențe: UPU-SMURD, UPU, CPU



6HUYLFLLGHDPEXODQ‫܊‬ă
FRPSDUWLPHQWHGHSULPLUHXUJHQ‫܊‬H
1U 1LYHOXO 8386085'838&38
)XQF‫܊‬LD
FUW VWXGLLORU
 6DODULXOGHED]ăOHL
 
*UDGD‫܊‬LD &RHILFLHQW
$QXO
 ,QILUPLHUăDJHQW''' 0*  
 ,QILUPLHUăDJHQW'''GHEXWDQW 0*  
 %UDQFDUGLHUEăLH‫܈‬QăPRODUVSăOăWRUHDVă
 
vQJULMLWRDUH 
 $PEXODQ‫܊‬LHU   0  
 ‫܇‬RIHUDXWRVDQLWDUă,   0  
 ‫܇‬RIHUDXWRVDQLWDUă,,   0  

c.4. Unități sanitare, cu excepția celor cuprinse în unități clinice, și unități de asistență medico-socială

8QLWă‫܊‬LVDQLWDUHcu excepаia
celor cuprinse în unităаi
clinice‫܈‬LXQLWă‫܊‬LGHDVLVWHQ‫܊‬ă
1U 1LYHOXO PHGLFRVRFLDOă
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULXOGHED]ă

  OHL
*UDGD‫܊‬LD &RHILFLHQW
$QXO
 ,QILUPLHUăDJHQW''' 0*  
 ,QILUPLHUăDJHQW'''GHEXWDQW 0*  
 %UDQFDUGLHUEăLH‫܈‬QăPRODUVSăOăWRUHDVăvQJULMLWRDUH   
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 41
 ‫܈‬  S  J M 
 %XFăWDU   
 ‫܇‬RIHUDXWRVDQLWDUă,,   0  
 ‫܇‬RIHUDXWRVDQLWDUă,,,   0*  
*1) Se poate utiliza numai în unități sanitare umane.
*2) Se aplică și funcțiilor de asistent farmacie, asistent social și educator-puericultor, instructor de energo-terapie, tehnician dentar și tehnician sanitar
din profilurile: utilaje medicale, optician, protezare ortopedică și protezare auditivă care au studii de acest nivel.
*3) Se aplică și funcțiilor de tehnician sanitar din profilurile: utilaje medicale, optician, protezare ortopedică și protezare auditivă.
*4) Se aplică și funcțiilor de oficiant medical, laborant cu liceul sanitar, moașă, maseur, gipsar, autopsier, instructor CFM, instructor de educație, instructor
de ergoterapie, asistent social, educator-puericultor.
*5) Se aplică și funcțiilor de educator-puericultor, asistent social și cosmetician ocupate de persoane care au absolvit cu diplomă învățământul superior
de scurtă durată, cu durata studiilor de 2 - 3 ani învățământ de zi sau de 3 - 4 ani învățământ seral sau fără frecvență.
*6) Se ocupă prin concurs sau examen de promovare de către personalul care îndeplinește condițiile de încadrare pentru funcția de șofer autosanitară I,
conducător de șalupă medicală, motorist și marinar cu o vechime de minimum 6 ani și posedă diploma de absolvire a cursului de ambulanțier potrivit Ordinului
ministrului sănătății nr. 388/1992 privind înființarea Școlii de Ambulanțieri în cadrul Stației de Salvare a Municipiului București, actual Serviciul de Ambulanță al
municipiului București - Ilfov, și în alte servicii județene de ambulanță acreditate de Ministerul Sănătății prin ordin al ministrului.
*7) Se aplică nivelurile I și II pentru salarizarea șoferilor autosanitarelor din serviciile de ambulanță județene și al municipiului București-Ilfov, iar nivelurile
de salarizare II și III, șoferilor autosanitarelor din alte unități sanitare.

NOTĂ:
1. Nivelul de salarizare prevăzut pentru unități clinice se aplică și personalului de specialitate din direcțiile de sănătate
publică.
2. Nivelul de salarizare prevăzut pentru unități clinice se poate aplica și personalului de cercetare cu studii superioare din
unitățile clinice, din institutele și centrele medicale, care este confirmat în gradele profesionale de la lit. a.1. nr. crt. 1—13,16 și
17,19—21 și lit. b.l. nr. crt. 1, 2, 5,11.
3. Nivelul de studii (M) cu diplomă de bacalaureat sau certificat de absolvire pentru funcțiile de ambulanțier și șofer
autosanitară I și II se utilizează numai pentru încadrarea și promovarea acestor funcții la serviciile de ambulanță și se aplică ulterior
intrării în vigoare a prezentei legi.
4. Anexele a.4., b.4., c.4. se utilizează și pentru dispensarele medicale școlare, pentru personalul din creșe, pentru
personalul medical din cadrul cabinetelor medicale din structurile teritoriale de expertiză medicală și recuperare a capacității de
muncă, personalul medico-sanitar din direcțiile județene pentru tineret și sport, complexele sportive naționale și cluburile sportive,
precum și pentru medicii din asistența socială.
5. Salarizarea prevăzută pentru funcția de infirmier se utilizează și pentru muncitorii care asigură supravegherea bolnavilor
psihici periculoși din unitățile, secțiile sau compartimentele de psihiatrie.
6. Salariile de bază prevăzute la pct. 2 sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

3. Unități de asistență socială/servicii sociale cu sau fără cazare


3.1. Salarii de bază pentru funcții de conducere

6DODULLOHGHED]ăOHL
1U 1LYHOXO &RHILFLHQW
)XQF‫܊‬LD $QXO
FUW VWXGLLORU
*UDG, *UDG,, *UDG, *UDG,,
D 8QLWă‫܊‬LGHDVLVWHQ‫܊‬ăVRFLDOăFHQWUH
 FXSHUVRQDOLWDWHMXULGLFă     
 'LUHFWRU 6    
 &RQWDELO‫܈‬HI 6    
E 8QLWă‫܊‬LGHDVLVWHQ‫܊‬ăVRFLDOăFHQWUH
 IăUăSHUVRQDOLWDWHMXULGLFă     
 ‫܇‬HIFHQWUX 6    
666'
 &RRUGRQDWRUSHUVRQDOGHVSHFLDOLWDWH    
3/
NOTĂ:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

3.2. Salarii de bază pentru personalul de specialitate din unitățile de asistență socială/centre cu sau fără
personalitate juridică
6DODULXOGHED]ă
1U 1LYHOXO OHL
)XQF‫܊‬LD
FUW VWXGLLORU *UDGD‫܊‬LD &RHILFLHQW

 
$QXO
 $VLVWHQWVRFLDOSULQFLSDO 6  
 $VLVWHQWVRFLDOVSHFLDOLVW 6  
 $VLVWHQWVRFLDOSUDFWLFDQW 6  
42 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 $VLVWHQWVRFLDOGHEXWDQW 6  


 3VLKRORJSULQFLSDO 6  
 3VLKRORJVSHFLDOLVW 6  
 3VLKRORJSUDFWLFDQW 6  
 3VLKRORJVWDJLDU 6  
/RJRSHGSURIHVRU&)0LQWHUSUHWvQ
OLPEDMXOPLPLFRJHVWXDO‫܈‬LDOOLPEDMXOXL
 VSHFLILFSHUVRDQHORUFXVXUGRFHFLWDWH 6  
NLQHWRWHUDSHXWSVLKRSHGDJRJWHUDSHXW
RFXSDWLRQDOSULQFLSDO
/RJRSHGSURIHVRU&)0LQWHUSUHWvQ
OLPEDMXOPLPLFRJHVWXDO‫܈‬LDOOLPEDMXOXL
 VSHFLILFSHUVRDQHORUFXVXUGRFHFLWDWH 6  
NLQHWRWHUDSHXWSVLKRSHGDJRJWHUDSHXW
RFXSDWLRQDO
 /RJRSHGSURIHVRU&)0LQWHUSUHWvQ
OLPEDMXOPLPLFRJHVWXDO‫܈‬LDOOLPEDMXOXL
VSHFLILFSHUVRDQHORUFXVXUGRFHFLWDWH 6  
NLQHWRWHUDSHXWSVLKRSHGDJRJWHUDSHXW
RFXSDWLRQDOGHEXWDQW
 )L]LRNLQHWRWHUDSHXWSULQFLSDO 6  
 )L]LRNLQHWRWHUDSHXWVSHFLDOLVW 6  
 )L]LRNLQHWRWHUDSHXW 6  
 )L]LRNLQHWRWHUDSHXWGHEXWDQW 6  
 (GXFDWRUSULQFLSDO 6  
 (GXFDWRU 6  
 (GXFDWRUGHEXWDQW 6  
 $VLVWHQWPHGLFDOWHKQLFLDQGH
DXGLRORJLH‫܈‬LSURWH]DUHDXGLWLYă 6  
SULQFLSDO
 $VLVWHQWPHGLFDOWHKQLFLDQGH
6  
DXGLRORJLH‫܈‬LSURWH]DUHDXGLWLYă
 $VLVWHQWPHGLFDOWHKQLFLDQGH
DXGLRORJLH‫܈‬LSURWH]DUHDXGLWLYă 6  
GHEXWDQW
 (GXFDWRUSURIHVRU&)0HGXFDWRU
SXHULFXOWRUDVLVWHQWPHGLFDOSULQFLSDO 66'  
 
 (GXFDWRUSURIHVRU&)0HGXFDWRU
66'  
SXHULFXOWRUDVLVWHQWPHGLFDO  
 (GXFDWRUSURIHVRU&)0HGXFDWRU
SXHULFXOWRUDVLVWHQWPHGLFDOGHEXWDQW 66'  
 
 (GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
3/ 
PHGLFDOSULQFLSDO  
 (GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
3/ 
PHGLFDO  
(GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
 3/  
PHGLFDOGHEXWDQW 
(GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
LJLHQDDVLVWHQW%)7RSWLFLDQSURWH]DUH
 0  
RUWRSHGLFă‫܈‬LDXGLWLYăDVLVWHQWPHGLFDO
SULQFLSDO 
(GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
LJLHQăDVLVWHQW%)7RSWLFLDQSURWH]DUH
 0  
RUWRSHGLFă‫܈‬LDXGLWLYăDVLVWHQWPHGLFDO
 
(GXFDWRUHGXFDWRUSXHULFXOWRUDVLVWHQW
LJLHQăDVLVWHQW%)7RSWLFLDQSURWH]DUH
 0  
RUWRSHGLFă‫܈‬LDXGLWLYăDVLVWHQWPHGLFDO
GHEXWDQW 
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 43

3URIHVRU&)0LQWHUSUHWvQOLPEDM
 PLPLFRJHVWXDO‫܈‬LDOOLPEDMXOXLVSHFLILF 0  
SHUVRDQHORUFXVXUGRFHFLWDWH
,QVWUXFWRUGHHGXFD‫܊‬LHLQVWUXFWRU&)0
 0  
SULQFLSDO
 ,QVWUXFWRUGHHGXFD‫܊‬LHLQVWUXFWRU&)0 0  
,QVWUXFWRUGHHGXFD‫܊‬LHLQVWUXFWRU&)0
 0  
GHEXWDQW
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 3/  
UHFXSHUDUHSULQFLSDO
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 3/  
UHFXSHUDUH
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 3/  
UHFXSHUDUHGHEXWDQW
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 0  
UHFXSHUDUHSULQFLSDO
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 0  
UHFXSHUDUH
,QVWUXFWRUGHHUJRWHUDSLHDUWWHUDSHXW
 DQLPDWRUVRFLRHGXFDWLYSHGDJRJGH 0  
UHFXSHUDUHGHEXWDQW
 6RUăPHGLFDOăPDVRUSULQFLSDO 0  
 6RUăPHGLFDOăPDVRU 0  
 6RUăPHGLFDOăPDVRUGHEXWDQW 0  
 $VLVWHQWPDWHUQDOSURIHVLRQLVW 0*  
3ăULQWHVRFLDOvQJULMLWRUODGRPLFLOLX
 DVLVWHQWSHUVRQDODVLVWHQWSHUVRQDO 0*  
SURIHVLRQLVW
7HKQLFLDQSURWH]LVWWHKQLFLDQ
 03/  
DXGLRSURWH]LVW
 $JHQWLQIRUPDUHSULYLQGFDULHUD 03/  
*1) Se aplică și funcțiilor de asistent de fiziokinetoterapie, asistent medico-social, asistent medical generalist, tehnician de audiologie și protezare auditivă,
asistent medical de geriatrie, gerontologie și asistență socială pentru vârstnici, asistent medical de igienă și sănătate publică, fiziokinetoterapeut, nutriționist și
dietetician, lucrător social, interpret în limbajul mimico-gestual și al limbajului specific persoanelor cu surdocecitate, mediator social.

3.3. Salarii de bază pentru personalul de îngrijire și asistență pentru unități de asistență socială/centre cu sau
fără personalitate juridică

6DODULXOGHED]ă
1U OHL
)XQF‫܊‬LD 1LYHOXO
FUW *UDGD‫܊‬LD &RHILFLHQW
 VWXGLLORU

$QXO
 ,QILUPLHUă *  
 ,QILUPLHUăGHEXWDQWă *  
 6XSUDYHJKHWRUGHQRDSWH *  
 6XSUDYHJKHWRUGHQRDSWHGHEXWDQW *  
 ÌQJULMLWRDUHVSăOăWRUHDVă  
 %XFăWDU  

N O T Ă:
Salariile de bază prevăzute la pct. 3.2. și pct. 3.3 sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se
determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
44 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II și a programului normal de lucru de la funcția de bază va


Reglementări specifice personalului din sănătate, beneficia de drepturile aferente activității prestate în linia de
din unitățile de asistență medico-socială și din unitățile gardă, stabilite conform prevederilor art. 3 din prezenta anexă;
de asistență socială/servicii sociale pentru determinarea tarifului orar se utilizează salariul de bază
al funcției de execuție stabilit pentru funcția și gradul profesional
Art. 1. — (1) În unitățile sanitare, de asistență socială și de
în care acesta este confirmat prin ordin al ministrului sănătății,
asistență medico-socială, unde activitatea se desfășoară fără
corespunzător vechimii în muncă.
întrerupere, în trei ture, personalul care lucrează lunar în toate Art. 5. — (1) În situația în care medicul de gardă la domiciliu
cele trei ture, precum și personalul care lucrează în două ture în este solicitat pentru a acorda asistență medicală de urgență la
sistem de 12 cu 24 pot primi, în locul sporului pentru munca nivelul unității sanitare publice și nu poate fi contactat sau nu
prestată în timpul nopții, prevăzut la art. 20 din prezenta lege, un răspunde solicitării, acesta va fi sancționat prin diminuarea
spor de 15% din salariul de bază pentru orele lucrate în cele trei, salariului de bază individual cu un procent între 5—10% pe o
respectiv două ture. perioadă de 3 luni, în condițiile legii.
(2) Sporul prevăzut la alin. (1) nu se ia în calcul la (2) Gărzile efectuate de medici în cadrul normei legale de
determinarea limitei sporurilor, compensațiilor, primelor, premiilor muncă și al programului normal de lucru de la funcția de bază
și indemnizațiilor prevăzută la art. 25 din prezenta lege. în limita a 48 de ore pe săptămână, care reprezintă durata
Art. 2. — (1) Munca prestată de personalul din unitățile maximă legală a timpului de muncă, inclusiv orele suplimentare,
sanitare, de asistență socială și de asistență medico-socială, în reprezintă gărzi obligatorii.
vederea asigurării continuității activității, în zilele de repaus (3) Pentru gărzile efectuate peste durata prevăzută la
săptămânal, de sărbători legale și în celelalte zile în care, în alin. (2) în vederea asigurării continuității asistenței medicale
conformitate cu reglementările în vigoare, nu se lucrează, în medicii vor încheia cu unitatea sanitară publică un contract
cadrul programului normal de lucru, se plătește cu un spor de individual de muncă cu timp parțial pentru activitatea prestată
până la 100% din salariul de bază al funcției îndeplinite. în linia de gardă și vor beneficia numai de drepturile aferente
(2) Munca astfel prestată și plătită nu se compensează și cu activității prestate în linia de gardă.
timp liber corespunzător. Art. 6. — (1) Personalul didactic medico-farmaceutic
Art. 3. — (1) Personalul sanitar cu pregătire superioară care desfășoară activitate integrată în unitățile sanitare în care
efectuează gărzi pentru asigurarea continuității asistenței funcționează catedra sau disciplina didactică.
medicale în afara normei legale de muncă și a programului (2) Personalul didactic de la catedrele sau disciplinele care
normal de lucru de la funcția de bază se salarizează cu tariful funcționează în alte unități decât cele sanitare este integrat în
orar aferent salariului de bază. unitățile sanitare stabilite de Ministerul Sănătății.
(2) Gărzile efectuate de personalul sanitar cu pregătire (3) Cadrele didactice prevăzute la alin. (1) și (2), cu excepția
superioară pentru asigurarea continuității asistenței medicale în rezidenților, desfășoară activitate integrată prin cumul de funcții
afara normei legale de muncă și a programului de lucru de la în baza unui contract individual de muncă cu 1/2 normă, în limita
funcția de bază în zilele lucrătoare se salarizează cu un spor de posturilor normate și vacante.
până la 75% din tariful orar al salariului de bază. (4) La încetarea raporturilor de muncă cu unitățile de
(3) Gărzile efectuate de personalul sanitar cu pregătire învățământ, cadrele didactice care au fost integrate o perioadă
superioară pentru asigurarea continuității asistenței medicale în mai mare de 5 ani își pot continua activitatea, cu normă întreagă,
afara normei legale de muncă și a programului de lucru de la în unitățile sanitare în care au fost integrate, în baza contractului
funcția de bază, în zilele de repaus săptămânal, de sărbători individual de muncă pe perioadă nedeterminată.
legale și în celelalte zile în care, potrivit dispozițiilor legale, nu se Art. 7. — (1) În raport cu condițiile în care se desfășoară
lucrează, se salarizează cu un spor de până la 100% din tariful activitatea, pot fi acordate, pentru personalul de specialitate
orar al salariului de bază. medico-sanitar și auxiliar sanitar din unitățile sanitare și unitățile
(4) Procentul concret al sporului prevăzut la alin. (2) și (3) se medico-sociale, cu respectarea prevederilor legale, următoarele
aprobă trimestrial de comitetul director, după consultarea categorii de sporuri:
organizațiilor sindicale reprezentative la nivel de unitate sau a a) pentru personalul din unități, secții și compartimente de
reprezentanților angajaților. boli infecțioase, neonatologie, săli de naștere și din
(5) Medicii care nu au contract individual de muncă cu laboratoarele de analize medicale, care își desfășoară
unitatea sanitară care organizează serviciul de gardă și care la activitatea în condiții periculoase, un spor de până la 25% din
nivelul acestei unități desfășoară activitate numai în linia de salariul de bază;
gardă vor încheia cu această unitate sanitară publică un contract b) pentru condiții deosebit de periculoase: leprozerii,
individual de muncă cu timp parțial pentru activitatea prestată anatomie patologică, TBC, SIDA, dializă, recuperare
în linia de gardă și vor beneficia numai de drepturile aferente neuromotorie, neuropsihomotorie, neuromusculară și
activității prestate în linia de gardă, stabilite conform prevederilor neurologică, psihiatrie, medicină legală, asistență medicală de
acestui articol. Salariul de bază se stabilește pentru funcția și urgență și transport sanitar, acordată prin serviciile de
gradul profesional în care aceștia sunt confirmați prin ordin al ambulanță și structurile de primire a urgențelor (UPU - SMURD,
ministrului sănătății, corespunzător vechimii în muncă, și se UPU, CPU), secții și compartimente de ATI, de terapie intensivă
utilizează pentru stabilirea tarifului orar. și de terapie acută, unități de supraveghere și tratament avansat
(6) Medicii care sunt nominalizați să asigure asistența al pacienților cardiaci critici (USTACC), secții și compartimente
medicală de urgență, prin chemări de la domiciliu, sunt salarizați de îngrijiri paliative, secții și compartimente de oncologie
pentru perioada în care asigură garda la domiciliu cu 40% din medicală, oncologie pediatrică, radioterapie, hematologie
tariful orar aferent salariului de bază pentru numărul de ore în oncologică, neurologie, neurochirurgie, transplant de organe,
care asigură garda la domiciliu. secții/compartimente pentru arși, laboratoare de radioterapie,
Art. 4. — Personalul sanitar cu pregătire superioară cu centru pentru arși, serviciul/compartimentul de prevenire a
funcție de conducere care efectuează gărzi pentru asigurarea infecțiilor asociate asistenței medicale, Institutul Național de
continuității asistenței medicale în afara normei legale de muncă Hematologie Transfuzională „Prof. Dr. C.T. Nicolau” București,
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 45

centrele de transfuzie sanguină regionale/județene și al potrivit metodologiei legale în vigoare, prin transformarea
municipiului București, personalul încadrat în blocul operator, în postului avut într-un post corespunzător promovării.
punctele de transfuzii din spital, în laboratoarele de cardiologie (2) Criteriile privind angajarea și promovarea în funcții, grade
și radiologie intervențională, în laboratoarele de endoscopie și trepte profesionale se stabilesc prin ordin al ministrului
intervențională, unități de accidente vasculare cerebrale acute sănătății, de comun acord cu organizațiile sindicale semnatare
(UAVCA)/unitate de urgențe neurovasculare, genetică medicală, ale contractului colectiv de muncă la nivel de ramură sanitară.
precum și medicii de specialitate chirurgicală, epidemii deosebit Art. 11. — Criteriile pentru clasificarea pe categorii a unităților
de grave și altele asemenea, stabilite de Ministerul Sănătății, și subunităților sanitare, stabilirea nivelului de salarizare pe
cuantumul sporului este de până la 85% din salariul de bază. grade pentru personalul cu funcții de conducere, precum și a
Nivelul sporului se stabilește de conducerea fiecărei unități indemnizației pentru îndeplinirea unor sarcini, activități și
sanitare cu personalitate juridică, de comun acord cu sindicatele responsabilități suplimentare funcției de bază se stabilesc prin
reprezentative semnatare ale contractului colectiv de muncă la ordin al ministrului sănătății.
nivel de sistem sanitar și cu încadrarea în cheltuielile de Art. 12. — Medicii angajați ai unităților de asistență
personal aprobate în bugetul de venituri și cheltuieli; socială/serviciilor sociale cu sau fără cazare și ai serviciilor
c) pentru condiții periculoase sau vătămătoare, un spor de publice de asistență socială care administrează servicii sociale
până la 15% din salariul de bază, corespunzător timpului lucrat sunt salarizați la nivelul de salarizare din unitățile sanitare, altele
la locurile de muncă respective; decât cele clinice.
d) pentru condiții grele de muncă, un spor de până la 15% din Art. 13. — Personalul din unitățile de asistență socială/centre
salariul de bază, corespunzător timpului lucrat la locurile de cu sau fără cazare se încadrează pe bază de contract individual
muncă respective; de muncă.
e) pentru personalul care își desfășoară activitatea cu surse Art. 14. — (1) În unitățile de asistență socială/centre cu sau
de radiații sau generatoare de radiații, un spor pentru condiții fără cazare, în raport cu condițiile în care se desfășoară
periculoase de până la 30% din salariul de bază, diferențiat pe activitatea, pot fi acordate, cu respectarea prevederilor legale,
categorii de risc radiologic astfel: 10% la categoria I, 15% la următoarele categorii de sporuri:
categoria a II-a, 20% la categoria a III-a și 30% la categoria a IV-a; a) pentru condiții deosebit de periculoase, personalul care
f) pentru unitățile sanitare cu specific deosebit, stabilite de își desfășoară activitatea în centrele de recuperare și reabilitare
Ministerul Sănătății, un spor de până la 15% din salariul de bază; neuropsihiatrică/alte centre rezidențiale pentru persoane cu
g) pentru personalul care lucrează în unități sanitare aflate în afecțiuni neuropsihiatrice, în module de reabilitare
localități izolate, situate la altitudine, care au căi de acces dificile comportamentală, precum și personalul din unitățile de asistență
sau unde atragerea personalului se face cu greutate, un spor socială în care sunt îngrijiți bolnavii cu TBC, SIDA sau cu nevoi
de până la 20% din salariul de bază; de recuperare neuromotorie, neuropsihomotorie,
h) pentru activități care se desfășoară în condiții deosebite, neuromusculară și neurologic, un spor de până la 75% din
cum ar fi stres sau risc, un spor de până la 15% din salariul de salariul de bază, corespunzător timpului lucrat la locurile de
bază, corespunzător timpului lucrat la locurile de muncă muncă respective;
respective. b) pentru condiții grele de muncă, un spor de până la 15% din
(2) Localitățile prevăzute la alin. (1) lit. g) se stabilesc prin salariul de bază, corespunzător timpului lucrat la locurile de
ordin al ministrului sănătății. muncă respective;
(3) Locurile de muncă, categoriile de personal, mărimea c) pentru personalul care lucrează în unități de asistență
concretă a sporului, precum și condițiile de acordare a acestora socială aflate în localități izolate, situate la altitudine, care au căi
se stabilesc de către ordonatorul de credite, cu consultarea de acces dificile sau unde atragerea personalului se face cu
sindicatelor sau, după caz, a reprezentanților salariaților, în limita greutate, un spor de până la 20% din salariul de bază;
prevederilor din regulamentul elaborat potrivit prezentei legi, d) pentru condiții periculoase sau vătămătoare, un spor de
având la bază buletinele de determinare sau, după caz, până la 15% din salariul de bază, corespunzător timpului lucrat
expertizare, emise de către autoritățile abilitate în acest sens. la locurile de muncă respective;
(4) Sporurile prevăzute la alin. (1) lit. a) – f) și h) nu pot fi e) pentru activități care se desfășoară în condiții deosebite,
acordate cumulat aceleiași persoane. cum ar fi stres sau risc, un spor de până la 15% din salariul de
(5) Personalul din cadrul direcțiilor de sănătate publică poate bază, corespunzător timpului lucrat la locurile de muncă
beneficia, în raport cu condițiile de muncă, de sporurile respective;
prevăzute la alin. (1) lit. a), b), c) și e), dacă își desfășoară f) pentru al II-lea copil dat în plasament, asistenții maternali
activitatea în aceleași condiții cu personalul care beneficiază de profesioniști pot beneficia de un spor de până la 15% din salariul
aceste sporuri. de bază;
Art. 8. — Regulamentul privind timpul de muncă, organizarea g) pentru asigurarea continuității în muncă, asistenții
și efectuarea gărzilor în unitățile publice din sistemul sanitar se maternali profesioniști pot beneficia de un spor de până la 7,5%
aprobă prin ordin al ministrului sănătății, cu consultarea din salariul de bază.
organizațiilor sindicale semnatare ale contractului colectiv de (2) Locurile de muncă, categoriile de personal, mărimea
muncă la nivel de ramură sanitară. concretă a sporului, precum și condițiile de acordare a acestuia
Art. 9. — Salariile de bază pentru personalul care își se stabilesc de către ordonatorul de credite, cu consultarea
desfășoară activitatea în structuri sanitare care furnizează sindicatelor sau, după caz, a reprezentanților salariaților, în limita
servicii medicale ambulatorii de specialitate se stabilesc pe prevederilor din regulamentul elaborat potrivit prezentei legi,
funcții, grade și trepte profesionale corespunzător vechimii în având la bază buletinele de determinare sau, după caz,
muncă. expertizare, emise de către autoritățile abilitate în acest sens.
Art. 10. — (1) În unitățile sanitare publice din sistemul sanitar (3) Sporurile prevăzute la alin. (1) lit. d) și e) nu pot fi
promovarea în funcții, grade și trepte profesionale se face acordate cumulat aceleiași persoane.
46 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. III
FAMILIA OCUPAȚIONALĂ DE FUNCȚII BUGETARE „CULTURĂ”
UNITĂȚI DE CULTURĂ

CAPITOLUL I
Salarii de bază din instituții de spectacole sau concerte naționale ori de importanță națională
I. Instituții de spectacole sau concerte naționale ori de importanță națională, instituții de spectacole la care
spectacolele se desfășoară preponderent în limba unei minorități, din cadrul filarmonicilor, opere, teatre, teatre lirice sau
muzicale, centre naționale de cultură/artă națională, Corul Național de Cameră Madrigal — Marin Constantin, Centrul
Național de Artă Tinerimea Română, precum și instituții de spectacole sau concerte din subordinea Consiliului General
al Municipiului București și din alte instituții de spectacole sau concerte

a) Funcții de conducere
,QVWLWX‫܊‬LLGHVSHFWDFROHVDXFRQFHUWH
QD‫܊‬LRQDOHRULGHLPSRUWDQ‫܊‬ăQD‫܊‬LRQDOă
1U 1LYHOXO 6DODULXOGHED]ăOHL
)XQF‫܊‬LD &RHILFLHQW
FUW VWXGLLORU
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
 'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU‫܈‬HI 6    
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
 ‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HIDWHOLHU 6    
 ‫܇‬HIDWHOLHU 3/0    
 ‫܇‬HIIRUPD‫܊‬LHPXQFLWRUL     
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție

,QVWLWX‫܊‬LLGHVSHFWDFROHVDXFRQFHUWHQD‫܊‬LRQDOH
1U 1LYHOXO RULGHLPSRUWDQ‫܊‬ăQD‫܊‬LRQDOă
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULXOGHED]ăOHL

  *UDGD‫܊‬LD &RHILFLHQW
$QXO
 'LULMRUUHJL]RUDUWLVWLFVFHQRJUDI
FRUHJUDIVROLVW YRFDOEDOHWFRQFHUWLVW
LQVWUXPHQWLVW SULPEDOHULQ
6  
FRQFHUWPDHVWUXDFWRU WHDWUXPkQXLWRU
SăSX‫܈‬LPDULRQHWH 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 'LULMRUFRU‫܈‬HISDUWLGăPDHVWUX DUWLVW
FLUFFRUHSHWLWRUFRUEDOHWGDQV  6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 47

 $UWLVWLQVWUXPHQWLVWDUWLVWOLULFEDOHULQ
GDQVDWRUDUWLVWFLUFFRUHSHWLWRU
DFRPSDQLDWRUUHJL]RUVFHQă FXOLVH 
6  
PDHVWUXGHVWXGLL EDOHWFDQWRPX]LFDO 
FRULVW RSHUDRSHUHWD 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 6HFUHWDU OLWHUDUPX]LFDODUWLVWLFSODWRX
35PDUNHWLQJ VFXOSWRUSăSX‫܈‬LDUWLVW
6  
SODVWLFJUDILFLDQVHIRUFKHVWUD
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 ,PSUHVDUDUWLVWLFSLFWRUFRQVXOWDQW
DUWLVWLFSURGXFăWRUGHOHJDWVXIOHRU
6  
RSHUăRSHUHWăWHDWUX 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 0DFKLRUSHUXFKLHURSHUDWRU OXPLQL
LPDJLQHVXQHW DVLVWHQWUHJLH
6  
VFHQRJUDILHVHFUHWDUSODWRX
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 'LULMRUGLULMRUFRUDFWRUDUWLVWFLUF
LQVWUXPHQWLVWFRULVWRSHUăDFWRUPkQXLWRU
SăSX‫܈‬LFRULVWVXIOHRUEDOHULQGDQVDWRU
FRUHSHWLWRUVFXOSWRUSăSX‫܈‬LDUWLVWSODVWLF
JUDILFLDQUHIHUHQWOLWHUDUPX]LFDODUWLVWLF
  
UHJL]RUWHKQLF VROLVW YRFDOEDOHW
LQVWUXPHQWLVWFRQFHUWLVWLQVWUXPHQWLVW 
PDHVWUX EDOHWGDQVFRUHSHWLWRUDUWLVW
FLUF FRQFHUWPDHVWUXFRUHJUDI
WUHDSWD,
WUHDSWD,,   
WUHDSWD,,,   
GHEXWDQW   
 0DHVWUX OXPLQLLPDJLQHVXQHW PDHVWUX
DFRUGRUSLDQFODYHFLQOXWLHU VSHFLDOLVW
  
RUJăLQVWUXPHQWHGHVXIODW ‫܈‬HIRUFKHVWUD
WUHDSWD,
WUHDSWD,,   
WUHDSWD,,,   
GHEXWDQW   
 2SHUDWRU OXPLQLLPDJLQHVXQHW HGLWRU
LPDJLQHVXQHW UHJL]RUVFHQăLOXPLQLVW
VFHQăPDFKLRUSHUXFKLHUEXWDIRU 0*  
UHFX]LWHU
WUHDSWD,
WUHDSWD,, 0*  
WUHDSWD,,, 0*  
GHEXWDQW 0*  
48 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 0XQFLWRUGLQDFWLYLWDWHDVSHFLILFă
 LQVWLWX‫܊‬LLORUGHVSHFWDFROHVDXFRQFHUWH 0*  
 WUHDSWD,
 WUHDSWD,, 0*  
WUHDSWD,,, 0*  
GHEXWDQW 0*  
 6XSUDYHJKHWRUVDOăFRQWURORUELOHWH
  
JDUGHURELHUSODVDWRUVDOă
 0DQLSXODQWGHFRU
  
WUHDSWD,
WUHDSWD,,   
N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.
II. Alte instituții de spectacole sau concerte
a) Funcții de conducere
$OWHLQVWLWX‫܊‬LLGHVSHFWDFROHVDXFRQFHUWH
6DODULLOHGHED]ă
1U 1LYHOXO
)XQF‫܊‬LD OHL &RHILFLHQW
FUW VWXGLLORU
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
 'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU‫܈‬HI 6    
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HI
 6  
DWHOLHU  
 ‫܇‬HIIRUPD‫܊‬LHPXQFLWRUL     
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție
$OWHLQVWLWX‫܊‬LLGHVSHFWDFROHVDXFRQFHUWH
1U 1LYHOXO
)XQF‫܊‬LD 6DODULXOGHED]ăOHL
FUW VWXGLLORU
 *UDGD‫܊‬LD &RHILFLHQW
 
$QXO
 'LULMRUUHJL]RUDUWLVWLFVFHQRJUDIFRUHJUDI
VROLVW YRFDOEDOHWFRQFHUWLVWLQVWUXPHQWLVW 
SULPEDOHULQFRQFHUWPDHVWUXDFWRU WHDWUX 6  
PkQXLWRUSăSX‫܈‬LPDULRQHWH 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 'LULMRUFRU‫܈‬HISDUWLGăPDHVWUX DUWLVWFLUF
FRUHSHWLWRUFRUEDOHWGDQV  6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 $UWLVWLQVWUXPHQWLVWDUWLVWOLULFEDOHULQ
GDQVDWRUDUWLVWFLUFFRUHSHWLWRU
DFRPSDQLDWRUUHJL]RUVFHQă FXOLVH 
6  
PDHVWUXGHVWXGLL EDOHWFDQWRPX]LFDO 
FRULVW RSHUDRSHUHWD 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 49

 6HFUHWDU OLWHUDUPX]LFDODUWLVWLFSODWRX35
PDUNHWLQJ VFXOSWRUSăSX‫܈‬LDUWLVWSODVWLF
6  
JUDILFLDQVHIRUFKHVWUD
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 ,PSUHVDUDUWLVWLFSLFWRUFRQVXOWDQWDUWLVWLF
SURGXFăWRUGHOHJDWVXIOHRU RSHUăRSHUHWă
6  
WHDWUX 
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 0DFKLRUSHUXFKLHURSHUDWRU OXPLQL
LPDJLQHVXQHW DVLVWHQWUHJLHVFHQRJUDILH
6  
VHFUHWDUSODWRX
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 'LULMRUGLULMRUFRUDFWRUDUWLVWFLUF
LQVWUXPHQWLVWFRULVWRSHUăDFWRUPkQXLWRU
SăSX‫܈‬LFRULVWVXIOHRUEDOHULQGDQVDWRU
FRUHSHWLWRUVFXOSWRUSăSX‫܈‬LDUWLVWSODVWLF
JUDILFLDQUHIHUHQWOLWHUDUPX]LFDODUWLVWLF
  
UHJL]RUWHKQLFVROLVW YRFDOEDOHW
LQVWUXPHQWLVWFRQFHUWLVWLQVWUXPHQWLVW 
PDHVWUX EDOHWGDQVFRUHSHWLWRUDUWLVWFLUF 
FRQFHUWPDHVWUXFRUHJUDI
WUHDSWD,
WUHDSWD,,   
WUHDSWD,,,   
GHEXWDQW   
 0DHVWUX OXPLQLLPDJLQHVXQHW PDHVWUX
DFRUGRUSLDQFODYHFLQOXWLHU VSHFLDOLVW
  
RUJăLQVWUXPHQWHGHVXIODW VHIRUFKHVWUD
WUHDSWD,
WUHDSWD,,   
WUHDSWD,,,   
GHEXWDQW   
 2SHUDWRU OXPLQLLPDJLQHVXQHW HGLWRU
LPDJLQHVXQHW UHJL]RUVFHQăLOXPLQLVW
0*  
VFHQăPDFKLRUSHUXFKLHUEXWDIRUUHFX]LWHU
WUHDSWD,
WUHDSWD,, 0*  
WUHDSWD,,, 0*  
GHEXWDQW 0*  
 0XQFLWRUGLQDFWLYLWDWHDVSHFLILFăLQVWLWX‫܊‬LLORU
GHVSHFWDFROHVDXFRQFHUWH 0*  
WUHDSWD,
 WUHDSWD,, 0*  
 WUHDSWD,,, 0*  
 GHEXWDQW 0*  
 6XSUDYHJKHWRUVDOăFRQWURORUELOHWH
  
JDUGHURELHUSODVDWRUVDOă
 0DQLSXODQWGHFRU
  
WUHDSWD,
WUHDSWD,,   

N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.
50 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II
Salarii de bază din sistemul bibliotecilor publice din România
I. Biblioteci naționale sau de importanță națională, stabilite potrivit legii, precum și Biblioteca Academiei Române

a) Funcții de conducere 
%LEOLRWHFLQD‫܊‬LRQDOHVDXGH
LPSRUWDQ‫܊‬ăQD‫܊‬LRQDOăSUHFXP‫܈‬L
%LEOLRWHFD$FDGHPLHL5RPkQH
1U 1LYHOXO 6DODULLOHGHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL &RHILFLHQW
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU
 6    
‫܈‬HI
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HI
 6    
DWHOLHU

N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție

%LEOLRWHFLQD‫܊‬LRQDOHVDX
GHLPSRUWDQ‫܊‬ăQD‫܊‬LRQDOă
SUHFXP‫܈‬L%LEOLRWHFD
$FDGHPLHL5RPkQH  
1U 1LYHOXO
)XQF‫܊‬LD 6DODULXOGH
FUW VWXGLLORU
ED]ăOHL
  
*UDGD‫܊‬LD &RHILFLHQW
$QXO
 %LEOLRWHFDUELEOLRWHFDUDUKLYLVW
ELEOLRJUDIUHGDFWRUWHKQRUHGDFWRU
LQJLQHUGHVLVWHPGRFXPHQWDULVW 6   

FRQVHUYDWRUUHVWDXUDWRUDQDOLVW
JUDGXO,$
 JUDGXO, 6   
 JUDGXO,, 6   
 GHEXWDQW 6   
 %LEOLRWHFDUELEOLRWHFDUDUKLYLVW
ELEOLRJUDIUHGDFWRUWHKQRUHGDFWRU
66'   
FRQVHUYDWRUUHVWDXUDWRU 
JUDGXO,
 JUDGXO,, 66'   
 JUDGXO,,, 66'   
 GHEXWDQW 66'   
 %LEOLRWHFDUUHGDFWRUWHKQRUHGDFWRU
3/  
WUHDSWD,  
 WUHDSWD,, 3/   
 WUHDSWD,,, 3/   
 GHEXWDQW 3/   
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 51

 %LEOLRWHFDUUHGDFWRUWHKQRUHGDFWRU
RSHUDWRUGDWHFRQWURORUGDWHUHVWDXUDWRU
0   
FRQVHUYDWRU 
WUHDSWD,$
 WUHDSWD, 0   
 WUHDSWD,, 0   
 GHEXWDQW 0   
 6XSUDYHJKHWRUVDOă    
 0kQXLWRUFDUWHJDUGHURELHU    
N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.

II. Alte biblioteci


a) Funcții de conducere
 
$OWHELEOLRWHFL
1U 1LYHOXO 6DODULLOHGHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL &RHILFLHQW 
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
 'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU‫܈‬HI 6    
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HI
 6    
DWHOLHU 

N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție

$OWHELEOLRWHFL  

6DODULXO
1U 1LYHOXO GHED]ă
)XQF‫܊‬LD
FUW VWXGLLORU OHL
  
  *UDGD‫܊‬LD &RHILFLHQW

$QXO
  
 %LEOLRWHFDUELEOLRWHFDUDUKLYLVW
ELEOLRJUDIUHGDFWRUWHKQRUHGDFWRU
LQJLQHUGHVLVWHPGRFXPHQWDULVW 6   

FRQVHUYDWRUUHVWDXUDWRUDQDOLVW
JUDGXO,$
 JUDGXO, 6   
 JUDGXO,, 6   
 GHEXWDQW 6   
52 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 %LEOLRWHFDUELEOLRWHFDUDUKLYLVW
ELEOLRJUDIUHGDFWRUWHKQRUHGDFWRU
66'   
FRQVHUYDWRUUHVWDXUDWRU 
JUDGXO,
 JUDGXO,, 66'   
 JUDGXO,,, 66'   
 GHEXWDQW 66'   
 %LEOLRWHFDUUHGDFWRUWHKQRUHGDFWRU
3/  
WUHDSWD,  
 WUHDSWD,, 3/   
 WUHDSWD,,, 3/   
 GHEXWDQW 3/   
 %LEOLRWHFDUUHGDFWRUWHKQRUHGDFWRU
RSHUDWRUGDWHFRQWURORUGDWH
0   
UHVWDXUDWRUFRQVHUYDWRU 
WUHDSWD,$
 WUHDSWD, 0   
 WUHDSWD,, 0   
 GHEXWDQW 0   
 6XSUDYHJKHWRUVDOă    
 0kQXLWRUFDUWHJDUGHURELHU    
*) Se utilizează și în cadrul bibliotecilor universitare, pentru cei care au statut de personal didactic auxiliar.

N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL III
Salarii de bază din sistemul muzeelor publice din România
I. Muzee de importanță națională, stabilite potrivit legii

a) Funcții de conducere

0X]HHGHLPSRUWDQ‫܊‬ăQD‫܊‬LRQDOă
6DODULLOHGHED]ă
1U 1LYHOXO
)XQF‫܊‬LD OHL &RHILFLHQW 
FUW VWXGLLORU
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU
 6    
‫܈‬HI
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HI
 6    
DWHOLHU

NOTĂ:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 53

b) Funcții de execuție

0X]HHGHLPSRUWDQ‫܊‬ăQD‫܊‬LRQDOă
1U 1LYHOXO 6DODULXOGHED]ăOHL
)XQF‫܊‬LD
FUW VWXGLLORU *UDGD‫܊‬LD &RHILFLHQW 
$QXO
 0X]HRJUDIUHVWDXUDWRUFRQVHUYDWRUELEOLRJUDI
DUKHRORJDUKLWHFWLVWRULFFXUDWRUGHVLJQHU
WD[LGHUPLVWIRWRJUDIGHVHQDWRUDUWLVWLFHGXFDWRU 6  

PX]HDODUKLYLVW
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 %LRORJIL]LFLDQFKLPLVWVRFLRORJSVLKRORJ
WRSRJUDIGRFXPHQWDULVWJUDILFLDQSULQFLSDO 6  

 %LRORJIL]LFLDQFKLPLVWVRFLRORJSVLKRORJ
6  
VSHFLDOLVW 
 %LRORJIL]LFLDQFKLPLVWVRFLRORJSVLKRORJ 6  
 %LRORJIL]LFLDQFKLPLVWVRFLRORJSVLKRORJ
6  
WRSRJUDIGRFXPHQWDULVWJUDILFLDQGHEXWDQW 
 0X]HRJUDIUHVWDXUDWRUFRQVHUYDWRUELEOLRJUDI
ELEOLRWHFDUDUKLYLVWFRQGXFWRUDUKLWHFWHGXFDWRU
66'  
PX]HDOWRSRJUDI 
JUDGXO,
JUDGXO,, 66'  
JUDGXO,,, 66'  
GHEXWDQW 66'  
 5HVWDXUDWRUFRQVHUYDWRUWUH]RULHUUHGDFWRU
WHKQRUHGDFWRUJHVWLRQDUFXVWRGHWD[LGHUPLVW
GHVHQDWRUDUWLVWLFIRWRJUDIRSHUDWRUYLGHR 0  

WRSRJUDIGRFXPHQWDULVWJUDILFLDQ
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
 6XSUDYHJKHWRUPX]HXFRQWURORUELOHWH   
 *DUGHURELHU  

N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.
54 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

II. Alte muzee


a) Funcții de conducere

$OWHPX]HH
1U 1LYHOXO 6DODULLOHGHED]ăOHL
)XQF‫܊‬LD
FUW VWXGLLORU &RHILFLHQW
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 0DQDJHU GLUHFWRUJHQHUDOGLUHFWRU  6    
 'LUHFWRUJHQHUDODGMXQFW 6    
 'LUHFWRU 6    
 'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU‫܈‬HI 6    
 ‫܇‬HIVHF‫܊‬LH 6    
 ‫܇‬HIVHUYLFLX 6    
 ‫܇‬HIELURX‫܈‬HIODERUDWRU‫܈‬HIRILFLX‫܈‬HIDWHOLHU 6    

N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție
$OWHPX]HH

1U 1LYHOXO 6DODULXOGH


)XQF‫܊‬LD
FUW VWXGLLORU ED]ăOHL &RHILFLHQW  
*UDGD‫܊‬LD
$QXO
 0X]HRJUDIUHVWDXUDWRUFRQVHUYDWRU
ELEOLRJUDIDUKHRORJDUKLWHFW
LVWRULFFXUDWRUGHVLJQHU
6  
WD[LGHUPLVWIRWRJUDIGHVHQDWRU  
DUWLVWLFHGXFDWRUPX]HDODUKLYLVW
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 %LRORJIL]LFLDQFKLPLVWVRFLRORJ
SVLKRORJWRSRJUDIGRFXPHQWDULVW 6  

JUDILFLDQSULQFLSDO
 %LRORJIL]LFLDQFKLPLVWVRFLRORJ
6  
SVLKRORJVSHFLDOLVW 
 %LRORJIL]LFLDQFKLPLVWVRFLRORJ
6  
SVLKRORJ 
 %LRORJIL]LFLDQFKLPLVWVRFLRORJ
SVLKRORJWRSRJUDIGRFXPHQWDULVW 6  

JUDILFLDQGHEXWDQW
 0X]HRJUDIUHVWDXUDWRUFRQVHUYDWRU
ELEOLRJUDIELEOLRWHFDUDUKLYLVW
FRQGXFWRUDUKLWHFWSHGDJRJPX]HDO 66'  
 
WRSRJUDI
JUDGXO,
JUDGXO,, 66'  
JUDGXO,,, 66'  
GHEXWDQW 66'  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 55

 5HVWDXUDWRUFRQVHUYDWRUWUH]RULHU
UHGDFWRUWHKQRUHGDFWRUJHVWLRQDU
FXVWRGHWD[LGHUPLVWGHVHQDWRU
0  
DUWLVWLFIRWRJUDIRSHUDWRUYLGHR  
WRSRJUDIGRFXPHQWDULVWJUDILFLDQ
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
6XSUDYHJKHWRUPX]HXFRQWURORU
  
ELOHWH   
 *DUGHURELHU   
N O T Ă:

Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL IV
Salarii de bază din presă, edituri, informare documentară și alte instituții publice de cultură

a) Funcții de conducere

3UHVăHGLWXULLQIRUPDUHGRFXPHQWDUă
1U 1LYHOXO
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULLOHGHED]ăOHL
&RHILFLHQW
$QXO
 *UDG, *UDG,, *UDG, *UDG,,
 5HGDFWRU‫܈‬HIDGMXQFW PDQDJHU      
 5HGDFWRU‫܈‬HIDGMXQFW     
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții de execuție

3UHVăHGLWXUL
LQIRUPDUHGRFXPHQWDUă  
1U 1LYHOXO 6DODULXOGH
)XQF‫܊‬LD
FUW VWXGLLORU ED]ăOHL
&RHILFLHQW  
*UDGD‫܊‬LD
$QXO
 5HGDFWRUGHUXEULFăUHGDFWRU
OHFWRUSXEOLFLVWFRPHQWDWRU
WHKQRUHGDFWRUFRUHVSRQGHQWvQ 6  
 
VWUăLQăWDWH
JUDGXO,$
 JUDGXO, 6  
 JUDGXO,, 6  
 GHEXWDQW 6  
56 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 ‫܇‬HIDJHQ‫܊‬LHSXEOLFLWDWH
DGPLQLVWUDWRU SXEOLFD‫܊‬LLHGLWXUă 
UHSRUWHU IRWRUHSRUWHUFRUHVSRQGHQW
ORFDO VHFUHWDU WHKQLF GHUHGDF‫܊‬LH
6  
GRFXPHQWDULVWWUDGXFăWRU  
FDULFDWXULVWGHVHQDWRUDUWLVWLF
FRUHFWRU
JUDGXO,
 JUDGXO,, 6  
 JUDGXO,,, 6  
 GHEXWDQW 6  
 5HGDFWRUVHFUHWDUGHUHGDF‫܊‬LH

JUDGXO, 66'   
 JUDGXO,, 66'  
 JUDGXO,,, 66'  
 GHEXWDQW 66'  
 5HGDFWRUVHFUHWDU WHKQLF GH
 UHGDF‫܊‬LHGRFXPHQWDULVWWUDGXFăWRU
FDULFDWXULVWGHVHQDWRUDUWLVWLF 0  
 
FRUHFWRUWHKQRUHGDFWRU
WUHDSWD,$
WUHDSWD, 0  
 WUHDSWD,, 0  
 GHEXWDQW 0  
 /DERUDQWIRWRUHWX‫܈‬RUIRWRIRWRJUDI
 
WUHDSWD,$ 0*  
 WUHDSWD, 0*  
 WUHDSWD,, 0*  
 GHEXWDQW 0*  
N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL V
Salarii de bază din case de cultură, case de cultură studențești și alte instituții publice din domeniul culturii
a) Funcții de conducere

&DVHGHFXOWXUăFDVHGHFXOWXUă
VWXGHQ‫܊‬H‫܈‬WL‫܈‬LDOWHLQVWLWX‫܊‬LLSXEOLFH
  
1U 1LYHOXO GLQGRPHQLXOFXOWXULL
)XQF‫܊‬LD 6DODULLOHGHED]ă
FUW VWXGLLORU
OHL &RHILFLHQW  
$QXO
*UDG
   *UDG, *UDG,, *UDG, ,, 
 0DQDJHU GLUHFWRU  6    
'LUHFWRUDGMXQFWFRQWDELO
 6    
‫܈‬HI 
 ‫܇‬HIVHUYLFLX 6    
‫܇‬HIELURX‫܈‬HIODERUDWRU
 6    
‫܈‬HIRILFLX‫܈‬HIDWHOLHU 
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 57

b) Funcții de execuție

&DVHGHFXOWXUăFDVHGHFXOWXUă
VWXGHQ‫܊‬H‫܈‬WL‫܈‬LDOWHLQVWLWX‫܊‬LLSXEOLFHGLQ
GRPHQLXOFXOWXULL
1U 1LYHOXO
)XQF‫܊‬LD 6DODULXOGH
FUW VWXGLLORU
ED]ăOHL
*UDGD‫܊‬LD &RHILFLHQW

$QXO
 5HIHUHQWJUDGXO,$ 6  
 5HIHUHQWJUDGXO, 6  
 5HIHUHQWGHEXWDQW 6  
 5HIHUHQWJUDGXO, 66'  
 5HIHUHQWJUDGXO,, 66'  
 5HIHUHQWGHEXWDQW 66'  
 5HIHUHQWWUHDSWD, 3/  
 5HIHUHQWWUHDSWD,, 3/  
 5HIHUHQWGHEXWDQW 3/  
 5HIHUHQWWUHDSWD,$ 0  
 5HIHUHQWWUHDSWD, 0  
 5HIHUHQWGHEXWDQW 0  
N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0, potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL VI
Reglementări specifice personalului din cultură

Art. 1. — (1) În raport cu condițiile în care se desfășoară activitatea, pot fi acordate personalului salarizat, cu respectarea
prevederilor legale, următoarele categorii de sporuri:
a) pentru condiții periculoase sau vătămătoare, un spor de până la 15% din salariul de bază, corespunzător timpului lucrat
la locurile de muncă respective;
b) pentru condiții grele de muncă, un spor de până la 15% din salariul de bază, corespunzător timpului lucrat la locurile
respective de muncă.
(2) Locurile de muncă, categoriile de personal, mărimea concretă a sporului, precum și condițiile de acordare a acestuia
se stabilesc de către ordonatorul de credite, cu consultarea sindicatelor sau, după caz, a reprezentanților salariaților, în limita
prevederilor din regulamentul elaborat potrivit prezentei legi, având la bază buletinele de determinare sau, după caz, expertizare,
emise de către autoritățile abilitate în acest sens.
Art. 2. — Persoanele încadrate în unitățile de cultură, care au rezultate valoroase în activitatea artistică, pot ocupa în
condițiile legii, în mod cu totul excepțional, în baza regulamentului elaborat de Ministerul Culturii și Identității Naționale și cu
aprobarea nominală a ministrului culturii și identității naționale, funcții de specialitate vacante, fără a avea studiile necesare postului.
Art. 3. — Pentru funcțiile de conducere aflate la nr. crt. 1 din cadrul cap. I, II, III și V din prezenta anexă se încheie contracte
de management în baza Ordonanței de urgență a Guvernului nr. 189/2008 privind managementul instituțiilor publice de cultură,
aprobată cu modificări și completări prin Legea nr. 269/2009, cu modificările și completările ulterioare.
58 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. IV

F A M I L I A O C U P A Ț I O N A L Ă D E F U N C Ț I I B U G E T A R E „D I P L O M A Ț I E”

MINISTERUL AFACERILOR EXTERNE

CAPITOLUL I
Salariile de bază pentru membrii Corpului diplomatic și consular al României și personalul care ocupă funcții de
execuție specifice în administrația centrală a Ministerului Afacerilor Externe și care exercită funcții de conducere

1LYHO 6DODULLOHGHED]ăOHL
1U
)XQF‫܊‬LD GH &RHILFLHQW
FUW
VWXGLL $QXO
*UDG
   *UDG, *UDG,, *UDG, ,,
 6HFUHWDUJHQHUDOFXUDQJGLSORPDWLF 6    
 6HFUHWDUJHQHUDODGMXQFWFXUDQJGLSORPDWLF 6    

 'LUHFWRUJHQHUDOFXUDQJGLSORPDWLF 6    


'LUHFWRUJHQHUDODGMXQFWGLUHFWRUGHFDELQHWFX
 6    
UDQJGLSORPDWLF
 'LUHFWRUFXUDQJGLSORPDWLF 6    
 'LUHFWRUDGMXQFWFXUDQJGLSORPDWLF 6    
 ‫܇‬HIVHUYLFLXFXUDQJGLSORPDWLF 6    
 ‫܇‬HIELURXFXUDQJGLSORPDWLF 6    
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

CAPITOLUL II
Salariile de bază pentru membrii Corpului diplomatic și consular al României și pentru personalul care îndeplinește
funcții de execuție specifice în centrala Ministerului Afacerilor Externe

a) Salarii de bază pentru funcțiile diplomatice și consulare

6DODULXOGH
1LYHO ED]ăOHL
1U 
)XQF‫܊‬LD GH *UDGD‫܊‬LD &RHILFLHQW
FUW
VWXGLL
$QXO
 $PEDVDGRU 6  
 0LQLVWUXSOHQLSRWHQ‫܊‬LDU 6  
 0LQLVWUXFRQVLOLHU 6  
 &RQVLOLHUGLSORPDWLFFRQVXOJHQHUDO 6  
 6HFUHWDU,FRQVXO 6  
 6HFUHWDU,,YLFHFRQVXO 6  
 6HFUHWDU,,, 6  
 $WD‫܈‬DWDJHQWFRQVXODU 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 59

b) Salarii de bază pentru funcțiile specifice de execuție


 
6DODULXOGH
1LYHO ED]ăOHL
1U
)XQF‫܊‬LD GH *UDGD‫܊‬LD &RHILFLHQW
FUW
VWXGLL
$QXO

Funcаii de execuаie pe grade profesionale


 &RQVLOLHUUHOD‫܊‬LLLQWHUSUHWUHOD‫܊‬LL,FRQVLOLHU 6  
FDELQHW,
 &RQVLOLHUUHOD‫܊‬LLLQWHUSUHWUHOD‫܊‬LL,,FRQVLOLHU 6  
FDELQHW,,
 &RQVLOLHUUHOD‫܊‬LLLQWHUSUHWUHOD‫܊‬LL,,,FRQVLOLHU 6  
FDELQHW,,,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 6  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,UHIHUHQWFDELQHW
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 66'  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 3/  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,UHIHUHQWFDELQHW
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 0  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 6  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 66'  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 3/  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,,
 5HIHUHQWUHOD‫܊‬LLUHIHUHQWFRPXQLFD‫܊‬LLUHIHUHQW 0  
SURWHF‫܊‬LHFXULHUGLSORPDWLF,,
 &DQFHODULVWUHOD‫܊‬LL, 6  
 &DQFHODULVWUHOD‫܊‬LL, 3/  
 &DQFHODULVWUHOD‫܊‬LL, 0  
 &DQFHODULVWUHOD‫܊‬LL,, 6  
 &DQFHODULVWUHOD‫܊‬LL,, 0  
 &DQFHODULVWUHOD‫܊‬LL,,, 6  
 &DQFHODULVWUHOD‫܊‬LL,,, 0  
 &XULHUUHOD‫܊‬LL, 0  
 &XULHUUHOD‫܊‬LL,, 0  

N O T Ă:
Salariile de bază prevăzute la lit. a) și b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL III răspunderea, complexitatea și importanța socială a funcției


Reglementări specifice personalului încadrat în aparatul exercitate, de specificul activității de promovare a politicii externe
central al Ministerului Afacerilor Externe și de la misiunile a României, de pregătirea și competența profesională a
diplomatice, oficiile consulare și institutele culturale diplomaților, precum și de incompatibilitățile și interdicțiile
românești din străinătate prevăzute pentru diplomați de legislația în vigoare.
Art. 2. — Salariile de bază pentru membrii Corpului
SECȚIUNEA 1
diplomatic și consular al României și pentru personalul care
Salarii de bază îndeplinește funcții de execuție specifice în centrala
Art. 1. — Salarizarea membrilor Corpului diplomatic și Ministerului Afacerilor Externe sunt prevăzute în prezenta
consular al României se face ținându-se seama de rolul, anexă la cap. II.
60 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

Art. 3. — Salariile de bază pentru membrii Corpului d) o indemnizație lunară în valută pentru îndeplinirea
diplomatic și consular al României și personalul care ocupă atribuțiilor de prim-colaborator;
funcții de execuție specifice în administrația centrală a e) o indemnizație lunară în valută pentru soția/soțul
Ministerului Afacerilor Externe și care exercită funcții de aflată/aflat în întreținere permanentă în străinătate;
conducere sunt cele prevăzute în prezenta anexă la cap. I. f) o indemnizație lunară în valută pentru copiii minori aflați în
Art. 4. — (1) Salariile lunare în valută ale personalului trimis întreținere permanentă în străinătate;
în misiune permanentă în străinătate se stabilesc pe funcții, g) o indemnizație lunară în valută pentru plata taxei de
ținându-se seama de rolul, răspunderea și complexitatea școlarizare pentru fiecare copil care urmează forme de
atribuțiilor ce revin fiecărei funcții și avându-se în vedere costul învățământ preuniversitar sau universitar în țara în care își
vieții și condițiile de viață și de muncă din țara în care personalul desfășoară activitatea părintele;
își desfășoară activitatea. h) o indemnizație lunară în valută pentru desfășurarea
(2) Salariul lunar în valută corespunzător fiecărei funcții se activității în străinătate în zone de risc, insecuritate și de conflict
determină prin aplicarea coeficientului de ierarhizare a funcției, armat;
prevăzut în prezenta anexă la cap. V, asupra bazei de calcul i) o indemnizație de reprezentare;
pentru țara respectivă. j) premii în valută pentru rezultate deosebite în activitatea
(3) Valoarea coeficientului de ierarhizare 1,00, reprezentând desfășurată la misiune;
baza de calcul al salariilor și indemnizațiilor în valută în cuantum k) o indemnizație lunară în lei pentru soția/soțul aflată/aflat în
net, pentru fiecare țară în care personalul își desfășoară întreținere în țară;
activitatea, se stabilește prin hotărâre a Guvernului. l) o indemnizație lunară în lei pentru fiecare copil aflat în
întreținere în țară, până la împlinirea vârstei de 18 ani sau până
SECȚIUNEA a 2-a la terminarea studiilor preuniversitare ori universitare, dar nu mai
Sporuri, premii și alte drepturi târziu de împlinirea vârstei de 26 de ani;
Art. 5. — Sporurile la salariile de bază și alte drepturi care m) o indemnizație lunară în lei, pe familie, pentru acoperirea
sunt specifice domeniului sunt prevăzute în prezenta anexă la cheltuielilor de întreținere a locuinței în țară;
cap. IV și cap. VI, care cuprind salariul de bază pentru n) o indemnizație lunară în cuantum de până la 20% din
personalul diplomatic și consular și personalul care ocupă funcții salariul în valută pentru personalul care lucrează în zone izolate
de execuție specifice. sau unde atragerea personalului se face cu greutate;
o) alte drepturi bănești.
SECȚIUNEA a 3-a (2) În sensul prezentei legi, sunt considerați membri de
Angajarea și avansarea în funcții de execuție specifice
familie aflați în întreținere permanentă la misiune în străinătate
soția/soțul și copiii minori care însoțesc personalul trimis în
Art. 6. — Criteriile și condițiile de ocupare a posturilor misiune permanentă cu o durată mai mare de un an la misiunile
vacante, precum și de încadrare și promovare a personalului din diplomatice, oficiile consulare și institutele culturale, precum și
administrația centrală a Ministerului Afacerilor Externe și copiii minori față de care soția/soțul care însoțește titularul are
misiunile diplomatice, oficiile consulare și institutele culturale îndatorirea legală de creștere și educare.
românești din străinătate în funcțiile de execuție specifice
Ministerului Afacerilor Externe se stabilesc prin ordin al SECȚIUNEA a 2-a
ministrului afacerilor externe. Salarii
Art. 7. — Personalul care, la data intrării în vigoare a
prezentei legi, este încadrat în alte funcții decât cele specifice Art. 2. — (1) Salariile lunare în valută ale personalului trimis
Ministerului Afacerilor Externe poate trece, la cerere, pe funcții în misiune permanentă în străinătate se stabilesc pe funcții,
specifice Ministerului Afacerilor Externe, prin transformarea ținându-se seama de rolul, răspunderea și complexitatea
corespunzătoare a posturilor. atribuțiilor ce revin fiecărei funcții și avându-se în vedere costul
vieții și condițiile de viață și de muncă din țara în care personalul
CAPITOLUL IV își desfășoară activitatea.
Salarizarea în valută și alte drepturi în valută și în lei ale (2) Salariul lunar în valută corespunzător fiecărei funcții se
personalului trimis în misiune permanentă în străinătate determină prin aplicarea coeficientului de ierarhizare a funcției,
prevăzut în prezenta anexă la cap. V, asupra bazei de calcul
SECȚIUNEA 1 pentru țara respectivă.
(3) Valoarea coeficientului de ierarhizare 1,00, reprezentând
Dispoziții generale
baza de calcul al salariilor și indemnizațiilor în valută în cuantum
Art. 1. — (1) Personalul trimis în misiune permanentă la net, pentru fiecare țară în care personalul își desfășoară
misiunile diplomatice, la oficiile consulare și la institutele activitatea, se stabilește prin hotărâre a Guvernului.
culturale românești din străinătate de către Ministerul Afacerilor Art. 3. — (1) Salariile și celelalte drepturi lunare în valută ale
Externe, precum și de către celelalte ministere, organe și personalului trimis în misiune permanentă în străinătate se
instituții de specialitate ale administrației publice centrale, acordă în funcție de momentul trecerii frontierei de stat a
denumite în continuare unități trimițătoare, are dreptul, în României, astfel:
condițiile prevăzute de prezenta lege, la: a) din ziua trecerii prin punctul de frontieră la plecarea în
a) salariul lunar în valută; străinătate, dacă aceasta a avut loc înainte de ora 12,00;
b) o indemnizație lunară în valută pentru îndeplinirea funcției b) până în ziua trecerii prin punctul de frontieră la sosirea din
de însărcinat cu afaceri, însărcinat cu afaceri ad interim sau străinătate, dacă aceasta a avut loc după ora 12,00 inclusiv.
gerant interimar ori a unor atribuții, altele decât cele specifice (2) Pe perioada prelungirii călătoriei peste limitele prevăzute
funcției pe care este încadrat; de orarele internaționale de transport sau în afara rutelor
c) o indemnizație lunară în valută pentru șefii de misiune stabilite, personalul este considerat în concediu fără plată sau,
acreditați în mai multe țări; la cererea acestuia, în concediu de odihnă, cu excepția cazurilor
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 61

în care întreruperea, respectiv prelungirea călătoriei are loc din lunar în valută, corespunzător funcției și gradului diplomatic și
cauză de forță majoră. consular pe care este încadrat. Indemnizația de prim-colaborator
(3) Salariile și indemnizațiile lunare în valută cuvenite pentru se acordă numai la reprezentanțele diplomatice unde șeful
o zi se determină prin raportarea drepturilor lunare la numărul de misiunii este acreditat în funcția de ambasador;
zile calendaristice din luna respectivă, iar drepturile totale d) o indemnizație lunară pentru soția/soțul neîncadrată/
cuvenite se întregesc la unitatea valutară dacă depășesc 0,50 și neîncadrat, pe timpul cât aceasta/acesta se află în întreținere
se neglijează dacă sunt sub 0,50 inclusiv. permanentă în străinătate, reprezentând 25% din salariul lunar
(4) Personalul trimis în misiune permanentă în străinătate în valută al soțului/soției, precum și din indemnizația prevăzută
beneficiază la plecarea în misiune de o indemnizație de la lit. a), b), g) și h), acolo unde este cazul;
reprezentare în valută, inclusiv pentru cheltuielile de instalare și e) o indemnizație lunară corespunzătoare coeficientului 0,25
procurarea de efecte personale, al cărei cuantum se situează la din baza de calcul prevăzută pentru țara respectivă, precum și
nivelul unui salariu lunar în valută, pentru acoperirea primelor din indemnizația prevăzută la lit. a), b), g) și h), acolo unde este
cheltuieli cu ocazia prezentării la post a personalului. cazul, pentru fiecare copil minor aflat în întreținere permanentă
(5) Indemnizația prevăzută la alin. (4) se acordă astfel: la misiune, până la împlinirea vârstei de 18 ani sau până la
a) în cuantum integral, la plecarea în misiune cu durata de terminarea cursurilor anului școlar în care copilul împlinește
minimum 12 luni; 18 ani. Indemnizația nu se acordă pentru copiii care repetă anul
b) în cuantum de 50%, la plecarea în misiune cu durata de școlar, cu excepția cazurilor în care repetenția este cauzată de
minimum 6 luni; motive de sănătate, dovedite cu certificat medical;
c) nu se acordă în cazul misiunilor cu durata mai mică de f) o indemnizație lunară în valută pentru plata taxei de
6 luni.
școlarizare pentru fiecare copil până la vârsta de 26 de ani care
În cazul prelungirii misiunii, personalul primește diferența
urmează forme de învățământ preuniversitare sau universitare
până la acoperirea indemnizației prevăzute la lit. a).
în țara unde părintele își desfășoară activitatea, în situația în
(6) Indemnizațiile acordate potrivit alin. (4) se restituie în
care sistemul de învățământ de stat din țara respectivă nu oferă
cazul în care duratele misiunilor sunt mai mici decât cele
în localitatea de reședință instruire în domeniul ales, precum și
prevăzute la alin. (5) din motive imputabile salariaților în cauză.
în situațiile în care unitățile de învățământ de stat percep taxe de
SECȚIUNEA a 3-a școlarizare. Această indemnizație se acordă cu condiția
Indemnizații lunare în valută
promovării anului de studii precedent sau a examenelor din anul
respectiv, pe bază de documente justificative, lunar, trimestrial
Art. 4. — (1) Personalul trimis în misiune permanentă în sau anual, și nu poate depăși 500 euro lunar;
străinătate beneficiază, pe lângă salariile lunare în valută g) o indemnizație lunară în cuantum de 25% din salariul în
stabilite în condițiile prevăzute la art. 2, și de: valută pentru desfășurarea activității în străinătate în zone de
a) o indemnizație lunară pentru îndeplinirea funcției de risc și/sau de conflict armat, acordată numai pe durata existenței
însărcinat cu afaceri, însărcinat cu afaceri ad interim sau gerant situației menționate.
interimar, calculată asupra salariului corespunzător funcției și Zonele de risc și/sau de conflict armat se stabilesc prin ordin
gradului diplomatic și consular pe care este încadrat personalul, al ministrului afacerilor externe. În cazuri justificate, pentru
după cum urmează: anumite zone, nivelul cuantumului poate fi majorat până la 50%
— 5% pentru personalul încadrat pe funcția de ministru- din salariul în valută prin ordin al ministrului afacerilor externe;
consilier sau ministru plenipotențiar sau consul general de h) o indemnizație lunară în cuantum de până la 20% din
carieră; salariul în valută pentru personalul care lucrează în zone izolate
— 10% pentru personalul încadrat pe funcția de consilier sau unde atragerea personalului se face cu greutate.
diplomatic;
Locurile de muncă, categoriile de personal, mărimea
— 15% pentru personalul încadrat pe funcțiile de secretar I,
concretă a indemnizației, precum și condițiile de acordare a
II sau III, consul ori viceconsul.
acesteia se stabilesc prin ordin al ministrului afacerilor externe,
Pentru personalul diplomatic și consular care îndeplinește de
cu consultarea sindicatelor sau, după caz, a reprezentanților
la început funcția de însărcinat cu afaceri, însărcinat cu afaceri
salariaților.
ad interim sau gerant interimar, indemnizația se acordă de la
(2) De drepturile prevăzute la alin. (1) lit. g) și h) beneficiază
data numirii în această funcție, pe toată perioada cât o
și persoanele prevăzute la art. 5 alin. (1).
îndeplinește.
Personalul diplomatic și consular care, în lipsa șefului Art. 5. — (1) Unitățile trimițătoare pot să aprobe ca misiunile
misiunii diplomatice, ambasador sau consul general, diplomatice, oficiile consulare și institutele culturale românești
îndeplinește funcția de însărcinat cu afaceri, însărcinat cu din străinătate să utilizeze, fără afectarea schemei de personal
afaceri ad interim sau gerant interimar beneficiază de aprobate activității de bază și a fondului de salarii al ministerului,
indemnizație pe timpul îndeplinirii acestei funcții, dacă persoane fizice, cetățeni români sau străini, de pe plan local ori
depășește o perioadă de o lună. Indemnizația nu se acordă pe persoane nesalariate din cadrul acestor reprezentanțe, cu
timpul cât șeful misiunii se află în concediu de odihnă sau în respectarea legislației din țara respectivă. Sumele acordate
interes de serviciu în România, în țara de reședință sau în altă pentru activitatea prestată se stabilesc în raport cu nivelul
țară; studiilor, cu munca depusă și cu timpul efectiv lucrat și se
b) o indemnizație lunară pentru șefii de misiune acreditați în plătesc potrivit prevederilor cap. V al prezentei anexe, conform
mai multe state, calculată în cuantum de 10% din salariul lunar metodologiei aprobate prin ordin al ministrului.
în valută, corespunzător funcției și gradului diplomatic și (2) Pe perioada cât soțiile/soții nesalariate/nesalariați
consular pe care sunt încadrați; prestează activități în condițiile alin. (1), personalul nu
c) o indemnizație lunară pentru îndeplinirea atribuțiilor de beneficiază de indemnizațiile prevăzute în prezenta lege pentru
prim-colaborator, calculată în cuantum de 5% asupra salariului soțiile/soții nesalariate/nesalariați.
62 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

(3) În situația în care personalul încadrat la misiuni b) 30 de zile calendaristice, pentru personalul de specialitate
îndeplinește, în afara orelor de program, pe o durată mai mare cu sarcini de gestiune;
de 30 de zile consecutive, și atribuții care revin unor posturi c) 7 zile calendaristice, pentru restul personalului.
vacante din schema reprezentanței respective sau a altei
reprezentanțe din țara de reședință, cu aprobarea conducerii SECȚIUNEA a 6-a
unității trimițătoare, acesta beneficiază de o indemnizație Drepturile personalului pe perioada cât este plecat de la post în
reprezentând 25% din salariul în valută al funcției pe care este interesul serviciului în România, în țara de reședință sau în altă
încadrat. țară străină

SECȚIUNEA a 4-a Art. 8. — Personalul trimis în misiune permanentă în


străinătate beneficiază, pe perioada cât se află în interesul
Indemnizații lunare în lei
serviciului în România, de:
Art. 6. — (1) Personalul trimis în misiune permanentă în a) drepturile prevăzute la art. 1 alin. (1) lit. a);
străinătate beneficiază, pe durata misiunii, pe lângă drepturile b) indemnizațiile în valută pentru soția/soțul și copiii rămași
în valută prevăzute în prezenta anexă, și de următoarele în întreținere permanentă în străinătate, în condițiile prezentei
indemnizații în lei, în țară, astfel: legi.
a) o indemnizație lunară reprezentând 25% din salariul de Art. 9. — (1) Personalul trimis în misiune permanentă în
bază în lei pentru soția/soțul neîncadrată/neîncadrat, pe tot străinătate, precum și persoanele prevăzute la art. 5 alin. (1), în
timpul cât aceasta/acesta se află în întreținere permanentă în măsura în care prin contractele încheiate cu acestea s-a
țară și nu realizează venituri sau indemnizații de orice natură, prevăzut acest lucru, beneficiază, pentru deplasările efectuate în
inclusiv din pensie; interesul serviciului în țara de reședință sau în altă țară străină,
b) o indemnizație lunară la nivelul alocației de stat pentru pe lângă drepturile în valută și în lei prevăzute de prezenta lege,
copii, impozabilă, pentru fiecare copil aflat în întreținere în țară, și de:
până la împlinirea vârstei de 18 ani sau până la terminarea a) cazare, transport și 30% din diurnă, pentru deplasări în
formelor de învățământ preuniversitar ori universitar, dar nu mai țara de reședință;
târziu de împlinirea vârstei de 26 de ani. Indemnizația nu se b) cazare, transport și 50% din diurnă, pentru deplasări în
acordă pentru copiii care repetă anul școlar, cu excepția altă țară străină.
cazurilor în care repetenția este cauzată de motive de sănătate, (2) Cazarea și diurna se acordă în condițiile stabilite prin
dovedite cu certificat medical; prezenta lege pentru personalul care se deplasează temporar în
c) o indemnizație lunară pe familie, pentru acoperirea țările respective, calculate în funcție de categoria de diurnă la
cheltuielilor de întreținere a locuinței deținute în proprietate din care are dreptul, potrivit funcției de încadrare.
țară, în sumă de 500 lei, impozabilă potrivit legii, în situația în (3) Categoriile de diurnă în care se încadrează personalul
care ambii soți se află permanent în străinătate și nu realizează trimis în misiune permanentă în străinătate sunt următoarele:
niciun fel de venituri din chirii. Indemnizația se actualizează a) la categoria a II-a — șefii de misiune;
anual, prin hotărâre a Guvernului. b) la categoria I — restul personalului.
(2) Indemnizațiile prevăzute la alin. (1) lit. a) și c) se acordă Art. 10. — În situația în care, din motive de ordin protocolar,
de la data depunerii declarației scrise date pe propria șeful misiunii diplomatice, al oficiului consular sau al institutului
răspundere. cultural trebuie să se deplaseze în România sau în străinătate,
în interesul serviciului, împreună cu soția/soțul
SECȚIUNEA a 5-a nesalariată/nesalariat, cheltuielile de transport și de cazare
Alte drepturi pe perioada de predare-primire a atribuțiilor pentru aceasta/acesta se decontează în aceleași condiții ca și
Art. 7. — (1) Unitățile trimițătoare sunt obligate ca, în vederea pentru șeful misiunii.
asigurării unei activități continue a reprezentanțelor din SECȚIUNEA a 7-a
străinătate, să ia măsurile necesare ca atribuțiile ce revin
Alte reglementări specifice
personalului existent la post să fie transmise cu maximum de
operativitate personalului care preia aceste atribuții. Art. 11. — Misiunea permanentă în străinătate încetează de
(2) Pe perioada de predare-primire a atribuțiilor, atât drept în cazul suspendării contractului individual de muncă la
personalul care predă, cât și personalul care primește cererea salariatului, pentru creșterea copilului în vârstă de până
beneficiază, pentru el și pentru membrii săi de familie, de la 2 ani sau, în cazul copilului cu handicap, până la împlinirea
drepturi în valută și în lei, după caz, în cuantumul și în condițiile vârstei de 3 ani.
stabilite prin prezenta lege. Art. 12. — Personalul din instituțiile de apărare națională,
(3) În cazul în care ambii soți sunt salariați la aceeași ordine publică și siguranță națională și de comerț exterior trimis
reprezentanță, persoana care nu are obligația de a preda în misiuni permanente sau temporare, potrivit legii, în străinătate
atribuții de serviciu este considerată în concediu fără plată, iar beneficiază de toate drepturile prevăzute în prezenta anexă la
persoana care predă are dreptul la indemnizația în valută pentru cap. IV și V.
soție/soț, precum și la indemnizațiile în valută pentru copiii aflați Art. 13. — În măsura în care prezenta lege nu prevede altfel,
în întreținere în străinătate, în condițiile prezentei legi. dispozițiile sale se completează cu celelalte prevederi din
(4) În vederea ducerii la îndeplinire a obligației prevăzute la cuprinsul actelor normative speciale referitoare la drepturile și
alin. (1), unitățile trimițătoare vor stabili durata maximă de obligațiile ce revin personalului trimis în misiune permanentă în
predare-primire a atribuțiilor, fără a depăși: străinătate de către ministere și celelalte organe și instituții de
a) 10 zile calendaristice, pentru personalul diplomatic; specialitate ale administrației publice centrale.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 63

CAPITOLUL V
Nomenclatorul funcțiilor și coeficienților de ierarhizare pentru determinarea salariilor în valută
pentru personalul trimis în misiune permanentă în străinătate
&RHILFLHQWXO
1U 1LYHOXO
)XQF‫܊‬LDGHvQFDGUDUHODPLVLXQH GH
FUW VWXGLLORU
LHUDUKL]DUH
 $PEDVDGRU‫܈‬HI GH PLVLXQH HPLVDU VSHFLDO SHQWUX ]RQHOH GH FRQIOLFW 6 
DUPDWUHSUH]HQWDQWVSHFLDO6(&, 
 $PEDVDGRUGHFDULHUă 6 
 &RQVXOJHQHUDO‫܈‬HIDOXQXLFRQVXODWJHQHUDOPLQLVWUXSOHQLSRWHQ‫܊‬LDU
)XQF‫܊‬LL GH UHSUH]HQWDQW PLOLWDU SUHYă]XWH FX JUDGXO GH JHQHUDO
ORFRWHQHQWJHQHUDOPDLRU vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOH ‫܈‬L 6 
IXQF‫܊‬LL vQ VWUXFWXUL 1$728(26&(218 SUHYă]XWH FX JUDGXO GH
JHQHUDOORFRWHQHQWJHQHUDOPDLRU‫܈‬HIVHF‫܊‬LXQHDSăUDUH
 0LQLVWUX FRQVLOLHU FRQVXO JHQHUDO GH FDULHUă UHSUH]HQWDQW
GLSORPDWLFRPLOLWDU SH OkQJă RUJDQL]D‫܊‬LLOH LQWHUQD‫܊‬LRQDOH GLUHFWRU
LQVWLWXWFXOWXUDODWD‫܈‬DWDODSăUăULLSULQFLSDOPLOLWDUDHUR‫܈‬LQDYDO 6 
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218SUHYă]XWHFXJUDGXOGHJHQHUDOGHEULJDGă
 &RQVLOLHUGLSORPDWLFFODVD,FRQVLOLHUHFRQRPLFFODVD,DWD‫܈‬DWDSăUDUH
FODVD,DWD‫܈‬DWGHDIDFHULLQWHUQHFODVD,DWD‫܈‬DWSHSUREOHPHGHPXQFă
‫܈‬L VRFLDOH FODVD , ‫܈‬HI ELURX SUHVă FODVD , GLUHFWRU DGMXQFW
6 
LQVWLWXWFXOWXUDO
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218SUHYă]XWHFXJUDGXOGHFRORQHO
 &RQVLOLHU GLSORPDWLF FODVD D ,,D FRQVLOLHU HFRQRPLF FODVD D ,,D
DWD‫܈‬DWDSăUDUHFODVDD,,DDWD‫܈‬DWGHDIDFHULLQWHUQHFODVDD,,DDWD‫܈‬DW
SHSUREOHPHGHPXQFă‫܈‬LVRFLDOHFODVDD,,D‫܈‬HIELURXSUHVăFODVDD
,,DUHSUH]HQWDQWPLOLWDU
6 
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218SUHYă]XWHFXJUDGXOGHORFRWHQHQWFRORQHO
)XQF‫܊‬LLGHSHUVRQDOFLYLOFRQWUDFWXDOD0LQLVWHUXOXL$SăUăULL1D‫܊‬LRQDOH
vQVWUXFWXULGHUHSUH]HQWDUHQD‫܊‬LRQDOHSUHYă]XWHFXVWXGLLVXSHULRDUH
 6HFUHWDU , FODVD , VHFUHWDU HFRQRPLF , FODVD , HFRQRPLVW SULQFLSDO
FODVD,DWD‫܈‬DWDSăUDUHDGMXQFWFODVD,DWD‫܈‬DWGHDIDFHULLQWHUQHDGMXQFW
FODVD , DWD‫܈‬DW SH SUREOHPHGH PXQFă ‫܈‬L VRFLDOH DGMXQFW FODVD ,
6 
FRQVXOFODVD,DWD‫܈‬DWSULQFLSDOFRPXQLFD‫܊‬LLFODVD,
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218SUHYă]XWHFXJUDGXOGHPDLRU
 6HFUHWDU , FODVD D ,,D VHFUHWDU HFRQRPLF , FODVD D ,,D HFRQRPLVW
SULQFLSDO FODVD D ,,D DWD‫܈‬DW DSăUDUH DGMXQFW FODVD D ,,D DWD‫܈‬DW GH
DIDFHUL LQWHUQH DGMXQFW FODVD D ,,D DWD‫܈‬DW SH SUREOHPH GH PXQFă ‫܈‬L
VRFLDOH DGMXQFW FODVD D ,,D FRQVXO FODVD D ,,D DWD‫܈‬DW SULQFLSDO 6 
FRPXQLFD‫܊‬LLFODVDD,,D
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218SUHYă]XWHFXJUDGXOGHFăSLWDQ
 6HFUHWDU ,, FODVD , VHFUHWDU HFRQRPLF ,, FODVD , HFRQRPLVW FODVD ,
YLFHFRQVXOFODVD,‫܈‬HIELURXWXULVPFODVD,DWD‫܈‬DWFRPXQLFD‫܊‬LL, 6 
FODVD,
 6HFUHWDU,,FODVDD,,DVHFUHWDUHFRQRPLF,,FODVDD,,DFRUHVSRQGHQW
GH SUHVă FODVD , HFRQRPLVW FODVD D ,,D ‫܈‬HI VHUYLFLX DGPLQLVWUDWLY
FODVD,YLFHFRQVXOFODVDD,,DDWD‫܈‬DWFRPXQLFD‫܊‬LL,FODVDD,,D
6 
)XQF‫܊‬LL PLOLWDUH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă ‫܈‬L vQ VWUXFWXUL
1$728(26&(218 SUHYă]XWH FX JUDGXO GH
VXEORFRWHQHQWORFRWHQHQW
 6HFUHWDU,,,FODVD,VHFUHWDUHFRQRPLF,,,FODVD,VHFUHWDUPLOLWDU‫܈‬HI
VHUYLFLX DGPLQLVWUDWLY FODVD D ,,D FRQVLOLHU UHOD‫܊‬LL FODVD , UHIHUHQW
SULQFLSDOUHOD‫܊‬LLFODVD,‫܈‬HIELURXWXULVPFODVDD,,DFRUHVSRQGHQWGH 6 
SUHVă FODVD D ,,D DWD‫܈‬DW FRPXQLFD‫܊‬LL ,, FODVD , GRFXPHQWDULVW vQ
VHF‫܊‬LXQHDDSăUDUH
64 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

 6HFUHWDU ,,, FODVD D ,,D VHFUHWDU HFRQRPLF ,,, FODVD D ,,D FRQVLOLHU
UHOD‫܊‬LL FODVD D ,,D UHIHUHQW SULQFLSDO UHOD‫܊‬LL FODVD D ,,D DWD‫܈‬DW 6 
FRPXQLFD‫܊‬LL,,FODVDD,,D
 $WD‫܈‬DW FODVD , UHIHUHQW UHOD‫܊‬LL FODVD , ELEOLRWHFDU SULQFLSDO DJHQW
FRQVXODUFODVD,DWD‫܈‬DWFRPXQLFD‫܊‬LL,,,FODVD,DWD‫܈‬DWSHSUREOHPHGH 6 
PXQFă‫܈‬LVRFLDOHDGMXQFWFODVD,UHIHUHQWSULQFLSDOSURWHF‫܊‬LHFODVD,
 $WD‫܈‬DWFODVDD,,DDJHQWFRQVXODUFODVDD,,DUHIHUHQWUHOD‫܊‬LLFODVDD
,,DDWD‫܈‬DWFRPXQLFD‫܊‬LL,,,FODVDD,,DDWD‫܈‬DWSHSUREOHPHGHPXQFă‫܈‬L 6 
VRFLDOHDGMXQFWFODVDD,,DUHIHUHQWSULQFLSDOSURWHF‫܊‬LHFODVDD,,D
 ‫܇‬HIELURXDGPLQLVWUDWLYUHIHUHQWSULQFLSDOGHVSHFLDOLWDWH
)XQF‫܊‬LL vQ FDGUXO VWUXFWXULORU GH UHSUH]HQWDUH QD‫܊‬LRQDOă VDX D
VWUXFWXULORU1$728(26&(218SUHYă]XWHFXJUDGXOGHSOXWRQLHU
PDMRUSOXWRQLHU DGMXWDQW SULQFLSDOPDLVWUX PLOLWDU FODVD D ,,D  
0 
PDLVWUXPLOLWDUSULQFLSDO
)XQF‫܊‬LL GH SHUVRQDO FLYLO FRQWUDFWXDO DO 0LQLVWHUXOXL $SăUăULL
1D‫܊‬LRQDOH vQ VWUXFWXUL GH UHSUH]HQWDUH QD‫܊‬LRQDOă SUHYă]XWH FX VWXGLL
PHGLL
 &RQWDELOSULQFLSDOUHIHUHQWWUDQVPLWHUHIXQF‫܊‬LRQDUFRQVXODUSULQFLSDO
)XQF‫܊‬LL vQ FDGUXO VWUXFWXULORU GH UHSUH]HQWDUH QD‫܊‬LRQDOă VDX D
0 
VWUXFWXULORU 1$728(26&(218 SUHYă]XWH FX JUDGXO GH VHUJHQW
SOXWRQLHUPDLVWUXPLOLWDUFODVDD9DPDLVWUXPLOLWDUFODVDD,,,D
 &RQWDELOFDQFHODULVWELEOLRWHFDUIXQF‫܊‬LRQDUFRQVXODU 0 
6HFUHWDUGDFWLORJUDISULQFLSDOUHIHUHQWGHVSHFLDOLWDWH,UHIHUHQW
 0 
SURWHF‫܊‬LH,
 ,QWHQGHQW,UHIHUHQWGHVSHFLDOLWDWH,,UHIHUHQWSURWHF‫܊‬LH,, 0 
 6HFUHWDUGDFWLORJUDIUHIHUHQWUHOD‫܊‬LL,,LQWHQGHQW,, 0* 
 ‫܇‬RIHU,PXQFLWRUFDOLILFDW, 0* 
 ‫܇‬RIHU,,PXQFLWRUFDOLILFDW,,
)XQF‫܊‬LL GH VROGD‫܊‬L ‫܈‬L JUDGD‫܊‬L YROXQWDUL vQ FDGUXO VWUXFWXULORU GH * 
UHSUH]HQWDUHQD‫܊‬LRQDOăVDXDVWUXFWXULORU1$728(26&(218
 3RUWDU * 
 ÌQJULMLWRU * 
N O T Ă:
1. La trimiterea în misiune, încadrarea în clasa I a funcției se face în cazul personalului care a mai fost trimis minimum
un an în misiune permanentă în străinătate în aceeași funcție sau într-o funcție ierarhizată cel puțin cu același coeficient de
ierarhizare. Începând cu data intrării în vigoare a prezentei legi, pentru personalul aflat în misiune care este trecut în altă funcție
încadrarea pe noua funcție se face la clasa a II-a.
Trecerea personalului la clasa I se face cu respectarea acelorași condiții de vechime.
2. La misiunile unde nu se justifică utilizarea unor funcții distincte, acestea pot fi comasate. Salariul funcției de încadrare a
persoanei numite se va stabili ținându-se seama de sarcinile preponderente, de pregătirea profesională și de vechimea în specialitate.
3. Funcțiile și asimilarea acestora sau coeficienții de ierarhizare a funcțiilor, altele decât cele prevăzute în prezenta anexă,
specifice unor ministere, altor organe și instituții de specialitate ale administrației publice centrale, se stabilesc prin hotărâre a Guvernului.

CAPITOLUL VI buletinele de determinare sau, după caz, expertizare, emise de


Sporuri, premii și alte drepturi către autoritățile abilitate în acest sens.
Art. 3. — Membrii Corpului diplomatic și consular al României
Art. 1. — (1) Membrii Corpului diplomatic și consular al
României beneficiază de o indemnizație de până la 15% pot fi numiți temporar într-o funcție de conducere vacantă sau
calculată asupra salariului de bază corespunzător funcției de numai până la ocuparea acesteia, prin concurs, potrivit legii.
încadrare, pentru cifrul de stat. Art. 4. — Persoanele numite în funcții de conducere în
(2) Membrii Corpului diplomatic și consular al României centrala Ministerului Afacerilor Externe își păstrează salariul de
beneficiază de indemnizația prevăzută la alin. (1) de la data încadrare și celelalte drepturi corespunzătoare funcțiilor de
acordării autorizației de acces la informații clasificate, eliberată execuție pe care le dețin, dacă acestea sunt mai favorabile.
în condițiile legii. Art. 5. — Celelalte categorii de personal angajate în
Art. 2. — (1) Pentru condiții de muncă grele, vătămătoare Ministerul Afacerilor Externe, Ministerul pentru Românii de
sau periculoase, se acordă un spor de până la 15% din salariul Pretutindeni și instituțiile subordonate acestuia, personalul
de bază corespunzător funcției de încadrare, proporțional cu încadrat pe funcții specifice Ministerului Afacerilor Externe, din
timpul efectiv lucrat în aceste condiții. cadrul Institutului Diplomatic Român, precum și personalul
(2) Locurile de muncă, categoriile de personal, condițiile de încadrat pe funcții și grade diplomatice din administrația centrală
acordare a sporului prevăzut la alin. (1) se aprobă de a Ministerului Economiei beneficiază de toate drepturile bănești
ordonatorul principal de credite, în limita prevederilor din și obligațiile prevăzute pentru membrii Corpului diplomatic și
regulamentul elaborat potrivit prezentei legi, având la bază consular al României.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 65

CAPITOLUL VII
INSTITUTUL CULTURAL ROMÂN
A. Salarii de bază pentru personalul care ocupă și exercită funcții de conducere în cadrul Institutului Cultural Român

1U 1LYHOXO 6DODULXOGHED]ăOHL


)XQF‫܊‬LD &RHILFLHQW
FUW VWXGLLORU
$QXO
 6HFUHWDUJHQHUDO 6  
 6HFUHWDUJHQHUDODGMXQFW 6  
 'LUHFWRUJHQHUDO 6  
 'LUHFWRU 6  
 ‫܇‬HIVHUYLFLX 6  
 ‫܇‬HIELURX 6  
N O T Ă:
Salariile de bază cuprind și sporul de vechime în muncă la nivel maxim.

B. Salariile de bază pentru personalul care ocupă și exercită funcții de execuție în cadrul Institutului Cultural Român

6DODULXOGHED]ă±OHL
1U 1LYHOXO
)XQF‫܊‬LD *UDGD‫܊‬LD &RHILFLHQW
FUW VWXGLLORU
$QXO
 $XGLWRU
6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
 &RQVLOLHUMXULGLF
6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 &RQVLOLHUH[SHUW
6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 5HGDFWRU
6  
JUDGXO,$
JUDGXO, 6  
JUDGXO,, 6  
GHEXWDQW 6  
 5HIHUHQW
66'  
JUDGXO,$
JUDGXO, 66'  
JUDGXO,, 66'  
GHEXWDQW 66'  
 $UKLYLVW
66'  
JUDGXO,$
JUDGXO, 66'  
JUDGXO,, 66'  
GHEXWDQW 66'  
 5HIHUHQW
0  
WUHDSWD,$
WUHDSWD, 0  
WUHDSWD,, 0  
GHEXWDQW 0  
N O T Ă:
Salariile de bază sunt pentru gradația 0. Salariile de bază pentru gradația 1—5 se determină prin majorarea salariilor de
bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
ANEXA Nr. V
FAMILIA OCUPAȚIONALĂ DE FUNCȚII BUGETARE „JUSTIȚIE” ȘI CURTEA CONSTITUȚIONALĂ
66
CAPITOLUL I
Indemnizația de încadrare pentru judecători, procurori, magistrați-asistenți
A. Indemnizația de încadrare pentru judecători și magistrați-asistenți


,QGHPQL]D‫܊‬LDOXQDUăOHL*UDGD‫܊‬LD
$QXO
     
1U 9HFKLPHD
)XQF‫܊‬LD
FUW vQIXQF‫܊‬LH
,QGHPQL]DWLD ,QGHPQL]DWLD ,QGHPQL]DWLD ,QGHPQL]DWLD ,QGHPQL]DWLD ,QGHPQL]DWLD
&RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW
OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL

-XGHFăWRU 3HVWH
           
 FXJUDGGH DQL
,&&- DQL            
3HVWH
           
-XGHFăWRU DQL
FXJUDGGH DQL            

FXUWHGH
DQL            
DSHO
DQL            
-XGHFăWRU 3HVWH
           
FXJUDGGH DQL
WULEXQDO DQL            
 MXGHFăWRU
PLOLWDUOD DQL            
WULEXQDOXO
PLOLWDU DQL            
3HVWH
           
DQL
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

-XGHFăWRU
 FXJUDGGH DQL            
MXGHFăWRULH
DQL            
DQL            

DQL            

%D]D
           
DQL
-XGHFăWRU %D]D
 VWDJLDU            
DQL
$XGLWRUGH
 DQXO,            
MXVWL‫܊‬LH
$XGLWRUGH
 DQXO,,            
MXVWL‫܊‬LH

1RWă

N O T Ă:
1. Prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în funcția de judecător, procuror, personal asimilat acestora, magistrat-asistent
sau auditor de justiție.
2. Promovarea judecătorilor, a personalului asimilat acestora și a magistraților-asistenți se face doar prin examen sau concurs, în condițiile Legii nr. 303/2004 privind
statutul judecătorilor și procurorilor, republicată, cu modificările și completările ulterioare.
3. Indemnizația de încadrare/coeficientul cuprinde sporul de vechime în muncă corespunzător gradației.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
67
B. Indemnizația de încadrare pentru procurori

68

,QGHPQL]D‫܊‬LDOXQDUăOHL*UDGD‫܊‬LD
$QXO
     
1U 9HFKLPHD
)XQF‫܊‬LD
FUW vQIXQF‫܊‬LH
,QGHPQL]D‫܊‬LD ,QGHPQL]D‫܊‬LD ,QGHPQL]D‫܊‬LD ,QGHPQL]D‫܊‬LD ,QGHPQL]D‫܊‬LD ,QGHPQL]D‫܊‬LD
&RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW &RHILFLHQW
OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL OXQDUăOHL

3HVWH
 
DQL          

DQL    
       
3URFXURU 
 FXJUDGGH 
3,&&- DQL      
     


DQL        
   

3HVWH
 
3URFXURU DQL          
FXJUDGGH DQL    
FXUWHGH  
 DQL      
DSHO  
 
 DQL        
   

MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
3HVWH
 
3URFXURU DQL          
FXJUDGGH
WULEXQDO DQL    
       
 MXGHFăWRU
PLOLWDUOD DQL      
WULEXQDOXO      
PLOLWDU
DQL        
   
3HVWH  
DQL            
   
DQL
           
     
3URFXURU DQL
           
 FXJUDGGH
MXGHFăWRULH DQL        
           

DQL          
 
%D]D
           
DQL
3URFXURU %D]D
 VWDJLDU            
DQL

NOTĂ:
1. Prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în funcția de judecător, procuror, personal asimilat acestora, magistrat-asistent sau
auditor de justiție.
2. Promovarea procurorilor, a personalului asimilat acestora și a magistraților-asistenți se face doar prin examen sau concurs, în condițiile Legii nr. 303/2004
privind statutul judecătorilor și procurorilor, republicată, cu modificările și completările ulterioare.
3. Indemnizația de încadrare/coeficientul cuprinde sporul de vechime în muncă corespunzător gradației.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
69
70 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II
Salarii de bază pentru personalul auxiliar de specialitate din cadrul instanțelor și parchetelor

6DODULXOGH
1U 1LYHOXO 9HFKLPHDvQ ED]ăOHL
)XQF‫܊‬LD &RHILFLHQW 
FUW VWXGLLORU IXQF‫܊‬LH

3ULPJUHILHUJUHILHU‫܈‬HIVHF‫܊‬LH
 JUHILHU‫܈‬HIJUHILHU‫܈‬HIFDELQHW 6  

GLUHFWRUGHSDUWDPHQWLQIRUPDWLF
*UHILHU‫܈‬HIVHUYLFLXGLUHFWRU
 DGMXQFWGHSDUWDPHQWLQIRUPDWLF 6  

JUHILHUDUKLYDU‫܈‬HI
‫܇‬HIVHUYLFLXGHSDUWDPHQW
 6  
LQIRUPDWLF 
 ,QIRUPDWLFLDQ‫܈‬HI 6  
3ULPJUHILHUJUHILHU‫܈‬HIVHF‫܊‬LH
 0  
JUHILHU‫܈‬HIJUHILHUDUKLYDU‫܈‬HI 
*UHILHU‫܈‬HIVHUYLFLXJUHILHU‫܈‬HI
 0  
FDELQHW 
6 3HVWHDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU 6 DQL  
GRFXPHQWDULVWJUHILHUDUKLYDU
 6 DQL  
JUHILHUUHJLVWUDWRUVSHFLDOLVW,7
JUDGXO, 6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU 6 DQL  
GRFXPHQWDULVWJUHILHUDUKLYDU
 6 DQL  
JUHILHUUHJLVWUDWRUVSHFLDOLVW,7
JUDGXO,, 6 DQL  
6 %D]DDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU
GRFXPHQWDULVWJUHILHUDUKLYDU
 6 %D]DDQL  
JUHILHU±UHJLVWUDWRUVSHFLDOLVW,7
GHEXWDQW
0 3HVWHDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU 0 DQL  
GRFXPHQWDULVWJUHILHUDUKLYDU
 0 DQL  
JUHILHUUHJLVWUDWRU
WUHDSWD, 0 DQL  
0 %D]DDQL  
0 3HVWHDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU 0 DQL  
GRFXPHQWDULVWJUHILHUDUKLYDU
 0 DQL  
JUHILHUUHJLVWUDWRU
WUHDSWD,, 0 DQL  
0 %D]DDQL  
*UHILHUJUHILHUVWDWLVWLFLDQJUHILHU
GRFXPHQWDULVWJUHILHUDUKLYDU
 0 %D]DDQL  
JUHILHUUHJLVWUDWRU
GHEXWDQW
0 3HVWHDQL  
0 DQL  
7HKQLFLDQFULPLQDOLVWGLQFDGUXO
 0 DQL  
SDUFKHWHORU
0 DQL  
0 %D]DDQL  
 7HKQLFLDQFULPLQDOLVWGHEXWDQW 0 %D]DDQL  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 71

N O T Ă:

1. Prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în funcții auxiliare de specialitate din cadrul
instanțelor judecătorești și parchetelor.
2. Salariile de bază prevăzute la pozițiile 1—6 cuprind sporul de vechime în muncă la nivel maxim.
3. Pentru funcțiile de la pozițiile 7—14 sunt prevăzute salariile de bază la gradația 0. Salariile de bază pentru gradațiile 1—5
se determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL III
Salarii de bază pentru personalul conex din cadrul instanțelor judecătorești și parchetelor


6DODULXOGH
1U 1LYHOXO 9HFKLPHD ED]ăOHL
)XQF‫܊‬LD &RHILFLHQW 
FUW VWXGLLORU vQIXQF‫܊‬LH *UDGD‫܊‬LD
$QXO
0 3HVWHDQL  
$JHQW 0 DQL  
 SURFHGXUDO 0 DQL  
‫܈‬RIHU 0 DQL  
0 %D]DDQL  
0 3HVWHDQL  
0 DQL  
 $SURG 0 DQL  
0 DQL  
0 %D]DDQL  


N O T Ă:

1. Prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în funcții de personal conex în cadrul
instanțelor judecătorești și parchetelor.
2. Salariile de bază prevăzute în prezentul capitol sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se
determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
72 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL IV
Salarii de bază pentru personalul de instruire fără specialitate juridică și pentru funcțiile auxiliare
din cadrul Institutului Național al Magistraturii și al Școlii Naționale de Grefieri


6DODULXOGH
1U 1LYHOXO 9HFKLPHDvQ ED]ăOHL
)XQF‫܊‬LD &RHILFLHQW  
FUW VWXGLLORU IXQF‫܊‬LH *UDGD‫܊‬LD
$QXO
6 3HVWHDQL  
6 DQL  
 3URIHVRUJUDGXO, 6 DQL  
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
 3URIHVRUJUDGXO,, 6 DQL  
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
 ([SHUWJUDGXO, 6 DQL  
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
 6HFUHWDUJUDGXO, 6 DQL  
6 DQL   
6 %D]DDQL   

N O T Ă:
1. În funcțiile de profesor gradul I și gradul II pot fi numite numai cadre didactice care au titlul de profesor universitar și,
respectiv, de conferențiar universitar.
2. Salariile de bază prevăzute în prezentul capitol sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se
determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 73

CAPITOLUL V
Salarii de bază pentru personalul de specialitate criminalistică și funcțiile auxiliare de specialitate criminalistică din
cadrul Institutului Național de Expertize Criminalistice și al laboratoarelor de expertiză criminalistică

6DODULXO
1U 1LYHOXO 9HFKLPHDvQ GHED]ă
)XQF‫܊‬LD &RHILFLHQW 
FUW VWXGLLORU IXQF‫܊‬LH OHL
$QXO
'LUHFWRU,QVWLWXWXO1D‫܊‬LRQDOGH
 6  
([SHUWL]H&ULPLQDOLVWLFH  
'LUHFWRUDGMXQFW,QVWLWXWXO1D‫܊‬LRQDOGH
 6  
([SHUWL]H&ULPLQDOLVWLFH  
‫܇‬HIODERUDWRULQWHUMXGH‫܊‬HDQH[SHUWL]H
 6  
FULPLQDOLVWLFH‫܈‬HIVHFWRU  
6 3HVWHDQL  
6 DQL  
([SHUWFULPLQDOLVWJUDGXO,
 6 DQL  
DQLYHFKLPHvQVSHFLDOLWDWH 
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
([SHUWFULPLQDOLVWJUDGXO,,
 6 DQL  
DQLYHFKLPHvQVSHFLDOLWDWH 
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
([SHUWFULPLQDOLVWJUDGXO,,,
 6 DQL  
DQLYHFKLPHvQVSHFLDOLWDWH 
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
([SHUWFULPLQDOLVWJUDGXO,9
 6 DQL  
DQYHFKLPHvQVSHFLDOLWDWH 
6 DQL  
6 %D]DDQL  
 $VLVWHQWFULPLQDOLVW 6 %D]DDQL  
0 3HVWHDQL  
0 DQL  
 7HKQLFLDQFULPLQDOLVW 0 DQL  
0 DQL  
0 %D]DDQL  
 7HKQLFLDQFULPLQDOLVWGHEXWDQW 0 %D]DDQL  
0 3HVWHDQL  
6HFUHWDU±GDFWLORJUDIODERUDWRU
0 DQL  
H[SHUWL]HFULPLQDOLVWLFH
 0 DQL  
DQYHFKLPHvQIXQF‫܊‬LLDX[LOLDUH
0 DQL  
MXULGLFHHFRQRPLFHVDXDGPLQLVWUDWLYH 
0 %D]DDQL  
6HFUHWDU±GDFWLORJUDIODERUDWRU
 0 %D]DDQL  
H[SHUWL]HFULPLQDOLVWLFHGHEXWDQW 
74 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

N O T Ă:
1. Pentru pozițiile 4—10, prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în funcții de
specialitate criminalistică și în funcții auxiliare de specialitate criminalistică.
2. Salariile de bază prevăzute la pozițiile 1—3 cuprind sporul de vechime în muncă la nivel maxim.
3. Pentru funcțiile de la pozițiile 4—12 sunt prevăzute salariile de bază la gradația 0. Salariile de bază pentru gradațiile
1—5 se determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

CAPITOLUL VI
Salarii de bază pentru personalul cu funcții de conducere și de execuție din cadrul Oficiului Național al Registrului
Comerțului și al oficiilor registrului comerțului de pe lângă tribunale
a) Funcții de conducere

D )XQF‫܊‬LLGHFRQGXFHUH
215&
1U 1LYHOXO
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULLOHGHED]ăOHL &RHILFLHQW
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 'LUHFWRUJHQHUDO215& 6    
'LUHFWRUJHQHUDO
 6    
DGMXQFW215& 
 'LUHFWRU 6    
 'LUHFWRUDGMXQFW 6    
 ‫܇‬HIVHUYLFLX 6    
 ‫܇‬HIELURX 6    
1RWă

N O T Ă:

Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 75

b) Funcții de execuție

6DODULXO
GHED]ă
1U 1LYHOXO 9HFKLPHDvQ OHL &RHILFLHQW  
)XQF‫܊‬LD
FUW VWXGLLORU IXQF‫܊‬LH *UDGD‫܊‬LD
$QXO
5HJLVWUDWRUGHUHJLVWUXO 6 3HVWHDQL  
FRPHU‫܊‬XOXLFRQVLOLHU 6 DQL  
 MXULGLFVSHFLDOLVW,$ 6 DQL  
SHVWHDQL
YHFKLPHvQVSHFLDOLWDWH  6 DQL  
5HJLVWUDWRUGHUHJLVWUXO 6 3HVWHDQL  
FRPHU‫܊‬XOXLFRQVLOLHU 6 DQL  
 MXULGLFVSHFLDOLVW, 6 DQL  
vQWUH‫܈‬LDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 %D]DDQL  
5HJLVWUDWRUGHUHJLVWUXO 6 3HVWHDQL  
FRPHU‫܊‬XOXLFRQVLOLHU 6 DQL  
 MXULGLFVSHFLDOLVW,, 6 DQL  
vQWUH‫܈‬LDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 %D]DDQL  
5HJLVWUDWRUGHUHJLVWUXO
FRPHUWXOXLFRQVLOLHU
 MXULGLFVSHFLDOLVWGHEXWDQW 6 %D]DDQL  
 
LQWUHDQYHFKLPHvQ
VSHFLDOLWDWH 
6SHFLDOLVW,7 6 3HVWHDQL  
,QVSHFWRUVSHFLDOLVW 6 DQL  
$XGLWRUGHUHJLVWUX 6 DQL  

H[SHUWVSHFLDOLVW,$
6 DQL  
SHVWHDQLYHFKLPHvQ
VSHFLDOLWDWH  6 ED]DDQL  
6SHFLDOLVW,7 6 3HVWHDQL  
,QVSHFWRUVSHFLDOLVW 6 DQL  
$XGLWRUGHUHJLVWUX
 6 DQL  
H[SHUWVSHFLDOLVW,
vQWUH‫܈‬LDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 ED]DDQL  
6SHFLDOLVW,7 6 3HVWHDQL  
,QVSHFWRUVSHFLDOLVW 6 DQL  
$XGLWRUGHUHJLVWUX 6 DQL  

H[SHUWVSHFLDOLVW,,
6 DQL  
vQWUH‫܈‬LDQL
YHFKLPHvQVSHFLDOLWDWH  6 ED]DDQL  
6SHFLDOLVW,7
,QVSHFWRUVSHFLDOLVW
$XGLWRUGHUHJLVWUX
 H[SHUWVSHFLDOLVW 6 ED]DDQL  
 
GHEXWDQW
vQWUH‫܈‬LDQ
YHFKLPHvQVSHFLDOLWDWH 
6 3HVWHDQL  
5HIHUHQWVSHFLDOLVW,$ 6 DQL  
 SHVWHDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 DQL  
6 ED]DDQL  
76 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

6 3HVWHDQL  


5HIHUHQWVSHFLDOLVW, 6 DQL  
 vQWUH‫܈‬LDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 DQL  
6 ED]DDQL  
6 3HVWHDQL  
5HIHUHQWVSHFLDOLVW,, 6 DQL  
 vQWUH‫܈‬LDQL 6 DQL  
YHFKLPHvQVSHFLDOLWDWH  6 DQL  
6 ED]DDQL  
5HIHUHQWVSHFLDOLVW
GHEXWDQW
 6 ED]DDQL  
vQWUH‫܈‬LDQ  
YHFKLPHvQVSHFLDOLWDWH 
66' 3HVWHDQL  
5HIHUHQW,QIRUPDWLFLDQ 66' DQL  
,$
 66' DQL  
SHVWHDQL
YHFKLPHvQVSHFLDOLWDWH  66' DQL  
66' ED]DDQL  
66' 3HVWHDQL  
5HIHUHQW,QIRUPDWLFLDQ, 66' DQL  
 vQWUH‫܈‬LDQL 66' DQL  
YHFKLPHvQVSHFLDOLWDWH  66' DQL  
66' ED]DDQL  
66' 3HVWHDQL  
5HIHUHQW,QIRUPDWLFLDQ,, 66' DQL  
 vQWUH‫܈‬LDQL 66' DQL  
YHFKLPHvQVSHFLDOLWDWH  66' DQL  
66' ED]DDQL  
5HIHUHQW,QIRUPDWLFLDQ
GHEXWDQW
 66' ED]DDQL  
vQWUH‫܈‬LDQ  
YHFKLPHvQVSHFLDOLWDWH 
0 3HVWHDQL  
5HIHUHQWDVLVWHQW,$ 0 DQL  
 SHVWHDQL 0 DQL  
YHFKLPHvQVSHFLDOLWDWH  0 DQL  
0 ED]DDQL  
0 3HVWHDQL  
5HIHUHQWDVLVWHQW, 0 DQL  
 vQWUH‫܈‬LDQL 0 DQL  
YHFKLPHvQVSHFLDOLWDWH  0 DQL  
0 ED]DDQL  
0 3HVWHDQL  
5HIHUHQWDVLVWHQW,, 0 DQL  
 vQWUH‫܈‬LDQL 0 DQL  
YHFKLPHvQVSHFLDOLWDWH  0 DQL  
0 ED]DDQL  
5HIHUHQWDVLVWHQWGHEXWDQW
 vQWUH‫܈‬LDQ 0 ED]DDQL  
 
YHFKLPHvQVSHFLDOLWDWH 
1 ă

N O T Ă:
Salariile de bază prevăzute la lit. b) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 77

CAPITOLUL VII
Salarii de bază pentru personalul de probațiune


6DODULXO
GHED]ă
1U 1LYHOXO 9HFKLPHDvQ
)XQF‫܊‬LD OHL &RHILFLHQW
FUW VWXGLLORU IXQF‫܊‬LH
$QXO
 
'LUHFWRUJHQHUDODO'LUHF‫܊‬LHL
 6  
1D‫܊‬LRQDOHGH3URED‫܊‬LXQH   
'LUHFWRUJHQHUDODGMXQFWDO'LUHF‫܊‬LHL
 6  
1D‫܊‬LRQDOHGH3URED‫܊‬LXQH   
‫܇‬HIVHUYLFLXvQFDGUXO'LUHF‫܊‬LHL
 6  
1D‫܊‬LRQDOHGH3URED‫܊‬LXQH   
‫܇‬HIELURXvQFDGUXO'LUHF‫܊‬LHL
 6  
1D‫܊‬LRQDOHGH3URED‫܊‬LXQH   
 ‫܇‬HIVHUYLFLXGHSURED‫܊‬LXQHORFDO 6  
 ‫܇‬HIELURXGHSURED‫܊‬LXQHORFDO 6  
6 3HVWHDQL  
6 DQL  
 ,QVSHFWRUGHSURED‫܊‬LXQHJUDGXO,
6 DQL  
6 DQL  
6 3HVWHDQL  
6 DQL  
 ,QVSHFWRUGHSURED‫܊‬LXQHJUDGXO,, 6 DQL  
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
&RQVLOLHUGHSURED‫܊‬LXQHJUDGXO, 6 DQL  

 6 DQL  
6 DQL  
6 3HVWHDQL  
6 DQL  
 &RQVLOLHUGHSURED‫܊‬LXQHJUDGXO,, 6 DQL  
6 DQL  
6 %D]DDQL  
6 3HVWHDQL  
6 DQL  
 &RQVLOLHUGHSURED‫܊‬LXQHJUDGXO,,, 6 DQL  
6 DQL  
6 %D]DDQL  
 &RQVLOLHUGHSURED‫܊‬LXQHGHEXWDQW 6 %D]DDQL  
1RWă

N O T Ă:
1. Prin „vechime în funcție”, în sensul prezentului capitol, se înțelege vechimea în probațiune.
2. Salariile de bază prevăzute la pozițiile 1—6 cuprind sporul de vechime în muncă la nivel maxim.
3. Pentru funcțiile de la pozițiile 7—12, sunt prevăzute salariile de bază la gradația 0. Salariile de bază pentru gradațiile
1—5 se determină prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.
78 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL VIII participarea personalului din cadrul fiecărei categorii la buna


Reglementări specifice personalului din sistemul justiției funcționare a sistemului judiciar, de răspunderea, complexitatea,
riscurile fiecărei funcții, de obligația de păstrare a
SECȚIUNEA 1 confidențialității, de pregătirea profesională, de interdicțiile
prevăzute de lege pentru aceste categorii de personal și de
Dispoziții comune exigențele prevăzute de documentele internaționale privind
Art. 1. — Dispozițiile prezentului capitol reglementează funcționarea eficientă a sistemului judiciar și statutul
salarizarea și celelalte drepturi salariale ale: magistraților.
a) judecătorilor de la Înalta Curte de Casație și Justiție, de la (2) Salarizarea judecătorilor și procurorilor trebuie să le
curțile de apel, tribunale, tribunalele specializate și judecătorii, asigure o reală independență economică, condiție necesară
procurorilor de la parchetele de pe lângă aceste instanțe, pentru protecția acestora împotriva oricărei atingeri aduse
judecătorilor militari și procurorilor militari de la instanțele și independenței și imparțialității lor în înfăptuirea actului de justiție.
parchetele militare, ale inspectorilor judiciari, membrilor Art. 4. — (1) Pentru condiții de muncă grele, vătămătoare
Consiliului Superior al Magistraturii, ale personalului de sau periculoase, personalul prevăzut la art. 1 beneficiază de un
specialitate juridică asimilat magistraților potrivit Legii spor de până la 15% din salariul de bază sau, după caz, din
nr. 303/2004 privind statutul judecătorilor și procurorilor, indemnizația de încadrare, corespunzător timpului lucrat.
republicată, cu modificările și completările ulterioare, ale (2) Condițiile de acordare a sporului prevăzut la alin. (1) se
auditorilor de justiție, precum și ale magistraților-asistenți de la aprobă de ordonatorul principal de credite în limita prevederilor
Înalta Curte de Casație și Justiție; din regulamentul elaborat potrivit prezentei legi, având la bază
b) asistenților judiciari; buletinele de determinare sau, după caz, expertizare, emise de
c) personalului auxiliar de specialitate și personalului conex către autoritățile abilitate în acest sens.
din cadrul instanțelor judecătorești și al parchetelor de pe lângă Art. 5. — Judecătorii de la Înalta Curte de Casație și Justiție,
acestea; de la curțile de apel, tribunale, tribunalele specializate și
d) personalului de instruire, precum și ale personalului care judecătorii, procurorii de la parchetele de pe lângă aceste
ocupă funcții auxiliare din cadrul Institutului Național al instanțe, membrii Consiliului Superior al Magistraturii, personal
Magistraturii și al Școlii Naționale de Grefieri, personalului de de specialitate juridică asimilat magistraților, magistrații-asistenți
specialitate criminalistică și personalului auxiliar de specialitate de la Înalta Curte de Casație și Justiție, asistenții judiciari,
inspectorii judiciari, personalul auxiliar de specialitate, personalul
criminalistică din cadrul Institutului Național de Expertize
de specialitate criminalistică și personalul auxiliar de specialitate
Criminalistice și al laboratoarelor de expertize criminalistice;
criminalistică din cadrul Institutului National de Expertize
e) specialiștilor din cadrul Parchetului de pe lângă Înalta Criminalistice și al laboratoarelor de expertize criminalistice,
Curte de Casație și Justiție, inclusiv al Direcției Naționale ofițerii și agenții de poliție judiciară, precum și specialiștii din
Anticorupție, Direcției de Investigare a Infracțiunilor de cadrul Direcției Naționale Anticorupție, Direcției de Investigare a
Criminalitate Organizată și Terorism și al celorlalte parchete, Infracțiunilor de Criminalitate Organizată și Terorism, personalul
precum și specialiștilor în domeniul informatic din aparatul de probațiune beneficiază și de un spor pentru risc și
propriu al Ministerului Justiției, al Consiliului Superior al suprasolicitare neuropsihică de până la 25%, respectiv de un
Magistraturii, al Înaltei Curți de Casație și Justiție și al spor pentru păstrarea confidențialității de până la 5%, aplicate la
Parchetului de pe lângă Înalta Curte de Casație și Justiție, al salariul de bază lunar, respectiv la indemnizația lunară de
Inspecției Judiciare, al Institutului Național al Magistraturii și al încadrare.
Școlii Naționale de Grefieri, al instanțelor judecătorești și al Art. 6. — (1) Personalul prevăzut la art. 1 care are calitatea
parchetelor de pe lângă acestea; de membru al unor comisii de examinare, de soluționare a
f) personalului de probațiune și personalului din cadrul contestațiilor ori de organizare a unor examene sau concursuri
Oficiului Național al Registrului Comerțului. este remunerat prin plata cu ora pentru timpul efectiv lucrat în
Art. 2. — (1) Salarizarea și celelalte drepturi ale judecătorilor cadrul acestor comisii, dacă activitatea se desfășoară în afara
militari și procurorilor militari se asigură de Ministerul Apărării programului zilnic de lucru.
Naționale, potrivit prevederilor prezentei legi și reglementărilor (2) Calculul tarifului orar pentru plata membrilor comisiilor
referitoare la drepturile materiale și bănești specifice calității de prevăzute la alin. (1) se face luându-se în considerare salariul de
militar activ. Salarizarea și celelalte drepturi ale procurorilor bază sau, după caz, indemnizația de încadrare a persoanei.
militari din cadrul Direcției Naționale Anticorupție se asigură de (3) Membrii comisiilor prevăzute la alin. (1) care se
aceasta, potrivit prevederilor prezentei legi și reglementărilor deplasează în altă localitate decât cea în care își au locul de
referitoare la drepturile materiale și bănești specifice calității de muncă beneficiază de diurnă, cheltuieli de transport și cazare,
militar activ. potrivit legii.
(2) Salarizarea și celelalte drepturi ale personalului auxiliar (4) Dispozițiile prezentului articol se aplică în mod
de specialitate și personalului conex militar și civil de la corespunzător și funcționarilor publici și personalului contractual
instanțele și parchetele militare se asigură de Ministerul Apărării din cadrul instanțelor judecătorești, parchetelor, Ministerului
Naționale, potrivit prevederilor prezentei legi și reglementărilor Justiției, Consiliului Superior al Magistraturii, Institutului Național
referitoare la drepturile materiale și bănești specifice calității de de Expertize Criminalistice, Institutului Național al Magistraturii
militar activ, respectiv de salariat civil al Ministerului Apărării și Școlii Naționale de Grefieri.
Naționale. Art. 7. — (1) Prin derogare de la art. 37 din lege, personalul
(3) Salarizarea și celelalte drepturi ale personalului civil al salarizat potrivit prezentului capitol, nemulțumit de modul de
Ministerului Apărării Naționale și al Direcției Naționale stabilire a drepturilor salariale, poate face contestație, în termen
Anticorupție se asigură de către acestea, potrivit prevederilor de 20 de zile calendaristice de la data comunicării actului
prezentei legi și reglementărilor referitoare la drepturile materiale administrativ de stabilire a drepturilor salariale, la organele de
și bănești specifice calității de personal civil al Ministerului conducere ale Ministerului Justiției, Consiliului Superior al
Apărării Naționale. Pentru judecătorii și procurorii militari, Magistraturii, Inspecției Judiciare, Institutului Național al
indemnizația de încadrare stabilită potrivit prezentei legi Magistraturii și Școlii Naționale de Grefieri, Parchetului de pe
reprezintă solda de funcție. lângă Înalta Curte de Casație și Justiție, Direcției Naționale
Art. 3. — (1) Salarizarea și celelalte drepturi salariale ale Anticorupție, Direcției de Investigare a Infracțiunilor de
personalului prevăzut la art. 1 din prezentul capitol se stabilesc Criminalitate Organizată și Terorism, la colegiul de conducere
ținându-se seama de criteriile prevăzute la art. 8 din prezenta al Înaltei Curți de Casație și Justiție ori la colegiile de conducere
lege, precum și de locul și rolul justiției în statul de drept, ale curților de apel sau parchetelor de pe lângă acestea sau la
echilibrul puterilor în stat, de importanța socială a muncii, de organele de conducere ale celorlalte instituții din sistem care au
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 79

stabilit drepturile salariale, după caz. Contestațiile se judecătorilor și procurorilor și ale personalului de instruire de la
soluționează în termen de cel mult 30 de zile calendaristice. Institutul Național al Magistraturii și Școala Națională de Grefieri
(2) Împotriva hotărârilor organelor prevăzute la alin. (1) se se stabilesc, după caz, de ministrul justiției, de președintele
poate face plângere, în termen de 30 de zile de la comunicare, Înaltei Curți de Casație și Justiție, de președintele Consiliului
la Secția de contencios administrativ și fiscal a Curții de Apel Superior al Magistraturii, de inspectorul șef al Inspecției
București. Judiciare, directorul Institutului Național al Magistraturii și al
Școlii Naționale de Grefieri sau de procurorul general al
SECȚIUNEA a 2-a
Parchetului de pe lângă Înalta Curte de Casație și Justiție, cu
Salarizarea judecătorilor, procurorilor, a personalului de excepția cazurilor în care, prin lege specială sau prin prezenta
specialitate juridică asimilat acestora și a magistraților-asistenți lege, se prevede altfel.
Art. 8. — (1) Judecătorii, procurorii și magistrații-asistenți au Art. 9. — Indemnizațiile de încadrare ale judecătorilor și ale
dreptul, pentru activitatea desfășurată, la o indemnizație de procurorilor sunt prevăzute în prezenta anexă la cap. I lit. A și,
încadrare stabilită în raport cu nivelul instanțelor sau parchetelor respectiv, lit. B.
sau, după caz, cu gradul profesional obținut, cu funcția deținută Art. 10. — (1) Judecătorii și procurorii care ocupă funcții de
și, după caz, cu vechimea în muncă și în funcție, potrivit conducere beneficiază de indemnizația de încadrare maximă
prevederilor prezentei legi. corespunzătoare nivelului instanței sau parchetului unde
(2) Indemnizațiile de încadrare și celelalte drepturi ale exercită funcția de conducere, majorată după cum urmează:
judecătorilor, procurorilor, magistraților-asistenți, inspectorilor a) funcții de conducere la Înalta Curte de Casație și Justiție
judiciari și ale personalului de specialitate juridică asimilat și la Parchetul de pe lângă Înalta Curte de Casație și Justiție:

1U 3URFHQWPDMRUDUH
)XQF‫܊‬LD
FUW 
 3UH‫܈‬HGLQWHSURFXURUJHQHUDO 
 9LFHSUH‫܈‬HGLQWH SULPDGMXQFW DO SURFXURUXOXL JHQHUDO SURFXURU ‫܈‬HI DO 'LUHF‫܊‬LHL 
1D‫܊‬LRQDOH $QWLFRUXS‫܊‬LHSURFXURU‫܈‬HIDO'LUHF‫܊‬LHLGH,QYHVWLJDUHD,QIUDF‫܊‬LXQLORU
GH&ULPLQDOLWDWH2UJDQL]DWă‫܈‬L7HURULVP
 3UH‫܈‬HGLQWH VHF‫܊‬LH DGMXQFW DO SURFXURUXOXL JHQHUDO DO 3DUFKHWXOXL GH SH OkQJă 
ÌQDOWD &XUWH GH &DVD‫܊‬LH ‫܈‬L -XVWL‫܊‬LH DGMXQFW DO SURFXURUXOXL ‫܈‬HI DO 'LUHF‫܊‬LHL
1D‫܊‬LRQDOH$QWLFRUXS‫܊‬LHDGMXQFWDOSURFXURUXOXL‫܈‬HIDO'LUHF‫܊‬LHLGH,QYHVWLJDUHD
,QIUDF‫܊‬LXQLORUGH&ULPLQDOLWDWH2UJDQL]DWă‫܈‬L7HURULVP
 3URFXURU‫܈‬HIVHF‫܊‬LHSURFXURU‫܈‬HIVHF‫܊‬LHvQFDGUXO'LUHF‫܊‬LHL1D‫܊‬LRQDOH$QWLFRUXS‫܊‬LH 
‫܈‬L 'LUHF‫܊‬LHL GH ,QYHVWLJDUH D ,QIUDF‫܊‬LXQLORU GH &ULPLQDOLWDWH 2UJDQL]DWă ‫܈‬L
7HURULVP
 3URFXURU ‫܈‬HI VHF‫܊‬LH DGMXQFW SURFXURU ‫܈‬HI VHF‫܊‬LH DGMXQFW vQ FDGUXO 'LUHF‫܊‬LHL 
1D‫܊‬LRQDOH $QWLFRUXS‫܊‬LH ‫܈‬L 'LUHF‫܊‬LHL GH ,QYHVWLJDUH D ,QIUDF‫܊‬LXQLORU GH
&ULPLQDOLWDWH2UJDQL]DWă‫܈‬L7HURULVP
 3URFXURU ‫܈‬HI VHUYLFLX SURFXURU ‫܈‬HI VHUYLFLX vQ FDGUXO 'LUHF‫܊‬LHL 1D‫܊‬LRQDOH 
$QWLFRUXS‫܊‬LH ‫܈‬L 'LUHF‫܊‬LHL GH ,QYHVWLJDUH D ,QIUDF‫܊‬LXQLORU GH &ULPLQDOLWDWH
2UJDQL]DWă‫܈‬L7HURULVP
 3URFXURU‫܈‬HIELURXSURFXURU‫܈‬HIELURXvQFDGUXO'LUHF‫܊‬LHL1D‫܊‬LRQDOH$QWLFRUXS‫܊‬LH 
‫܈‬L 'LUHF‫܊‬LHL GH ,QYHVWLJDUH D ,QIUDF‫܊‬LXQLORU GH &ULPLQDOLWDWH 2UJDQL]DWă ‫܈‬L
7HURULVP
b) funcții de conducere în cadrul curților de apel, tribunalelor, tribunalelor specializate, judecătoriilor și a parchetelor de pe lângă
aceste instanțe:

1U 3URFHQW
)XQF‫܊‬LD
FUW PDMRUDUH
 3UH‫܈‬HGLQWHSURFXURUJHQHUDOSULPSURFXURU 
 9LFHSUH‫܈‬HGLQWHSURFXURUJHQHUDODGMXQFWSULPSURFXURUDGMXQFW 
 3UH‫܈‬HGLQWHVHF‫܊‬LHSURFXURU‫܈‬HIVHF‫܊‬LH 
 3URFXURU‫܈‬HIVHUYLFLX 
 3URFXURU‫܈‬HIELURX 
(2) Judecătorii și procurorii numiți în funcții de conducere în a) pentru funcțiile de secretar general al Consiliului Superior
cadrul instanțelor și parchetelor își păstrează indemnizația al Magistraturii, inspector șef al Inspecției Judiciare și în cadrul
lunară de încadrare și celelalte drepturi salariale Ministerului Justiției, sunt cele prevăzute în prezenta anexă la
corespunzătoare funcției de execuție pe care o dețin, dacă cap. I lit. A nr. crt. 1 și art. 10 alin. (1) lit. a) nr. crt. 2;
acestea sunt mai favorabile. b) pentru funcțiile de secretar general adjunct al Consiliului
Superior al Magistraturii, director al Institutului Național al
Art. 11. — Indemnizațiile de încadrare pentru celelalte funcții
Magistraturii și al Școlii Naționale de Grefieri, inspector șef adjunct
din cadrul sistemului justiției se stabilesc în raport cu funcția, al Inspecției Judiciare, director general de specialitate juridică în
gradul și, după caz, vechimea în muncă și în funcție avute, după cadrul Ministerului Justiției, sunt cele prevăzute în prezenta anexă
cum urmează: la cap. I lit. A nr. crt. 1 și art. 10 alin. (1) lit. a) nr. crt. 3;
80 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

c) pentru funcțiile de director al direcțiilor de inspecție prevăzute la art. 1 lit. a), c) și f) din prezentul capitol, delegate
judiciară din cadrul Inspecției Judiciare, director adjunct al sau detașate sau care își desfășoară activitatea în sistemul
Institutului Național al Magistraturii și al Școlii Naționale de penitenciar, beneficiază pe durata delegării sau detașării sau a
Grefieri, director general adjunct de specialitate juridică și desfășurării activității în sistemul penitenciar, și de un spor de
director la direcții de specialitate juridică din cadrul Consiliului până la 20% calculat la indemnizația de încadrare sau, după
Superior al Magistraturii, Ministerului Justiției și Inspecției caz, la salariul de bază.
Judiciare, prim-magistrat-asistent și magistrat-asistent-șef Art. 14. — (1) Pe durata mandatului președintelui Înaltei Curți
gradul I, sunt cele prevăzute în prezenta anexă la cap. I, lit. A de Casație și Justiție, al președintelui Consiliului Superior al
nr. crt. 2 și art. 10 alin. (1) lit. a) nr. crt. 4; Magistraturii, al procurorului general al Parchetului de pe lângă
d) pentru funcțiile de inspector judiciar în cadrul Inspecției Înalta Curte de Casație și Justiție, al procurorului șef al Direcției
Judiciare, inspector în cadrul Ministerului Justiției, director adjunct Naționale Anticorupție, al procurorului șef al Direcției de Investigare
la direcții de specialitate juridică din cadrul Consiliului Superior al a Infracțiunilor de Criminalitate Organizată și Terorism și al
Magistraturii, Ministerului Justiției și Inspecției Judiciare, ministrului justiției, consilierii acestora, personal contractual cu studii
magistrat-asistent-șef gradul II, sunt cele prevăzute în prezenta superioare juridice, sunt salarizați cu o indemnizație de încadrare
anexă la cap. I, lit. A nr. crt. 2 și art. 10 alin. (1) lit. a) nr. crt. 5; lunară stabilită la nivelul funcției de președinte de tribunal.
e) pentru funcția de șef serviciu de specialitate juridică din (2) Consilierii prevăzuți la alin. (1) beneficiază, în mod
cadrul Consiliului Superior al Magistraturii, Ministerului Justiției, corespunzător, de drepturile prevăzute la art. 4 din prezentul
Ministerului Public, Inspecției Judiciare, Institutului Național al capitol, precum și de drepturile prevăzute la art. 13 alin. (1) lit. c)
Magistraturii și Școlii Naționale de Grefieri, magistrat-asistent- și art. 23 din Ordonanța de urgență a Guvernului nr. 27/2006
șef gradul III, sunt cele prevăzute în prezenta anexă la cap. I, privind salarizarea și alte drepturi ale judecătorilor, procurorilor
lit. A nr. crt. 2 și art. 10 alin. (1) lit. a) nr. crt. 6; și altor categorii de personal din sistemul justiției, aprobată cu
f) pentru funcția de șef birou de specialitate juridică din cadrul modificări și completări prin Legea nr. 45/2007, cu modificările și
Consiliului Superior al Magistraturii, Ministerului Justiției și completările ulterioare.
Ministerului Public, Inspecției Judiciare, Institutului Național al Art. 15. — Bursele auditorilor de justiție sunt cele prevăzute
Magistraturii și Școlii Naționale de Grefieri, magistrat-asistent în prezenta anexă la cap. I lit. A nr. crt. 6.
gradul I sunt cele prevăzute în prezenta anexă la cap. I, lit. A
nr. crt. 2 și art. 10 alin. (1) lit. a) nr. crt. 7; SECȚIUNEA a 3-a
g) pentru funcția de magistrat-asistent gradul II sunt cele Salarizarea și celelalte drepturi salariale ale asistenților judiciari
prevăzute în prezenta anexă la cap. I, lit. A nr. crt. 2 și art. 10
alin. (1) lit. a) nr. crt. 7; Art. 16. — (1) Asistenții judiciari numiți în condițiile Legii
h) pentru funcția de magistrat-asistent gradul II sau III, după nr. 304/2004, republicată, cu modificările și completările
caz, cu vechime în funcție sub 6 ani, sunt cele prevăzute în ulterioare, sunt salarizați cu indemnizația lunară de încadrare
prezenta anexă la cap. I, lit. A nr. crt. 2, diminuate cu 10%; prevăzută în prezenta anexă la cap. I lit. A nr. crt. 4, aferentă
i) pentru funcția de personal de specialitate juridică asimilat unei vechimi în funcție de la 0 la 3 ani, respectiv de la 3 la 5 ani.
magistraților, cu o vechime în funcție de peste 8 ani, personal de (2) Asistenții judiciari beneficiază în mod corespunzător de
instruire de specialitate juridică la Institutul Național al drepturile prevăzute la art. 24 și 25 din Ordonanța de urgență a
Magistraturii, magistrat-asistent gradul III, sunt cele prevăzute Guvernului nr. 27/2006, aprobată cu modificări și completări prin
în prezenta anexă la cap. I, lit. A nr. crt. 2; Legea nr. 45/2007, cu modificările și completările ulterioare.
j) pentru funcția de personal de specialitate juridică asimilat (3) Indemnizațiile de încadrare și celelalte drepturi ale
magistraților, cu o vechime în funcție între 5—8 ani, personalul de asistenților judiciari se stabilesc prin ordin al ministrului justiției.
instruire de specialitate juridică la Școala Națională de Grefieri,
sunt cele prevăzute în prezenta anexă la cap. I, lit. A nr. crt. 3; SECȚIUNEA a 4-a
k) pentru funcția de personal de specialitate juridică asimilat Salarizarea și celelalte drepturi salariale ale personalului
magistraților, cu o vechime în funcție între 1—5 ani, sunt cele auxiliar de specialitate și ale personalului conex
prevăzute în prezenta anexă la cap. I, lit. A nr. crt. 4;
l) pentru funcția de personal de specialitate juridică stagiar Art. 17. — (1) Salariile de bază pentru personalul auxiliar de
asimilat magistraților stagiari sunt cele prevăzute în prezenta specialitate și conex din cadrul instanțelor judecătorești și al
anexă la cap. I, lit. A nr. crt. 5. parchetelor de pe lângă acestea, astfel cum este definit la art. 3
Art. 12. — (1) Pe perioada mandatului, președintele și din Legea nr. 567/2004 privind statutul personalului auxiliar de
vicepreședintele Consiliului Superior al Magistraturii primesc o specialitate al instanțelor judecătorești și al parchetelor de pe
indemnizație de încadrare egală cu cea a președintelui, lângă acestea, cu modificările și completările ulterioare, se
respectiv a vicepreședintelui Înaltei Curți de Casație și Justiție. stabilesc pe grade sau trepte profesionale, în raport cu funcția
(2) Membrii aleși ai Consiliului Superior al Magistraturii, care deținută, cu nivelul studiilor, cu vechimea în specialitate, precum
au funcția de judecător sau procuror, cu excepția celor prevăzuți și cu nivelul instanței sau al parchetului, după caz.
la alin. (1), primesc lunar pentru activitatea desfășurată o (2) Salariile de bază pentru personalul auxiliar de specialitate
indemnizație de încadrare egală cu cea a unui președinte de și conex din cadrul judecătoriilor și al parchetelor de pe lângă
secție al Înaltei Curți de Casație și Justiție. acestea sunt cele prevăzute în prezenta anexă la cap. II și III.
(3) La indemnizațiile prevăzute la alin. (1) și (2) se includ (3) Salariile de bază pentru personalul auxiliar de specialitate
sporurile prevăzute de prezenta lege. și personalul conex de la tribunale/tribunale specializate,
(4) Membrii Consiliului Superior al Magistraturii prevăzuți la tribunalele militare și de la parchetele de pe lângă acestea, de
alin. (1) și (2) beneficiază și de o indemnizație de membru egală la judecătoriile din municipiul București și din localitățile
cu 25% din indemnizația brută lunară maximă a judecătorului reședință de județ, precum și de la parchetele de pe lângă
de la Înalta Curte de Casație și Justiție. acestea sunt cele prevăzute la alin. (2) majorate cu 5%.
(5) Membrii de drept ai Consiliului Superior al Magistraturii și (4) Salariile de bază pentru personalul auxiliar de specialitate
reprezentanții societății civile beneficiază de o indemnizație de și personalul conex de la curțile de apel și parchetele de pe
membru egală cu 50% din indemnizația brută lunară maximă a lângă acestea sunt cele prevăzute la alin. (2) majorate cu 7,5%.
judecătorului de la Înalta Curte de Casație și Justiție. (5) Salariile de bază pentru personalul auxiliar de specialitate
(6) În baza de calcul al indemnizației de membru al și personalul conex de la Înalta Curte de Casație și Justiție, de
Consiliului Superior al Magistraturii, prevăzută la alin. (4) și (5), la Parchetul de pe lângă Înalta Curte de Casație și Justiție, de
nu se includ sporurile stabilite de prezenta lege. la Direcția Națională Anticorupție și de la Direcția de Investigare
Art. 13. — Judecătorul delegat pentru executarea pedepselor a Infracțiunilor de Criminalitate Organizată și Terorism sunt cele
privative de libertate, precum și alte categorii de personal prevăzute la alin. (2) majorate cu 10%.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 81

Art. 18. — Pentru personalul auxiliar de specialitate din cadrul (2) Specialiștii prevăzuți la alin. (1) beneficiază și de celelalte
instanțelor judecătorești și al parchetelor de pe lângă acestea, drepturi salariale prevăzute de lege pentru categoria
cu studii superioare, care a ocupat funcții medii de specialitate, profesională din care fac parte, după caz, cu excepția
în calculul vechimii în specialitate se ia în considerare și jumătate elementelor salariale care compun salariul de bază stabilit
din timpul cât a lucrat în funcțiile respective. pentru categoriile profesionale din care fac parte.
(3) Salariul de bază se stabilește potrivit prezentei anexe,
SECȚIUNEA a 5-a cap. I lit. A nr. crt. 6 pentru agenții de poliție judiciară din cadrul
Salarizarea și celelalte drepturi salariale ale personalului de Direcției Naționale Anticorupție și Direcției de Investigare a
instruire fără specialitate juridică, a personalului care ocupă Infracțiunilor de Criminalitate Organizată și Terorism și cap. I lit. B
funcții auxiliare din cadrul Institutului Național al Magistraturii și nr. crt. 4 pentru ofițerii de poliție judiciară. Șefii de birou din cadrul
al Școlii Naționale de Grefieri, a personalului de specialitate Direcției Naționale Anticorupție și Direcției de Investigare a
criminalistică și a personalului auxiliar de specialitate Infracțiunilor de Criminalitate Organizată și Terorism beneficiază
criminalistică din cadrul Institutului Național de Expertize de indemnizația de încadrare corespunzătoare funcției de prim-
Criminalistice și al laboratoarelor de expertize criminalistice
procuror adjunct din cadrul parchetului de pe lângă judecătorie, iar
șefii de serviciu de indemnizația de încadrare corespunzătoare
Art. 19. — Salariile de bază pentru personalul de instruire funcției de prim-procuror în cadrul parchetului de pe lângă
fără specialitate juridică și pentru personalul auxiliar din cadrul judecătorie. Ofițerii și agenții de poliție judiciară din Direcția
Institutului Național al Magistraturii și al Școlii Naționale de Națională Anticorupție și Direcția de Investigare a Infracțiunilor de
Grefieri sunt prevăzute în prezenta anexă la cap. IV, pe grade Criminalitate Organizată și Terorism beneficiază de drepturile
profesionale, în funcție de nivelul studiilor și de vechimea în prevăzute în prezenta anexă. Specialiștii prevăzuți la alin. (1)
specialitate, după caz. beneficiază și de prevederile art. 23 din Ordonanța de urgență a
Art. 20. — (1) La Institutul Național al Magistraturii și la Guvernului nr. 27/2006, aprobată cu modificări și completări prin
Școala Națională de Grefieri, pentru îndeplinirea unor activități Legea nr. 45/2007, cu modificările și completările ulterioare.
pentru care volumul de muncă este sub jumătate din cel al unui (4) Indemnizațiile de încadrare sau salariile de bază, precum
post cu normă întreagă, se face plata cu ora. Aceste fracțiuni de și alte drepturi salariale ale personalului din cadrul Direcției
normă sunt prevăzute în statul de funcții. Activitățile pentru care Naționale Anticorupție și Direcției de Investigare a Infracțiunilor
se poate aplica plata cu ora se stabilesc anual de președintele de Criminalitate Organizată și Terorism se stabilesc de
Consiliului Superior al Magistraturii. procurorul șef al Direcției Naționale Anticorupție, respectiv al
(2) Calculul tarifului orar se face luându-se în considerare Direcției de Investigare a Infracțiunilor de Criminalitate
salariul de bază al celui în cauză, stabilit în condițiile prevăzute Organizată și Terorism, potrivit legii.
la art. 19 din prezentul capitol. SECȚIUNEA a 7-a
(3) Pentru personalul care prestează activități didactice cu
ora, calculul tarifului orar se face în raport cu norma didactică de Salarizarea personalului de probațiune și a personalului
predare săptămânală și cu funcția didactică îndeplinită. din cadrul Oficiului Național al Registrului Comerțului
Art. 21. — (1) Salariile de bază pentru personalul de execuție Art. 23. — Salariile de bază pentru personalul de probațiune
de specialitate criminalistică și personalul auxiliar de specialitate și pentru directorul general și directorul general adjunct ai Direcției
criminalistică din Institutul Național de Expertize Criminalistice și Naționale de Probațiune sunt prevăzute în prezenta anexă la
din laboratoarele de expertize criminalistice sunt stabilite în cap. VII, în raport cu funcția deținută, gradul profesional avut și
prezenta anexă la cap. V, pe grade sau trepte profesionale, în cu vechimea în probațiune, după caz. Salariile de bază și celelalte
raport cu nivelul studiilor și vechimea în specialitate, după caz. drepturi ale personalului de probațiune și ale directorului general
(2) Personalul de specialitate criminalistică și personalul și directorului general adjunct ai Direcției Naționale de Probațiune
auxiliar de specialitate criminalistică din cadrul Institutului se stabilesc de ministrul justiției, cu excepția cazurilor în care prin
Național de Expertize Criminalistice și al laboratoarelor de lege specială sau prin prezenta lege se prevede altfel.
expertize criminalistice au calitatea de personal contractual, Art. 24. — Salariile de bază pentru personalul din cadrul
având drepturile și obligațiile prevăzute de legislația aplicabilă Oficiului Național al Registrului Comerțului și al oficiilor
acestei categorii profesionale excepție făcând drepturile Registrului Comerțului de pe lângă tribunale sunt prevăzute în
salariale prevăzute de prezenta lege. prezenta anexă la cap. VI.
(3) Personalul prevăzut la alin. (2) poate fi utilizat și la parchete.
(4) Indemnizațiile lunare prevăzute în prezenta anexă la SECȚIUNEA a 8-a
cap. V, sunt mai mari cu 2% pentru personalul de specialitate Salarizarea judecătorilor și personalului din cadrul
criminalistică și personalul auxiliar de specialitate criminalistică Curții Constituționale
din cadrul Institutului Național de Expertize Criminalistice. Art. 25. — (1) Președintele Curții Constituționale este egal în
(5) La numirea în funcția de tehnician criminalist și la grad cu președintele Înaltei Curți de Casație și Justiție, iar
stabilirea treptei profesionale, pot fi luate în considerare și judecătorii Curții Constituționale, cu vicepreședintele Înaltei Curți
perioadele lucrate în funcții de tehnician în alte sectoare de de Casație și Justiție, beneficiind de indemnizație egală cu a
activitate; în acest caz vechimea în specialitate prevăzută în acestora la nivel maxim, necondiționată de vechimea în funcția
prezenta anexă se majorează cu 3 ani. de judecător sau procuror, precum și de celelalte drepturi.
(6) Dispozițiile art. 17 alin. (3)—(5) din prezentul capitol se (2) Personalul Curții Constituționale este salarizat potrivit
aplică în mod corespunzător și tehnicienilor criminaliști din anexelor la prezenta lege în care se regăsesc aceste categorii
cadrul parchetelor de pe lângă instanțele judecătorești. de personal, în funcție de încadrare, cu respectarea prevederilor
prezentei legi, beneficiind, în mod corespunzător, și de celelalte
SECȚIUNEA a 6-a drepturi prevăzute de legislația în vigoare.
Salarizarea specialiștilor din cadrul Parchetului de pe lângă
Înalta Curte de Casație și Justiție, inclusiv al Direcției Naționale SECȚIUNEA a 9-a
Anticorupție, al Direcției de Investigare a Infracțiunilor de Dispoziții finale
Criminalitate Organizată și Terorism și al celorlalte parchete
Art. 26. — Personalul din Ministerul Justiției cu atribuții de
Art. 22. — (1) Salariile de bază pentru specialiștii din cadrul coordonare și control și cel care efectuează lucrări în legătură cu
Parchetului de pe lângă Înalta Curte de Casație și Justiție, activitatea penitenciarelor, cu excepția funcționarilor publici cu
inclusiv al Direcției Naționale Anticorupție și al Direcției de statut special, beneficiază de un spor la salariul de bază,
Investigare a Infracțiunilor de Criminalitate Organizată și respectiv indemnizația de încadrare, de până la 5%.
Terorism și al celorlalte parchete, sunt prevăzute în prezenta Art. 27. — Statele de personal și statele de funcții se
anexă la cap. I lit. B nr. crt. 4. întocmesc în limita numărului de posturi legal aprobat.
82 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. VI

FA M I L I A O C U PA Ț I O N A L Ă D E F U N C Ț I I B U G E TA R E
„AP Ă R A R E, O R D I N E P U B L I C Ă Ș I S E C U R I T A T E N A Ț I O N A L Ă”

CAPITOLUL I
Soldele de funcție/Salariile de funcție pentru personalul militar, polițiștii și funcționarii publici cu statut special
din instituțiile publice din sistemul de apărare, ordine publică și securitate națională

6ROGHGHIXQF‫܊‬LH
VDODULLGHIXQF‫܊‬LH
1U 1LYHOXO OHL &RHILFLHQW
)XQF‫܊‬LD
FUW VWXGLLORU
$QXO
0LQLP 0D[LP 0LQLP 0D[LP
‫܇‬HIXO6WDWXOXL0DMRU*HQHUDOVHFUHWDUGH
VWDW‫܈‬HIDO'HSDUWDPHQWXOXL2UGLQH‫܈‬L
6LJXUDQ‫܊‬ă3XEOLFăSULPDGMXQFWXO
GLUHFWRUXOXL6HUYLFLXOXL5RPkQGH
 6   
,QIRUPD‫܊‬LLSULPXODGMXQFWDOGLUHFWRUXOXL 
6HUYLFLXOXLGH,QIRUPD‫܊‬LL([WHUQHGLUHFWRUXO
6HUYLFLXOXLGH7HOHFRPXQLFD‫܊‬LL6SHFLDOH
GLUHFWRUXO6HUYLFLXOXLGH3URWHF‫܊‬LH‫܈‬L3D]ă
$GMXQF‫܊‬LLGLUHFWRUXOXL6HUYLFLXOXL5RPkQGH
,QIRUPD‫܊‬LLDGMXQF‫܊‬LLGLUHFWRUXOXL6HUYLFLXOXL
GH,QIRUPD‫܊‬LL([WHUQHGLUHFWRUXOJHQHUDODO
 'LUHF‫܊‬LHL*HQHUDOHGH,QIRUPD‫܊‬LLD$SăUăULL 6   

VHFUHWDULLGHVWDW‫܈‬LDOWHIXQF‫܊‬LLDVLPLODWH
IXQF‫܊‬LHLGHVHFUHWDUGHVWDWGLQ0LQLVWHUXO
$IDFHULORU,QWHUQH
3ULPDGMXQFWXO‫܈‬LDGMXQF‫܊‬LLGLUHFWRUXOXL
6HUYLFLXOXLGH7HOHFRPXQLFD‫܊‬LL6SHFLDOH
SULPDGMXQFWXO‫܈‬LDGMXQFWXOGLUHFWRUXOXL
 6   
6HUYLFLXOXLGH3URWHF‫܊‬LH‫܈‬L3D]ă 
VXEVHFUHWDULLGHVWDWGLQ0LQLVWHUXO
$IDFHULORU,QWHUQH
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHJHQHUDO
DPLUDOFKHVWRUJHQHUDOGHSROL‫܊‬LHGLUHFWRUXO
 6    
JHQHUDODO$GPLQLVWUD‫܊‬LHL1D‫܊‬LRQDOHD
3HQLWHQFLDUHORU
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGH
JHQHUDOORFRWHQHQWYLFHDPLUDOFKHVWRU‫܈‬HI
 6    
GHSROL‫܊‬LHGLUHFWRULLJHQHUDOLDGMXQF‫܊‬LGLQ
$GPLQLVWUD‫܊‬LD1D‫܊‬LRQDOăD3HQLWHQFLDUHORU
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHJHQHUDO
 PDLRUFRQWUDDPLUDOFKHVWRUSULQFLSDOGH 6    
SROL‫܊‬LH
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHJHQHUDO
GHEULJDGăJHQHUDOGHIORWLOăDHULDQă
 6    
FRQWUDDPLUDOGHIORWLOăFKHVWRUGH
SROL‫܊‬LHSHQLWHQFLDUH
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHFRORQHO
 FRPDQGRUFRPLVDU‫܈‬HIGH 6    
SROL‫܊‬LHSHQLWHQFLDUH
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGH
 ORFRWHQHQWFRORQHOFăSLWDQFRPDQGRU 6    
FRPLVDUGHSROL‫܊‬LHSHQLWHQFLDUH
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 83
S ‫ ܊‬S
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLRU
 ORFRWHQHQWFRPDQGRUVXEFRPLVDUGHSROL‫܊‬LH 6    
SHQLWHQFLDUH
)XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHFăSLWDQ
 6    
LQVSHFWRUSULQFLSDOGHSROL‫܊‬LHSHQLWHQFLDUH
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGH
6    
ORFRWHQHQWLQVSHFWRUGHSROL‫܊‬LHSHQLWHQFLDUH
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGH
VXEORFRWHQHQWDVSLUDQWVXELQVSHFWRUGH 6    
SROL‫܊‬LHSHQLWHQFLDUH
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGH
VXELQVSHFWRUGHSROL‫܊‬LHSHQLWHQFLDUH 6    
GHEXWDQW
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 6    
PLOLWDUSULQFLSDOSOXWRQLHUDGMXWDQW 3/    
SULQFLSDO‫܈‬HI 0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 6    
PLOLWDUFOV,SOXWRQLHUDGMXWDQW 3/    
0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 6    
PLOLWDUFOVD,,DSOXWRQLHUPDMRU 3/    
0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 6    
PLOLWDUFOVD,,,DSOXWRQLHU 3/    
0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 6    
PLOLWDUFOVD,9DVHUJHQWPDMRU 3/    
0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHDJHQW 6    
DJHQW‫܈‬HISULQFLSDOGHSROL‫܊‬LHSHQLWHQFLDUH
‫܈‬HIIRUPD‫܊‬LXQH  0
   
   
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHDJHQW 6    
DJHQW‫܈‬HISULQFLSDOGHSROL‫܊‬LHSHQLWHQFLDUH
0    
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHPDLVWUX 3/   
PLOLWDUFOVD9DVHUJHQWDJHQWGH   
SROL‫܊‬LHSHQLWHQFLDUHGHEXWDQW 0
   
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHFDSRUDO
  
FODVD,  
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHFDSRUDO
  
FODVDD,,D  
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHFDSRUDO
  
FODVDD,,,D  
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHIUXQWD‫܈‬   
 )XQF‫܊‬LLFRUHVSXQ]ăWRDUHJUDGXOXLGHVROGDW   
*) Prin formațiune se înțelege: echipaj, post de poliție, patrulă, arest, schimb, tură, atelier etc.

N O T Ă:
Pentru personalul militar în activitate, polițiști și funcționari publici cu statut special din sistemul administrației penitenciare,
care prin aplicarea programului de restructurare sunt numiți/încadrați în funcții inferioare, se acordă solda/salariul de funcție
corespunzător funcției din care aceste categorii de personal au provenit, în condițiile stabilite prin ordinul ordonatorului principal
de credite.
84 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

CAPITOLUL II SECȚIUNEA a 2-a


Reglementări specifice personalului din instituțiile publice Soldele de funcție și salariile de funcție
de apărare, ordine publică și securitate națională
Art. 3. — (1) Personalul militar are dreptul la soldă lunară.
(2) Solda lunară se compune din solda de funcție, solda de
SECȚIUNEA 1
grad, gradații și, după caz, solda de comandă, indemnizații,
Soldele personalului militar și salariile polițiștilor compensații, sporuri, prime, premii și din alte drepturi salariale.
și funcționarilor publici cu statut special Art. 4. — (1) Polițiștii și funcționarii publici cu statut special
din sistemul administrației penitenciare din sistemul administrației penitenciare au dreptul la salariu
Art. 1. — (1) Personalul încadrat în instituțiile publice de lunar.
apărare, ordine publică și securitate națională este salarizat în (2) Salariul lunar se compune din salariul de funcție, salariul
raport cu statutul, activitățile și organizarea stabilite prin lege, gradului profesional deținut, gradații și, după caz, salariul de
cu îndeplinirea cu credință a obligațiilor ce îi revin, potrivit comandă, indemnizații, compensații, sporuri, prime, premii și din
jurământului depus, cu responsabilitățile, atribuțiile, rolul, alte drepturi salariale.
complexitatea și importanța socială a funcției exercitate, cu Art. 5. — (1) Soldele de funcție, respectiv salariile de funcție
gradul de efort și risc, cu pregătirea și competența profesională, sunt diferențiate în raport cu nivelul studiilor, pregătirea
precum și cu interdicțiile și restrângerea exercițiului unor drepturi profesională, atribuțiile ce revin fiecărei funcții, solicitările la efort,
prevăzute pentru personalul din aceste instituții de legislația în complexitatea și gradul de răspundere cerut de îndeplinirea
vigoare. acesteia, precum și cu eșalonul la care se desfășoară
(2) Personalul instituțiilor publice prevăzute la alin. (1) activitatea, prevăzute în prezenta anexă la cap. I.
beneficiază de solde, salarii, indemnizații, compensații, sporuri, (2) Pentru personalul militar, precum și pentru polițiștii și
prime, premii și alte drepturi salariale. funcționarii publici cu statut special din sistemul administrației
(3) Drepturile bănești cuvenite militarilor în termen, soldaților penitenciare, soldele de funcție corespunzătoare gradelor
și gradaților profesioniști care urmează modulul instruirii militare și nivelului studiilor, respectiv salariile de funcție
individuale, elevilor și studenților instituțiilor militare de corespunzătoare gradelor profesionale și nivelului studiilor sunt
învățământ, elevilor și studenților din instituțiile de învățământ prevăzute în prezenta anexă la cap. I.
pentru formarea polițiștilor, respectiv ale cursanților din instituțiile (3) Soldele de funcție/Salariile de funcție și nivelul studiilor
de învățământ pentru formarea funcționarilor publici cu statut pentru funcțiile de comandă, respectiv de execuție ale
special din sistemul administrației penitenciare sunt prevăzute în personalului militar pe grade militare, respectiv ale polițiștilor și
secțiunea a 7-a din prezentul capitol. funcționarilor publici cu statut special din sistemul administrației
Art. 2. — (1) Personalul încadrat în instituțiile publice de penitenciare, pe grade profesionale, se stabilesc prin hotărâre a
apărare, ordine publică și securitate națională este format din Guvernului, în limitele prevăzute în prezenta anexă la cap. I, în
personal militar, polițiști, funcționari publici cu statut special din raport cu eșalonul la care se desfășoară activitatea.
sistemul administrației penitenciare, personal civil. (4) Solda de funcție se acordă de la data prevăzută în ordinul
(2) Prin personal militar, în sensul prezentei legi, se înțelege de numire. Pentru persoanele chemate sau rechemate în
cadrele militare în activitate, precum și soldații și gradații activitate, solda de funcție se acordă de la data prezentării la
profesioniști în activitate. serviciu.
(3) Prin polițiști, în sensul prezentei legi, se înțelege (5) Salariul de funcție se acordă de la data prevăzută în
funcționarii publici cu statut special din unitățile Ministerului ordinul/dispoziția/decizia de numire. Pentru persoanele nou-
Afacerilor Interne, aflați sub incidența Legii nr. 360/2002 privind încadrate sau reintegrate în rândul polițiștilor și funcționarilor
Statutul polițistului, cu modificările și completările ulterioare. publici cu statut special din sistemul administrației penitenciare,
(4) Prin funcționari publici cu statut special din sistemul salariul de funcție se acordă de la data prezentării la serviciu.
administrației penitenciare, în sensul prezentei legi, se înțelege Art. 6. — Solda de funcție, respectiv salariul de funcție sunt
funcționarii publici cu statut special din sistemul administrației prevăzute în prezenta anexă la cap. I.
penitenciare și din Ministerul Justiției, aflați sub incidența Legii Art. 7. — (1) Pentru gradul militar pe care îl deține, ca drept
nr. 293/2004 privind Statutul funcționarilor publici cu statut al titularului și recunoaștere în plan social, personalul militar,
special din Administrația Națională a Penitenciarelor, respectiv polițistul și funcționarul public cu statut special din
republicată. sistemul administrației penitenciare beneficiază de soldă de
(5) Prin personal civil, în sensul prezentei legi, se înțelege grad, respectiv de salariul gradului profesional deținut.
funcționarii publici și personalul contractual. (2) Cuantumurile soldelor/salariilor de grad sunt următoarele:
3ULQIRUPD‫܊‬LXQHVHvQ‫܊‬HOHJHHFKLSDMSRVWGHSROL‫܊‬LHSDWUXOăDUHVWVFKLPEWXUăDWHOLHUHWF
 Ofiаeri: 
 *HQHUDODPLUDOFKHVWRUJHQHUDOGHSROL‫܊‬LH OHL
 *HQHUDOORFRWHQHQWYLFHDPLUDOFKHVWRU‫܈‬HIGHSROL‫܊‬LH OHL
 *HQHUDOPDLRUFRQWUDDPLUDOFKHVWRUSULQFLSDOGHSROL‫܊‬LH OHL
 *HQHUDOGHEULJDGăJHQHUDOGHIORWLOăDHULDQăFRQWUDDPLUDOGH
OHL
IORWLOăFKHVWRUGHSROL‫܊‬LHSHQLWHQFLDUH
 &RORQHOFRPDQGRUFRPLVDU‫܈‬HIGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 /RFRWHQHQWFRORQHOFăSLWDQ±FRPDQGRUFRPLVDUGH
OHL
SROL‫܊‬LHSHQLWHQFLDUH
 0DLRUORFRWHQHQWFRPDQGRUVXEFRPLVDUGH
OHL
SROL‫܊‬LHSHQLWHQFLDUH
 &ăSLWDQLQVSHFWRUSULQFLSDOGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 /RFRWHQHQWLQVSHFWRUGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 6XEORFRWHQHQWDVSLUDQWVXELQVSHFWRUGHSROL‫܊‬LHSHQLWHQFLDUH OHL
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 85
 S  S S ‫ ܊‬S
 MaiЮtri militari 
 0DLVWUXPLOLWDUSULQFLSDO OHL
 0DLVWUXPLOLWDUFODVD, OHL
 0DLVWUXPLOLWDUFODVDD,,D OHL
 0DLVWUXPLOLWDUFODVDD,,,D OHL
 0DLVWUXPLOLWDUFODVDD,9D OHL
 0DLVWUXPLOLWDUFODVDD9D OHL
 Subofiаeri Юi agenаi de poliаie/penitenciare 
 3OXWRQLHUDGMXWDQWSULQFLSDO‫܈‬HIDJHQW‫܈‬HISULQFLSDOGH
OHL
SROL‫܊‬LHSHQLWHQFLDUH
 3OXWRQLHUDGMXWDQWDJHQW‫܈‬HIGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 3OXWRQLHUPDMRUDJHQW‫܈‬HIDGMXQFWGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 3OXWRQLHUDJHQWSULQFLSDOGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 6HUJHQWPDMRUDJHQWGHSROL‫܊‬LHSHQLWHQFLDUH OHL
 6HUJHQW OHL
 Soldaаi Юi gradaаi profesioniЮti 
 &DSRUDOFODVD, OHL
 &DSRUDOFODVDD,,D OHL
 &DSRUDOFODVDD,,,D OHL
 )UXQWD‫܈‬  OHL
 6ROGDW OHL

(3) Cuantumul soldei de grad/salariului gradului profesional (3) Cadrele militare în activitate, polițiștii și funcționarii publici
deținut se actualizează proporțional cu evoluția salariului de cu statut special din sistemul administrației penitenciare
bază minim brut pe țară garantat în plată, prin hotărâre a împuternicite/împuterniciți își mențin soldele de funcție/salariile
Guvernului. de funcție și, după caz, soldele de comandă/salariile de
(4) Solda de grad se plătește de la data acordării gradului, comandă avute anterior, dacă acestea sunt mai mari decât cele
respectiv a înaintării în grad. Pentru persoanele chemate sau acordate în baza prevederilor alin. (1) și (2).
rechemate în activitate, solda de grad se plătește de la data (4) Normele metodologice privind împuternicirea pentru
prezentării la serviciu. îndeplinirea atribuțiilor funcțiilor de comandă și de execuție se
(5) Salariul gradului profesional deținut se plătește de la data stabilesc prin ordin al ordonatorului principal de credite.
obținerii gradului profesional, respectiv a avansării în gradul Art. 10. — Cadrele militare în activitate, numite în funcții
profesional. Pentru persoanele nou-încadrate sau reintegrate în inferioare gradelor pe care le au, ca urmare a situațiilor
rândul polițiștilor și funcționarilor publici cu statut special din prevăzute la art. 81 alin. (1) lit. a) și b) din Legea nr. 80/1995
sistemul administrației penitenciare, salariul gradului profesional privind statutul cadrelor militare, cu modificările și completările
deținut se plătește de la data prezentării la serviciu. ulterioare, primesc soldele de funcție minime corespunzătoare
Art. 8. — (1) Cadrele militare în activitate, polițiștii și gradelor militare deținute.
funcționarii publici cu statut special din sistemul administrației Art. 11. — (1) Personalul militar, polițiștii și funcționarii publici
penitenciare care îndeplinesc funcții de comandă beneficiază cu statut special din sistemul administrației penitenciare au
lunar de solda de comandă/salariul de comandă de până la 25% dreptul la 1—7 gradații, în raport cu timpul servit în calitate de
din solda de funcție/salariul de funcție.
personal militar, polițist și funcționar public cu statut special din
(2) Funcțiile pentru care se acordă solda de comandă/salariul
sistemul administrației penitenciare.
de comandă, mărimea concretă a procentului, precum și
(2) Soldele de funcție/Salariile de funcție prevăzute la cap. I
normele de acordare/suspendare se stabilesc prin ordin al
ordonatorului principal de credite. din prezenta anexă sunt la gradația 0.
(3) Solda de comandă/Salariul de comandă se acordă de la (3) Intervalul de timp cuprins între data acordării gradului
data numirii în funcțiile cu drept la solda de comandă/salariul de militar și data absolvirii instituției militare de învățământ se ia în
comandă și încetează la data schimbării din funcție. calcul la stabilirea de gradații. Perioada modulului instruirii
Art. 9. — (1) Cadrele militare în activitate, polițiștii și individuale nu se ia în calcul la stabilirea de gradații.
funcționarii publici cu statut special din sistemul administrației (4) Intervalele de timp în funcție de care se acordă cele
penitenciare, care îndeplinesc, prin împuternicire, atribuțiile 7 gradații, precum și procentele corespunzătoare acestora,
funcțiilor prevăzute cu solda de comandă/salariul de comandă calculate la solda de funcție/salariul de funcție avută/avut la data
beneficiază, pe perioada împuternicirii, de solda de îndeplinirii condițiilor de trecere în gradație și incluse în solda
funcție/salariul de funcție și de solda de comandă/salariul de de funcție/salariul de funcție, sunt următoarele:
comandă corespunzător funcțiilor în care sunt împuternicite. a) gradația I — de la 3 la 6 ani — și se determină prin
(2) Cadrele militare în activitate din Ministerul Apărării majorarea soldei de funcție/salariului de funcție prevăzut la
Naționale, Serviciul Român de Informații și Serviciul de cap. I din prezenta anexă cu cota procentuală de 3%, rezultând
Telecomunicații Speciale, împuternicite să asigure îndeplinirea cuantumul nou al soldei de funcție/salariului de funcție;
atribuțiilor funcțiilor de execuție vacante sau ai căror titulari b) gradația a II-a — de la 6 la 9 ani — și se determină prin
lipsesc temporar, beneficiază, pe perioada împuternicirii, de majorarea soldei de funcție/salariului de funcție cu cota
solda de funcție corespunzătoare funcțiilor în care sunt procentuală de 3%, rezultând cuantumul nou al soldei de
împuternicite. funcție/salariului de funcție;
86 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

c) gradația a III-a — de la 9 la 12 ani — și se determină prin (2) Personalul militar, polițiștii, funcționarii publici cu statut
majorarea soldei de funcție/salariului de funcție cu cota special din sistemul administrației penitenciare și personalul civil
procentuală de 3%, rezultând cuantumul nou al soldei de beneficiază de următoarele sporuri, în funcție de condițiile de
funcție/salariului de funcție; muncă:
d) gradația a IV-a — de la 12 la 15 ani — și se determină prin a) pentru condiții periculoase sau vătămătoare, un spor de
majorarea soldei de funcție/salariului de funcție cu cota până la 15% din solda de funcție/salariul de funcție/salariul de
procentuală de 3%, rezultând cuantumul nou al soldei de bază, corespunzător timpului lucrat la locurile de muncă
funcție/salariului de funcție; respective;
e) gradația a V-a — de la 15 la 18 ani — și se determină prin b) pentru condiții grele de muncă, un spor de până la 15% din
majorarea soldei de funcție/salariului de funcție cu cota solda de funcție/salariul de funcție/salariul de bază,
procentuală de 3%, rezultând cuantumul nou al soldei de corespunzător timpului lucrat la locurile de muncă respective;
funcție/salariului de funcție;
c) pentru activitățile care solicită o încordare psihică foarte
f) gradația a VI-a — de la 18 la 21 ani — și se determină prin
majorarea soldei de funcție/salariului de funcție cu cota ridicată, un spor de până la 15% din solda de funcție/salariul de
procentuală de 3%, rezultând cuantumul nou al soldei de funcție/salariul de bază, corespunzător timpului lucrat la locurile
funcție/salariului de funcție; de muncă respective.
g) gradația a VII-a — peste 21 ani — și se determină prin (3) Locurile, condițiile de muncă și operațiunile, precum și
majorarea soldei de funcție/salariului de funcție cu cota procentele de acordare se stabilesc prin ordin al ordonatorului
procentuală de 3%, rezultând cuantumul nou al soldei de principal de credite, în limita prevederilor din Regulamentul
funcție/salariului de funcție. elaborat potrivit prezentei legi, având la bază buletinele de
(5) Persoanele chemate sau rechemate în activitate, precum determinare sau, după caz, expertizare, emise de către
și rezerviștii concentrați beneficiază de gradații în raport cu autoritățile abilitate în acest sens.
vechimea în serviciu avută/stagiul de cotizare realizat, legal Art. 13. — (1) Dispozițiile legale prin care sunt stabilite
stabilit, prin aplicarea succesivă a cotelor procentuale prevăzute sporuri, indemnizații și alte drepturi de natură salarială pentru
la alin. (4), după cum urmează: personalul din alte domenii de activitate din sectorul bugetar se
a) 3—6 ani, gradația I; aplică și personalului militar, polițiștilor, funcționarilor publici cu
b) 6—10 ani, gradația a II-a; statut special din sistemul administrației penitenciare și
c) 10—15 ani, gradația a III-a; personalului civil care se află în situații similare, indiferent de
d) 15—20 ani, gradația a IV-a; tipul unității în care își desfășoară activitatea, cu avizul
e) 20—25 ani, gradația a V-a; Ministerului Muncii și Justiției Sociale.
f) peste 25 de ani, gradația a VI-a. (2) Normele de aplicare se stabilesc prin ordin al
(6) Personalul militar trecut în rezervă care este rechemat în ordonatorului principal de credite.
activitate beneficiază de numărul de gradații avut înainte de Art. 14. — (1) Pentru munca cu grad ridicat de risc sau, după
trecerea în rezervă, dacă acesta este mai mare decât cel cuvenit
caz, în condiții de pericol deosebit, desfășurată în exercitarea
prin aplicarea prevederilor alin. (5), luându-se în calcul pentru
atribuțiilor funcționale, stabilite potrivit domeniilor de
acordarea gradației următoare și vechimea scursă de la
acordarea ultimei gradații până la data schimbării poziției de responsabilitate ale unității, personalul militar, polițiștii,
activitate. funcționarii publici cu statut special din sistemul administrației
(7) Prevederile alin. (5) și (6) se aplică și absolvenților penitenciare și personalul civil care execută, conduc,
instituțiilor militare de învățământ pentru vechimea în serviciu coordonează sau contribuie la realizarea misiunilor de operații
avută, respectiv pentru stagiul de cotizare realizat până la data speciale, misiunilor și/sau activităților deosebite ori de
intrării în aceste instituții și, după caz, soldaților și gradaților specialitate, misiunilor operative de protecție a demnitarilor, a
voluntari profesioniști în corpul cadrelor militare în activitate acțiunilor de gardare, protecție și control antiterorist,
pentru vechimea în serviciu avută, respectiv pentru stagiul de supraveghere operativă, a procedurilor speciale și activităților
cotizare realizat până la data schimbării poziției de activitate. de pază, supraveghere, escortare, reeducare, integrare și
(8) Prevederile alin. (5)—(7) se aplică în mod corespunzător asistență medicală și psihologică pentru persoanele arestate
și polițiștilor și funcționarilor publici cu statut special din sistemul preventiv sau condamnate cu pedepse privative de libertate ori
administrației penitenciare. care au solicitat sau au dobândit o formă de protecție în
(9) Gradația obținută se acordă cu începere de la data de România, culegere, prelucrare, centralizare, verificare și
întâi a lunii următoare celei în care s-au împlinit condițiile de valorificare a informațiilor sau datelor/situațiilor/documentelor/
acordare. actelor, investigații, acțiuni și intervenție, efectuarea actelor de
Art. 12. — (1) Personalul militar, polițiștii, funcționarii publici cercetare penală specială, beneficiază de o compensație de
cu statut special din sistemul administrației penitenciare și risc/pericol deosebit de până la 30% calculată la solda de
personalul civil care lucrează în condiții de pericol în unitățile de funcție/salariul de funcție/salariul de bază.
fabricare, experimentare, analiză sau depozitare a munițiilor, (2) Compensația prevăzută la alin. (1) se acordă și
pulberilor, explozivilor și substanțelor toxice speciale sau care personalului din structurile din domeniile informații pentru
execută operațiuni de depozitare, dezamorsare, manipulare,
apărare, cercetare sau operații speciale ale Ministerului Apărării
examinare ori neutralizare a acestora, precum și cel care
desfășoară activități specifice la calamități naturale beneficiază Naționale.
de o primă pentru condiții periculoase de muncă, diferențiată în (3) Personalul militar, polițiștii, funcționarii publici cu statut
funcție de gradul de pericol și/sau de timpul efectiv lucrat în special din sistemul administrației penitenciare și personalul civil
aceste locuri, calculată la solda de funcție/salariul de care desfășoară activități privind prevenirea și combaterea
funcție/salariul de bază, astfel: corupției în rândul personalului propriu beneficiază de o
— locuri de muncă sau operațiuni deosebit de periculoase — compensație de 30% din solda de funcție/salariul de
37—50%; funcție/salariul de bază.
— locuri de muncă sau operațiuni foarte periculoase — (4) Prevederile alin. (3) nu se aplică personalului militar,
16—30%; polițiștilor, funcționarilor publici cu statut special din sistemul
— locuri de muncă sau operațiuni periculoase — până la administrației penitenciare și personalului civil care beneficiază
16%. de compensația prevăzută la alin. (1).
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 87

(5) Unitățile, categoriile de personal, condițiile, criteriile și Art. 21. — (1) Personalul militar, polițiștii, funcționarii publici
mărimea compensației se stabilesc prin ordin al ordonatorului cu statut special din sistemul administrației penitenciare, mutați
principal de credite. sau transferați, în interes de serviciu, într-o altă localitate decât
Art. 15. — (1) Pentru personalul militar, polițiștii, funcționarii cea de domiciliu, individual sau împreună cu unitatea sau
publici cu statut special din sistemul administrației penitenciare subunitatea, au dreptul la:
și personalul civil care execută lucrări de excepție sau misiuni a) o indemnizație de mutare egală cu solda de funcție/salariul
speciale, apreciate ca atare de către conducătorii acestora, se de funcție cuvenită/cuvenit pentru noile funcții în care au fost
acordă o majorare de până la 50% calculată la solda de încadrați;
funcție/salariul de funcție/salariul de bază. b) o indemnizație pentru fiecare membru de familie aflat în
(2) Dreptul prevăzut la alin. (1) poate fi acordat pentru cel întreținere, egală cu 1/4 din solda de funcție/salariul de funcție
mult 5% din numărul total de posturi prevăzute în statele de cuvenită/cuvenit, în luna schimbării domiciliului membrilor de
organizare, în limita a 30% din suma salariilor de bază, a familie;
soldelor de funcție/salariilor de funcție, soldelor de grad/salariilor c) rambursarea costului transportului pentru personalul
gradului profesional deținut, gradațiilor, soldelor de militar, membrii de familie și gospodăria lor;
comandă/salariilor de comandă și a indemnizațiilor de încadrare, d) o permisie, respectiv o învoire plătită de 5 zile lucrătoare,
cumulat pe total buget, pentru fiecare ordonator principal de în vederea mutării efective, acordată la cerere.
credite. (2) Indemnizația de mutare prevăzută la alin. (1) lit. a) se
(3) Condițiile de acordare a dreptului prevăzut la alin. (1) se acordă personalului militar, polițiștilor și funcționarilor publici cu
stabilesc prin norme metodologice aprobate prin ordin al statut special din sistemul administrației penitenciare în luna
ordonatorului principal de credite. schimbării domiciliului.
Art. 16. — Personalul militar, polițiștii, funcționarii publici cu (3) Rambursarea costului transportului pentru personalul
statut special din sistemul administrației penitenciare și militar se efectuează la data prezentării la unitate, iar pentru
membrii de familie și gospodăria lor se efectuează la data
personalul civil, trimiși în interesul serviciului în delegare sau
schimbării domiciliului, în condițiile prevăzute prin ordin al
detașați la aplicații, trageri, instrucție în tabără sau în alte misiuni
ordonatorului principal de credite.
în alte localități decât cele în care se află sediul unității din care
(4) Drepturile prevăzute la alin. (1) se acordă și persoanelor
fac parte, au dreptul la indemnizația de delegare sau de chemate sau rechemate în rândul cadrelor militare în activitate
detașare, precum și la decontarea cheltuielilor de cazare, potrivit ori cărora li se acordă gradul la absolvirea cursului de formare
reglementărilor în vigoare aplicabile personalului din sectorul a cadrelor militare în activitate, persoanelor nou-încadrate sau
bugetar. reintegrate în rândul polițiștilor sau, după caz, funcționarilor
Art. 17. — Drepturile de transport ale personalului militar în publici cu statut special din sistemul administrației penitenciare.
activitate, ale polițiștilor, ale funcționarilor publici cu statut special Indemnizația se calculează în raport cu solda de funcție/salariul
din sistemul administrației penitenciare, ale elevilor și studenților funcție, stabilită/stabilit pentru funcțiile în care acestea sunt
din instituțiile de învățământ pentru formarea polițiștilor și numite.
cursanților din instituțiile de învățământ pentru formarea (5) Cadrele militare în activitate care urmează cursurile unei
funcționarilor publici cu statut special din sistemul administrației instituții de învățământ militar beneficiază, după absolvire, de
penitenciare, precum și ale personalului civil sunt reglementate indemnizația de mutare și de decontarea costului transportului,
prin hotărâre a Guvernului. prevăzute la alin. (1).
Art. 18. — (1) Personalul care lucrează cu cifru de stat (6) La absolvirea instituțiilor de învățământ militar, elevii și
beneficiază de o indemnizație de 15—20% din solda de studenții militari cărora li se acordă grade de ofițeri, maiștri
funcție/salariul de funcție/salariul de bază. militari sau subofițeri ori cei care au obținut asemenea grade pe
(2) Funcțiile pentru care se acordă indemnizația de cifru și timpul școlarizării au dreptul, la prezentarea la unități, la o
mărimea concretă a procentului se stabilesc prin ordin al indemnizație de instalare egală cu solda de funcție/salariul de
ordonatorului principal de credite. funcție stabilită/stabilit pentru funcțiile în care au fost numiți și la
(3) Funcțiile cu drept la indemnizație de cifru se prevăd prin decontarea cheltuielilor de transport pentru ei, membrii de
statele de organizare. familie și gospodăria lor.
(7) Prevederile alin. (6) se aplică în mod corespunzător și
SECȚIUNEA a 3-a polițiștilor și funcționarilor publici cu statut special din sistemul
Drepturi specifice activității desfășurate în instituțiile publice administrației penitenciare.
de apărare, ordine publică și securitate națională (8) Soldații și gradații profesioniști în activitate care au obținut
grade de subofițeri ca urmare a absolvirii unor cursuri
Art. 19. — Pentru realizarea prerogativelor constituționale de beneficiază de indemnizație de instalare numai în situația în
apărare, ordine publică și securitate națională, personalul militar, care nu au beneficiat de indemnizație în condițiile alin. (10).
polițiștii, funcționarii publici cu statut special din sistemul (9) În localitățile izolate sau în zonele unde atragerea
administrației penitenciare și personalul civil beneficiază de personalului se face cu greutate, stabilite prin ordin al
majorarea soldei de funcție/salariului de funcție/salariului de ordonatorului principal de credite, indemnizația prevăzută la
bază cu 7,5%. alin. (6) poate fi la nivelul a două solde de funcție/salarii de
Art. 20. — (1) Pentru activitatea desfășurată în unități situate funcție.
în localități sau în zone izolate ori în unități situate în localități (10) Soldații și gradații profesioniști în activitate, la semnarea
sau zone unde atragerea personalului se face cu greutate, primului contract, beneficiază de o indemnizație de instalare
personalul militar, polițiștii și funcționarii publici cu statut special egală cu solda de funcție cuvenită.
din sistemul administrației penitenciare, precum și personalul (11) Personalul militar care a beneficiat de indemnizația de
civil beneficiază de un spor de până la 20% din solda de instalare și care, ulterior, și-a prezentat demisia înainte de
funcție/salariul de funcție/salariul de bază. împlinirea unui termen de 3 ani de la absolvirea instituțiilor de
(2) Criteriile de stabilire a localităților și zonelor izolate, a învățământ, respectiv de la semnarea primului contract va
localităților și zonelor unde atragerea personalului se face cu restitui indemnizația primită, proporțional cu perioada rămasă
greutate, categoriile de personal și mărimea concretă a sporului până la expirarea termenului de 3 ani. Această prevedere se
se stabilesc conform actelor normative în vigoare, prin ordin al aplică în mod corespunzător și personalului care a urmat cursul
ordonatorului principal de credite. de formare a cadrelor militare în activitate.
88 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

(12) Cadrelor militare trecute în rezervă sau direct în (3) Personalul militar, polițiștii și funcționarii publici cu statut
retragere, în baza art. 85 alin. (1) lit. a)—f) din Legea nr. 80/1995, special din sistemul administrației penitenciare, precum și
cu modificările și completările ulterioare, care își schimbă personalul civil, pentru titlurile de specialist de clasă/domeniu
domiciliul în termen de 12 luni de la data schimbării poziției de funcțional deținute în specialitate, beneficiază de majorarea
activitate, li se rambursează cheltuielile de transport pentru ele, soldei de funcție/salariului de funcție/salariului de bază cu 2,5%,
membrii lor de familie și gospodărie, până la localitatea unde își 5%, respectiv 7,5%, corespunzător clasei a 3-a, clasei a 2-a sau
stabilesc domiciliul. clasei 1.
(13) Polițiștii și funcționarii publici cu statut special din (4) Specialitățile, condițiile de acordare și de retragere a
sistemul administrației penitenciare care au beneficiat de titlului de specialist de clasă/domeniu funcțional, retrogradarea
indemnizația de instalare și care ulterior și-au prezentat demisia dintr-o clasă superioară într-una inferioară, criteriile și
înainte de împlinirea unui termen de 3 ani de la absolvirea standardele de performanță se stabilesc prin ordin al
instituțiilor de învățământ vor restitui indemnizația primită, ordonatorului principal de credite.
proporțional cu perioada rămasă până la expirarea termenului Art. 29. — Maiștrii militari, subofițerii, soldații și gradații
de 3 ani.
profesioniști, agenții de poliție și cei din sistemul administrației
(14) În cazul decesului personalului militar, familia acestuia
penitenciare și personalul contractual care desfășoară activități
are dreptul la rambursarea costului transportului prevăzut la
alin. (1) lit. c), dacă în termen de 12 luni de la data decesului își de conducători de autovehicule, inclusiv cei care conduc
stabilește domiciliul în altă localitate. motociclete cu ataș, care, prin natura muncii, lucrează peste
Art. 22. — Personalul militar, polițiștii și funcționarii publici cu programul normal de lucru, inclusiv în zilele de repaus
statut special din sistemul administrației penitenciare, precum și săptămânal sau în zilele în care, în conformitate cu
personalul civil care au în primire cai sau câini de serviciu au reglementările în vigoare, nu se lucrează, și cărora nu li se poate
dreptul, pe perioada respectivă, la un spor de până la 5% din acorda timp liber corespunzător, au dreptul la o compensație de
solda de funcție/salariul de funcție/salariul de bază. 5—25% din solda de funcție/salariul de funcție/salariul de bază,
Art. 23. — Personalul militar, polițiștii, funcționarii publici cu în conformitate cu normele metodologice aprobate prin ordin al
statut special din sistemul administrației penitenciare și ordonatorului principal de credite.
personalul civil care sunt încadrați în structurile centrale ale
instituțiilor din sistemul național de apărare, ordine publică și SECȚIUNEA a 4-a
securitate națională sau în structuri militare ale NATO sau UE Primele și compensațiile acordate personalului aeronautic
dislocate pe teritoriul României, beneficiază de majorarea soldei
de funcție/salariului de funcție/salariului de bază cu 12,5%. Art. 30. — Personalul aeronavigant definit la art. 8, 17 și 31
Art. 24. — Pe perioada în care își desfășoară activitatea în din Legea nr. 35/1990 privind Statutul personalului aeronautic
structurile instituțiilor din sistemul de apărare, ordine publică și din aviația militară a României, cu modificările și completările
securitate națională, preoții militari sunt asimilați ofițerilor și ulterioare, denumit în continuare Statut, încadrat potrivit statului
beneficiază de solda de funcție/salariul de funcție, solda de de organizare, în funcții specifice categoriei de personal
grad/salariul gradului profesional deținut, gradații și, după caz, aeronautic din care face parte și care desfășoară efectiv
solda de comandă/salariul de comandă, de compensațiile, activități aeronautice, beneficiază, în condițiile prevăzute de
primele, sporurile, indemnizațiile și de alte drepturi salariale Statut, de următoarele prime:
prevăzute de prezenta lege. a) prima de clasificare;
Art. 25. — Polițiștii și funcționarii publici cu statut special din b) prima orară de zbor;
sistemul administrației penitenciare care asigură paza, c) prima de parașutare;
escortarea și supravegherea deținuților, reținuților, arestaților d) prima specială pentru încercarea, recepția și verificarea
preventiv și a minorilor condamnați în penitenciare sau internați în zbor a tehnicii aeronautice.
în centre de reeducare minori, în spitale-penitenciare, în secții Art. 31. — (1) Prima de clasificare se acordă lunar
sau ateliere de producție, în puncte de lucru ori în perioada în personalului navigant de aviație și parașutiștilor militari, în
care se află în mijloace de transport au dreptul, pe timpul efectiv limitele a 8—30% din solda de funcție, diferențiată în raport cu
prestat în astfel de condiții, la o indemnizație pentru pază și titlul de clasificare deținut, categoria de personal navigant,
supraveghere de 5% din salariul de funcție. aeronave și activități.
Art. 26. — De indemnizația prevăzută la art. 25 beneficiază (2) Pentru militarii în termen, prima de clasificare se
și membrii grupelor de intervenție, precum și cei care sunt calculează la solda de funcție minimă cuvenită unui soldat
desemnați să-și desfășoare activitatea în cadrul grupelor de gradat profesionist, cu o gradație.
intervenție la unitățile unde funcțiile prevăzute în statele de Art. 32. — (1) Prima orară de zbor se acordă tuturor
organizare nu sunt încadrate. categoriilor și specialităților de personal navigant de aviație,
Art. 27. — Guvernul României este abilitat să stabilească și definite la art. 9 și 17 din Statut, astfel:
alte drepturi salariale specifice pentru personalul instituțiilor
a) prima orară de zbor se acordă pilotului comandant de
publice de apărare, ordine publică și securitate națională, la
bord, diferențiat în funcție de categoria de aeronave și de
propunerea conducătorilor acestora.
Art. 28. — (1) Pentru asigurarea condițiilor de îndeplinire a condițiile de zbor, în procente cuprinse între 2—10% din 1/3 a
misiunilor specifice instituțiilor de apărare, ordine publică și soldei de funcție prevăzute în statul de organizare pentru
securitate națională, în raport cu standardele de performanță comandantul de escadrilă/similar;
profesională, personalului militar, polițiștilor și funcționarilor b) pentru zborurile executate în echipaj, membrii acestora au
publici cu statut special din sistemul administrației penitenciare, dreptul la prima orară de zbor, calculată în limitele a 50—85%
precum și personalului civil, li se poate acorda titlul de specialist din prima orară de zbor a pilotului comandant de bord, în raport
de clasă/domeniu funcțional. cu categoria de personal navigant și cu activitățile pe care le
(2) Titlul de specialist de clasă/domeniu funcțional este desfășoară la bordul aeronavei.
ierarhizat, în ordinea crescătoare a calificării, pe trei niveluri: (2) În funcție de tipul și de dificultatea misiunii de zbor, de
clasa a 3-a, clasa a 2-a, clasa 1. Acesta se obține/menține condițiile în care se execută zborul și de categoria de aeronave
potrivit condițiilor, criteriilor și standardelor de performanță respectivă, prima orară de zbor stabilită la alin. (1) se majorează
stabilite pentru clasa respectivă, prin ordin al ordonatorului în limitele a 50—200%, în condițiile stabilite prin ordin al
principal de credite. ordonatorului principal de credite.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 89

(3) Drepturile salariale prevăzute la alin. (1) și (2) se acordă soldei de funcție prevăzute în statul de organizare pentru
în același cuantum ambilor piloți de pe aeronave de instrucție și comandantul de batalion parașutiști/similar, după cum urmează:
de luptă, în cazul zborurilor de încercare, recepție și verificare a i) pentru fiecare parașutare de omologare a produselor
aeronavelor, pentru cercetarea meteorologică, demonstrative prototip și serie zero, în limitele a 10—20%, în funcție
sau în cadrul aplicațiilor și antrenamentelor. de categoria și tipul de parașută;
(4) Pentru misiunile executate cu aeronave peste hotare sau ii) pentru fiecare parașutare de recepție și verificare a
în cadrul companiilor civile de transport aerian, drepturile produselor noi, în limitele a 5—10%, în funcție de
salariale prevăzute la alin. (1) și (2) se acordă, pentru întregul categoria și tipul de parașută;
traiect de zbor, în cuantumurile prevăzute de reglementările în c) pentru zborurile de încercare a unei aeronave după
vigoare pentru aviația civilă. reparația capitală sau medie, pentru recepția unei aeronave noi
(5) Prima orară de zbor se plătește în funcție de durata sau reparate, precum și pentru verificarea după executarea unor
lucrări de importanță majoră (lucrări regulamentare, schimbări
misiunii de zbor rezultată din registrele de cronometraj. În
de agregate de motoare) se acordă prime speciale, calculate în
cazurile în care calificativele obținute în urma executării
limitele a 4—18% din 1/3 a soldei de funcție prevăzute în statul
zborurilor nu sunt pozitive, durata acestora nu se ia în calcul la de organizare pentru comandantul escadrilei de aviație/similar,
plata primelor orare de zbor. la categoria respectivă de aeronave;
Art. 33. — (1) Prima de parașutare se acordă lunar tuturor d) pentru parașutările executate în scopul recepției
categoriilor și specialităților de personal aeronavigant, definite parașutelor după reparația capitală sau medie, precum și pentru
la art. 9, 10 și 17 din Statut, în procente cuprinse între 2—8% din verificările prin parașutare a produselor la care s-au executat
1/3 a soldei de funcție prevăzute în statul de organizare pentru lucrări de importanță majoră, parașutiștilor li se acordă prime
comandantul de batalion parașutiști/similar, pentru fiecare speciale în procente față de 1/3 a soldei de funcție prevăzute în
parașutare executată, diferențiat în raport cu condițiile de statul de organizare pentru comandantul de batalion
lansare și aterizare, cu condițiile de zbor și meteorologice și cu parașutiști/similar, în limitele a 4—8%.
dificultatea lansării. (2) Primele speciale stabilite la alin. (1) lit. a) și c) se acordă
(2) Pentru parașutările executate sub formă de exerciții membrilor echipajului în cuantum de 75% din prima pilotului
combinate, cu acționarea comenzii manuale, cu deschiderea comandant de bord, iar pentru încercarea sau recepția
parașutei de rezervă, cu lansarea cu container de luptă sau aeronavelor de instrucție și de luptă, integral ambilor piloți.
materiale și de la înălțimi și viteze periculoase de lansare, Art. 35. — Personalul aeronautic nenavigant, definit la
personalului aeronavigant definit la art. 9, 10 și 17 din Statut i se art. 12, 17 și 31 din Statut, încadrat, potrivit statului de
acordă compensații în procente cuprinse între 1—5% din 1/3 a organizare, în funcții specifice categoriei de personal aeronautic
soldei de funcție prevăzute în statul de organizare pentru din care face parte și care desfășoară efectiv activități
comandantul de batalion parașutiști/similar. aeronautice, beneficiază în condițiile prevăzute de statut de
(3) Pentru catapultarea din aeronavă, piloților li se acordă următoarele prime:
a) prima de clasificare;
prime echivalente cu:
b) prima de specializare;
a) suma soldei de funcție, soldei de grad, gradațiilor și, după
c) prima pentru asigurarea activităților aeronautice.
caz, a soldei de comandă, în cazul catapultării ca urmare a unui Art. 36. — Prima de clasificare se acordă lunar personalului
caz de forță majoră prevăzut în instrucțiunile de pilotaj; aeronautic nenavigant, cu excepția inginerilor și subinginerilor,
b) de două ori suma prevăzută la lit. a), în cazul catapultării în limitele a 5—19% din solda de funcție, diferențiat în raport cu
de încercare-testare sau recepție a sistemelor de salvare. titlul de clasificare deținut, categoria de personal nenavigant și
Art. 34. — (1) Prima specială pentru încercarea, recepția și categoria de tehnică aeronautică.
verificarea în zbor a tehnicii aeronautice se acordă tuturor Art. 37. — Prima de specializare se acordă lunar ofițerilor
categoriilor și specialităților de personal aeronavigant, definite ingineri și subingineri de aviație, de transmisiuni aeronautice și
la art. 8 și 17 din Statut, astfel: protecția navigației aeriene, în limitele a 8—22% din solda de
a) pentru zborurile de încercare, recepție și verificare a funcție, diferențiat în raport cu titlul de specializare deținut,
aeronavelor prototip și a celor nou-construite, personalului categoria de personal nenavigant și categoria de tehnică
navigant de aviație i se acordă prime speciale, calculate în aeronautică.
procente față de 1/3 a soldei de funcție prevăzute în statul de Art. 38. — (1) Primele pentru asigurarea activităților
organizare pentru comandantul escadrilei de aviație/similar, la aeronautice se acordă tuturor categoriilor și specialităților de
categoria respectivă de aeronave, după cum urmează: personal aeronautic nenavigant, definite la art. 12 și 17 din
i) pentru primul zbor al unei aeronave prototip, în Statut, precum și inginerilor, subinginerilor și tehnicienilor de
limitele a 200—500%, în funcție de categoria de bord, astfel:
aeronave; a) prima de aterizare se acordă lunar personalului tehnic-
ii) pentru primul zbor al unei aeronave nou-construite, ingineresc de aviație, definit la art. 13 și 17 din Statut, din unități
în limitele a 30—70%, în funcție de categoria de (similare) care execută activități de pregătire pentru zbor a
aeronave; aeronavelor, exploatează la sol și în zbor aeronave, exploatează
și întrețin mijloace tehnice de aerodrom, echipamente de
iii) pentru fiecare zbor de încercare a unei aeronave
altitudine și de prevenire a evenimentelor de zbor prin mijloace
nou-construite, prevăzut în programele de încercare
tehnice de control obiectiv, diferențiat pe categorii de funcții ale
pentru omologare sau de casă (cu excepția primului personalului și tipuri de aeronave, în limitele a 0,04—3% din 1/3
zbor), în limitele a 5—20%, în funcție de categoria de a soldei de funcție, pentru fiecare aterizare urmată de refacerea
aeronave; capacității de zbor;
iv) pentru fiecare zbor de încercare a produselor noi de b) pentru aterizările executate în cadrul starturilor de noapte,
aviație (motoare, sisteme de salvare, rachete, prima de aterizare prevăzută la lit. a) se majorează cu 50%;
muniții, bombe, instalații de armament și anvelope), c) pentru personalul tehnic-ingineresc de aviație care
în limitele a 4—15%; operează tehnica de avioane fără pilot, prima de aterizare
b) pentru parașutările executate în scopul încercării, recepției (lansare) reprezintă un cuantum în limitele a 5—40% din solda
și verificării parașutelor prototip sau nou-construite, parașutiștilor de funcție, pentru fiecare lansare, diferențiat pe categorii și tipuri
li se acordă prime speciale, calculate în procente față de 1/3 a de avioane fără pilot;
90 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

d) personalul aeronautic care execută activități de exploatare profesionale sau a unor defecțiuni cauzate de activitățile
a simulatoarelor de zbor beneficiază de o primă pentru asigurare aeronautice desfășurate, personalul aeronautic beneficiază de:
tehnică, în cuantum de 0,10—0,50% din solda de funcție, pentru a) toate drepturile prevăzute pentru categoria de personal
fiecare oră de funcționare a simulatorului în procesul de instruire aeronautic din care face parte, pe timpul recuperării capacității
a personalului navigant, diferențiat pe categorii și tipuri de de muncă, până la stabilirea situației medico-militare, fără a se
simulatoare; depăși însă durata de 2 ani;
e) soldații și gradații profesioniști în activitate, precum și b) o compensație la suma soldei de funcție, soldei de grad,
militarii în termen, calificați, care desfășoară activități de gradațiilor și, după caz, a soldei de comandă, astfel încât noile
asigurare tehnică de aviație, beneficiază lunar de o primă de drepturi salariale să nu se micșoreze, în cazul în care
aterizare în limitele a 0,5—2,5% din solda de funcție desfășoară alte activități militare decât cele specifice categoriei
corespunzătoare gradului de caporal clasa I, pentru fiecare de personal aeronautic din care face parte, până la limita de
aterizare, urmată de refacerea capacității de zbor, diferențiat pe vârstă prevăzută la art. 45 din Statut.
categorii de aeronave și activități; (2) Compensația reprezintă diferența dintre suma soldei de
f) prima pentru asigurarea tehnică a zborului se acordă lunar funcție, soldei de grad, gradațiilor și, după caz, a soldei de
personalului tehnic-ingineresc de aviație, definit la art. 13 și 17 comandă și prima de clasificare, cumulate, avute ca personal
din Statut, care execută lucrări regulamentare, periodice și de aeronautic, și suma soldei de funcție, soldei de grad, gradațiilor
întreținere, reparații curente și modernizări ale tehnicii de aviație, și, după caz, a soldei de comandă cuvenite pentru funcția în
precum și activități de conducere a proceselor de exploatare, care este încadrat cel în cauză.
reparare-fabricare, asimilare și experimentare a tehnicii de (3) Prevederile alin. (1) lit. b) se aplică pentru personalul
aviație și de asigurare cu tehnică de aviație. Face excepție aeronautic care are o vechime efectivă în serviciu de cel puțin
personalul tehnic-ingineresc de aviație din unitățile de reparare- 80% din vechimea minimă prevăzută de legislația în vigoare
fabricare a tehnicii aeronautice și din comisiile de reprezentanți pentru pensionare.
militari de pe lângă acestea, în funcție de numărul orelor de zbor Art. 40. — (1) În conformitate cu art. 57 din Statut,
realizate, la eșalonul respectiv, diferențiat pe categorii de prevederile prezentei secțiuni se aplică în mod corespunzător
personal și categorii de aeronave, în limitele a 0,003—0,1% din personalului aeronautic din Ministerul Apărării Naționale
solda de funcție, pentru ora de zbor; încadrat, potrivit statului de organizare, în funcții specifice
g) pentru personalul de comandă din unitățile care operează categoriei de personal aeronautic din care face parte și care
tehnica de avioane fără pilot se acordă, la sfârșitul fiecărui an, desfășoară efectiv activități aeronautice, precum și militarilor din
o primă pentru asigurarea zborului, egală cu valoarea soldei de unitățile de toate armele și celor detașați în afara Ministerului
funcție, în vigoare în luna decembrie, proporțional cu Apărării Naționale, care execută activități aeronautice militare.
îndeplinirea planului anual de lansări ale avioanelor; (2) Pentru personalul aeronautic definit de Statut, care
h) prima de reparații se acordă lunar personalului tehnic- participă la misiuni și operații în afara teritoriului statului român,
ingineresc de aviație, de transmisiuni aeronautice și protecția prevederile art. 30—39 se aplică în mod corespunzător.
navigației aeriene din unitățile de reparare-fabricare a tehnicii (3) Baza de calcul al primelor și compensațiilor acordate în
aeronautice și comisiile de reprezentanți militari de pe lângă lei personalului aeronautic prevăzut la alin. (2) se constituie, în
acestea, care execută sau conduc activități de reparații, mod corespunzător, din solda de funcție prevăzută de statul de
modernizări, proiectare, fabricare, asimilare și experimentare a organizare sau, după caz, prin ordinul de numire/detașare
tehnicii aeronautice militare, precum și recepția acesteia din pentru fiecare participant la misiuni în afara teritoriului statului
fabricație și reparație, în funcție de tehnica reparată, fabricată român.
și recepționată, diferențiat pe categorii de personal și în raport (4) Personalul aeronautic trimis în misiune permanentă în
cu complexitatea lucrărilor, în procent de 0,2—15% din solda de străinătate, care încadrează funcțiile alocate României în cadrul
funcție, pentru fiecare produs recepționat de beneficiar; Grupului de transport aerian de mare capacitate (HAW),
i) prima de start se acordă lunar meteorologilor, personalului beneficiază de următoarele drepturi în valută:
tehnic de transmisiuni aeronautice și protecția navigației aeriene a) personalului navigant, așa cum este definit la art. 8 și 31
și personalului tehnic auto care execută, organizează sau din Statut, i se acordă o primă orară de zbor la nivelul a 1% din
conduc activități specifice asigurării starturilor de zbor cu salariul lunar în valută. Pentru misiunile executate în zonele de
aeronave militare, în funcție de numărul de starturi de zbor conflict sau în teatrele de operații, prima orară de zbor se
executate/misiuni independente, în limitele a 1—2% din solda mărește cu 100%. Prima orară de zbor se plătește în funcție de
de funcție, pentru fiecare start, diferențiat pe categorii de durata zborului rezultată din registrele de cronometraj sau din
personal și aeronave; documentele similare utilizate de HAW. Pentru catapultarea din
j) prima de dirijare se acordă lunar navigatorilor de sol pentru aeronavă, piloților li se acordă o primă egală cu un salariu lunar
conducerea, dirijarea și coordonarea activității de zbor a în valută;
aeronavelor militare, în funcție de numărul de aeronave b) personalului aeronautic nenavigant, așa cum este definit
conduse, dirijate sau coordonate, în limitele a 0,02—2% din la art. 12 din Statut, care execută activități de pregătire pentru
solda de funcție, diferențiat pe categorii de personal, tehnică zbor a aeronavelor, exploatează la sol și în zbor aeronave,
aeronautică și activități. exploatează și întreține mijloace tehnice de aerodrom,
(2) Prin start executat se înțelege startul îndeplinit în echipamente de altitudine și de prevenire a evenimentelor de
proporție de cel puțin 50% din durata planificată, la care zbor, i se acordă o primă de aterizare la nivelul a 1% din salariul
specialistul respectiv a desfășurat activități specifice de lunar în valută, pentru fiecare aterizare. Pentru aterizările
asigurare a zborului. executate în cadrul starturilor de noapte, prima de aterizare se
(3) Prin misiune independentă se înțelege zborul executat la majorează cu 50%;
ordin de o aeronavă izolată sau, după caz, formație de c) personalului tehnic-ingineresc de aviație, așa cum este
aeronave, la care specialistul respectiv a desfășurat activități definit la art. 13 din Statut, care execută lucrări de exploatare,
specifice de asigurare a zborului. întrețineri curente și reparații ale tehnicii de aviație, i se acordă
Art. 39. — (1) În cazul imposibilității desfășurării activităților o primă pentru asigurarea tehnică a zborului la nivelul a 0,1% din
aeronautice specifice categoriei de personal aeronautic din care salariul lunar în valută, pentru fiecare oră de zbor asigurată
face parte, ca urmare a unui eveniment de aviație, a unei boli tehnic.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 91

(5) Condițiile de acordare a primelor și compensațiilor de Art. 43. — Membrii echipajelor de pe nave care conduc,
care beneficiază personalul aeronautic, precum și diferențierea coordonează, evaluează sau execută efectiv manevrele de
procentelor/cuantumurilor în cadrul limitelor prevăzute în plecare și de acostare, precum și alte manevre și activități
prezenta secțiune, pe categorii de personal, tehnică aeronautică periculoase beneficiază de o primă egală cu 50% din solda de
și activități, se stabilesc prin norme aprobate de ordonatorul funcție/salariul de bază zilnic, indiferent de numărul de manevre
principal de credite. din zona respectivă.
Art. 41. — (1) Dispozițiile prezentei secțiuni se aplică în mod §2. Drepturile bănești specifice personalului care execută
corespunzător întregului personal aeronautic militar și polițiștilor salturi din elicoptere în apă și scafandrilor
care își desfășoară activitatea în condiții similare. Art. 44. — Personalul care execută salturi din elicoptere în
(2) Pentru personalul, altul decât cel prevăzut la art. 30, se apă are dreptul, pentru fiecare salt, la o primă, astfel:
acordă următoarele prime pentru coborârile pe frânghie din a) personalul militar și personalul civil — 1% din solda de
elicopter: funcție prevăzută în statul de organizare pentru comandantul
a) pentru personalul care execută rapel din elicopter, 2% din unității de scafandri;
solda de funcție/salariul de funcție al comandantului/șefului b) elevii și studenții instituțiilor de învățământ pentru formarea
unității din care face parte personalul respectiv, pentru fiecare personalului militar — 1% din solda de funcție minimă cuvenită
coborâre; unui soldat gradat profesionist.
b) pentru personalul care execută coborâre rapidă pe Art. 45. — (1) Scafandrii militari și civili brevetați beneficiază
frânghie din elicopter, 3% din solda de funcție/salariul de funcție de o primă de clasificare în limitele a 5—30% din solda de
al comandantului/șefului unității din care face parte personalul funcție/salariul de bază, diferențiat în raport cu titlul de clasificare
respectiv, pentru fiecare coborâre. deținut.
(2) Scafandrii brevetați și scafandrii cursanți au dreptul
SECȚIUNEA a 5-a
pentru orice scufundare reală sau în simulatoare, care cuprinde
Drepturile bănești specifice personalului ambarcat, timpul compresiei, lucrul efectiv și decompresia, la o primă orară
ale celui care execută salturi din elicoptere în apă sau zilnică, în procente, din 1/3 a soldei de funcție prevăzute în
și ale scafandrilor din marina militară statul de organizare pentru comandantul de divizion scafandri,
§1. Drepturile bănești specifice personalului ambarcat pe astfel:
nave de suprafață a) pentru scufundarea autonomă cu circuit deschis,
Art. 42. — (1) Personalul din subunitățile și unitățile marinei scufundarea cu alimentare de la suprafață sau scufundarea cu
militare, ambarcat pe nave de suprafață, are dreptul la o primă turela deschisă, o primă orară de 1—5%;
de ambarcare, astfel: b) pentru scufundarea autonomă cu circuit semiînchis,
a) pe timpul cât navele se află în baza lor permanentă: o primă orară de 1,5—6%;
(i) personalul militar și personalul civil — 15% din solda c) pentru scufundarea autonomă cu circuit închis, o primă
de funcție/salariul de bază; orară de 2—3%;
(ii) elevii și studenții instituțiilor de învățământ pentru d) pentru scufundarea unitară cu turela închisă, scufundarea
formarea personalului militar — 10% din solda de unitară cu minisubmarin sau scufundarea unitară în simulatoare,
funcție minimă cuvenită unui soldat gradat o primă orară de 3—7%;
profesionist; e) pentru scufundarea în saturație, o primă zilnică de
b) pe timpul cât navele se deplasează din baza lor 12—50%.
permanentă pentru instrucții, aplicații sau alte misiuni, pe lângă (3) Pentru scufundările reale, executate de scafandrii de
drepturile prevăzute la lit. a), mai beneficiază de: mare adâncime, în scop de antrenament, prima se diminuează
(i) personalul militar și personalul civil — 15% din solda cu 20%.
de funcție/salariul de bază; (4) Pentru scufundările reale care se execută în apă, cu
(ii) elevii și studenții instituțiilor de învățământ pentru temperatura mai mică de 10ºC, precum și pentru cele de testare
formarea personalului militar — 10% din solda de de noi procedee, echipamente sau aparatură de scufundare,
funcție minimă cuvenită unui soldat gradat prima de scufundare se majorează cu 25%.
profesionist. (5) Pentru scufundări reale în cadrul misiunilor de tip EOD,
(2) Prin personal ambarcat se înțelege personalul încadrat prima se majorează cu 100%.
potrivit statelor de organizare ale navelor respective, precum și Art. 46. — (1) Scafandrii lansați sau recuperați din/de vedete
cel ambarcat pentru diverse misiuni, inspecții, controale, rapide, submarin sau elicopter beneficiază de o primă de salt
verificări, reparații ordonate sau planificate de organele sau de recuperare, în procente, din 1/3 a soldei de funcție
competente în documentele care atestă prezența la bordul prevăzută în statul de organizare pentru comandantul de
navelor. divizion scafandri, astfel:

/DQVDUH
9HGHWă (OLFRSWHU 6XEPDULQ
5HFXSHUDUH
 7XE
9LWH]ă 6WD‫܊‬LRQDUH (YROX‫܊‬LH 6DV ODQVDUH
WRUSLOă
 1G 1G    
      
&XPLFXOHFKLSDPHQW      
&X HFKLSDPHQW      
FRPSOHW

(2) Pentru misiunile de luptă reale, prima de salt sau de recuperare se majorează cu 100%.
92 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

Art. 47. — Membrii echipajelor submersibilelor de cercetare și de celelalte drepturi aplicabile personalului din instituția de
și intervenție, precum și personalul de altă specialitate, care, învățământ, cu excepția soldei de comandă/salariului de
prin natura funcției, execută imersiuni în incintă nepresurizată, comandă, în condițiile stabilite prin ordin al ordonatorului
au dreptul la o primă orară de 2,5—5% din solda de funcție principal de credite.
prevăzută în statul de organizare pentru comandantul de (2) Personalul militar, polițiștii și funcționarii publici cu statut
divizion scafandri. special din sistemul administrației penitenciare care urmează
Art. 48. — Membrii echipei de suprafață care asigură cursuri de carieră și nivel, precum și alte activități de
scufundările din punct de vedere organizatoric, tehnic și perfecționare sau formare continuă beneficiază de solda de
medical, stabiliți în conformitate cu normele de organizare și funcție/salariul de funcție și, după caz, solda de
conducere a activităților de scufundare din unitatea de scafandri, comandă/salariul de comandă avute la data începerii cursurilor,
au dreptul la o primă orară sau zilnică de 10—25% din prima de de solda de grad/salariul gradului profesional deținut, de gradații
scufundare orară sau zilnică de care beneficiază scafandrii și de celelalte drepturi salariale avute, în condițiile prevăzute prin
brevetați. ordin al ordonatorului principal de credite. .
Art. 49. — Prima orară sau zilnică de scufundare se acordă (3) Drepturile prevăzute la alin. (1) și (2) se mențin și pe
și personalului de altă specialitate care, prin natura atribuțiilor perioada stagiului la unități.
de serviciu, execută scufundări reale sau în simulatoare. (4) Elevii și studenții instituțiilor de învățământ superior pentru
Art. 50. — Condițiile de acordare a primei de clasificare și a formarea personalului militar după obținerea gradului de ofițer
primei de scufundare, precum și diferențierea cuantumurilor în beneficiază de solda gradului acordat.
cadrul limitelor prevăzute în prezenta secțiune, pe categorii de (5) Personalul contractual care participă la cursuri sau stagii
personal și activități, se stabilesc prin norme aprobate prin ordin de formare profesională cu scoatere integrală din activitate, cu
al ordonatorului principal de credite. acordul și în interesul autorităților sau instituțiilor publice de
Art. 51. — Pe timpul desfășurării activităților de control la apărare, ordine publică și securitate națională, beneficiază, în
bordul navelor românești și străine în cadrul misiunilor de luptă, această perioadă, de o indemnizație egală cu salariul de bază,
reglementate prin ordin al ordonatorului principal de credite, indemnizațiile, compensațiile și sporurile acordate în luna
personalul echipelor specializate beneficiază de o compensație anterioară trimiterii la aceste forme de pregătire profesională,
de 30% din solda de funcție. cu excepția celor care se acordă în raport cu timpul efectiv
§3. Drepturile personalului ambarcat pe submarine lucrat.
Art. 52. — Personalul militar și personalul civil beneficiază (6) Pentru ofițerii care, în timp ce urmează cursurile
de o primă de ambarcare de 30% din solda de funcție/salariul de instituțiilor de învățământ superior militare sau civile, precum și
bază, iar elevii și studenții instituțiilor de învățământ pentru doctoratul, sunt înaintați în grad sau pentru maiștrii militari și
formarea personalului militar de o primă de ambarcare de 10% subofițerii aflați în această situație când li se acordă grade de
din solda de funcție minimă cuvenită unui soldat gradat ofițeri, solda de funcție a acestora nu poate fi mai mică decât
profesionist. solda de funcție minimă prevăzută pentru gradul respectiv.
Art. 53. — (1) Pe timpul navigației în imersiune, personalul (7) Pentru polițiștii și funcționarii publici cu statut special din
militar și personalul civil beneficiază de o primă orară de sistemul administrației penitenciare care, în timp ce urmează
imersiune de 2% din solda de funcție prevăzută în statul de cursurile instituțiilor de învățământ superior, precum și
organizare pentru comandantul submarinului, iar elevii și doctoratul, sunt avansați în grad profesional sau pentru polițiștii
studenții instituțiilor de învățământ pentru formarea personalului și funcționarii publici cu statut special din sistemul administrației
militar, de o primă de imersiune de 10% din solda de funcție penitenciare cărora li se acordă grade profesionale superioare,
minimă cuvenită unui soldat gradat profesionist. salariul de funcție al acestora nu poate fi mai mic decât salariul
(2) Pentru navigația submarinului la adâncimi cuprinse între de funcție minim prevăzut pentru gradul profesional respectiv.
100—200 m, prima orară de imersiune se dublează, iar pentru (8) Solda de funcție, solda de grad, gradațiile și, după caz,
navigația la adâncimi de peste 200 m, aceasta se triplează. solda de comandă, precum și alte drepturi salariale pentru
(3) Pentru fiecare intrare sau ieșire în/din imersiune se personalul militar detașat la alte unități în vederea îndeplinirii
adaugă 30% din valoarea primei orare de imersiune. atribuțiilor unor funcții sau a unor misiuni se stabilesc și se
Art. 54. — Personalul ambarcat pe submarine care participă plătesc de unitățile de la care acesta este detașat.
la proba de imersiune la mare adâncime beneficiază de o primă Art. 58. — (1) Cadrele militare în activitate, polițiștii și
egală cu două solde de funcție ale comandantului de submarin. funcționarii publici cu statut special din sistemul administrației
Art. 55. — Pentru ieșirea din submarinul avariat, membrii penitenciare care sunt puși la dispoziție în situații temeinic
echipajului primesc o primă echivalentă cu 4 solde de funcție justificate, potrivit legii, beneficiază de solda de funcție
ale comandantului de submarin. avută/salariul de funcție avut, solda de grad/salariul gradului
Art. 56. — Dispozițiile prezentei secțiuni se aplică în mod profesional deținut, gradații, precum și de celelalte drepturi
corespunzător și polițiștilor și funcționarilor publici cu statut salariale avute, cu excepția soldei de comandă/salariului de
special din sistemul administrației penitenciare care își comandă, în condițiile prevăzute prin norme metodologice
desfășoară activitatea în situații similare, în condițiile stabilite aprobate prin ordin al ordonatorului principal de credite.
prin ordin al ordonatorului principal de credite. (2) Prevederile alin. (1) se aplică și cadrelor militare în
SECȚIUNEA a 6-a activitate puse la dispoziție ca efect al începerii urmăririi penale.
Art. 59. — (1) Cadrele militare trecute în rezervă sau direct
Drepturile salariale cuvenite pe timpul studiilor și în alte situații
în retragere primesc solda de funcție, solda de grad, gradațiile
Art. 57. — (1) Cadrele militare în activitate, polițiștii și și, după caz, solda de comandă, precum și celelalte drepturi
funcționarii publici cu statut special din sistemul administrației salariale prevăzute de normele metodologice aprobate prin ordin
penitenciare, pe timpul cât urmează cursuri de zi în cadrul al ordonatorului principal de credite, până la sfârșitul lunii în care
instituțiilor de învățământ superior, cu acordul și în interesul a avut loc schimbarea poziției de activitate.
autorităților sau instituțiilor publice de apărare, ordine publică și (2) Termenul legal de predare a funcției începe de la data
securitate națională, beneficiază de solda de funcție/salariul de schimbării poziției de activitate. Dacă termenul legal de predare
funcție avută/avut la data începerii cursurilor, de solda de a funcției depășește luna respectivă, plata drepturilor bănești
grad/salariul gradului profesional deținut și de gradații, precum prevăzute la alin. (1) se face, în continuare, până la terminarea
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 93

predării, fără a depăși acest termen. Termenul legal de predare (3) În cazul în care s-a dispus scoaterea de sub urmărire
a funcției nu poate depăși 22 de zile lucrătoare. penală ori achitarea, precum și în cazul încetării urmăririi penale
(3) În situațiile prevăzute la alin. (1) și (2), pentru cadrele ori a procesului penal, persoanele cărora li s-au aplicat
militare înaintate în grad în activitate și trecute în rezervă cu prevederile alin. (1) și (2) vor fi repuse în toate drepturile bănești
aceeași dată, drepturile salariale se stabilesc, proporțional, în avute la data punerii la dispoziție, respectiv a suspendării din
raport cu noul grad. funcție, inclusiv compensarea drepturilor salariale de care au
(4) Cadrele militare prevăzute la alin. (1) trecute în rezervă fost private pe perioada punerii la dispoziție, respectiv a
sau direct în retragere, din inițiativa lor ori pentru motive suspendării din funcție, actualizate potrivit majorărilor sau
imputabile acestora, primesc solda de funcție, solda de grad, indexărilor salariale.
gradațiile și, după caz, solda de comandă, precum și alte Art. 61. — În caz de deces, drepturile bănești cuvenite
drepturi salariale prevăzute de normele metodologice aprobate
personalului militar, polițiștilor, funcționarilor publici cu statut
prin ordin al ordonatorului principal de credite, până la data
special din sistemul administrației penitenciare și personalului
schimbării poziției de activitate. Situațiile prevăzute la prezentul
alineat sunt reglementate, în limitele legii, prin norme civil se plătesc, pentru întreaga lună în care a avut loc decesul,
metodologice aprobate prin ordin al ordonatorului principal de după caz, soțului supraviețuitor, copiilor sau părinților, iar în lipsa
credite. acestora, celorlalți moștenitori legali.
(5) Prevederile alin. (1), (3) și (4) se aplică, în mod Art. 62. — Drepturile neachitate personalului militar,
corespunzător, polițiștilor și funcționarilor publici cu statut special polițiștilor, funcționarilor publici cu statut special din sistemul
din sistemul administrației penitenciare, cărora le încetează administrației penitenciare și personalului civil, nereclamate în
raporturile de serviciu. termen de 3 ani de la data când trebuiau plătite, se prescriu.
Art. 60. — (1) Personalul militar, polițiștii și funcționarii publici
cu statut special din sistemul administrației penitenciare puși la SECȚIUNEA a 7-a
dispoziție, potrivit legii, ca urmare a punerii în mișcare a acțiunii Drepturile bănești cuvenite militarilor în termen,
penale, ca efect al trimiterii în judecata unei instanțe penale, în soldaților și gradaților profesioniști care urmează
stare de libertate, precum și cel eliberat pe cauțiune, după caz, modulul instruirii individuale, elevilor și studenților
beneficiază de solda de funcție/salariul de funcție minimă/minim instituțiilor militare de învățământ, elevilor și studenților din
corespunzătoare/corespunzător gradului deținut, de solda de instituțiile de învățământ pentru formarea polițiștilor,
grad/salariul gradului profesional deținut, de gradațiile cuvenite, respectiv ale cursanților din instituțiile de învățământ
precum și de alte drepturi salariale prevăzute de normele pentru formarea funcționarilor publici cu statut special
metodologice aprobate de ordonatorul principal de credite, până din sistemul administrației penitenciare
la definitivarea situației.
(2) Personalului militar, polițiștilor și funcționarilor publici cu Art. 63. — (1) Elevii și studenții din instituțiile militare de
statut special din sistemul administrației penitenciare, arestați, le învățământ, persoanele care urmează cursurile de formare a
încetează plata drepturilor salariale începând cu data cadrelor militare și militarii în termen beneficiază de o
suspendării din funcție. indemnizație lunară, stabilită astfel:

,QGHPQL]D‫܊‬LHOHL
,QVWLWX‫܊‬LLGHvQYă‫܊‬ăPkQW
$QXO, $QXO,, $QXO,,, $QXO,9
‫܇‬FROLPLOLWDUHGHPDL‫܈‬WULPLOLWDUL‫܈‬LVXERIL‫܊‬HUL    
$FDGHPLL‫܈‬LLQVWLWX‫܊‬LLGHvQYă‫܊‬ăPkQWVXSHULRU    
‫܇‬FROLPLOLWDUHGHRIL‫܊‬HULGHUH]HUYă 

(2) Prevederile alin. (1) se aplică în mod corespunzător și elevilor și studenților din instituțiile de învățământ pentru formarea
polițiștilor, respectiv cursanților din instituțiile de învățământ pentru formarea funcționarilor publici cu statut special din sistemul
administrației penitenciare.
(3) Elevii și studenții instituțiilor militare de învățământ pentru formarea cadrelor militare, ai instituțiilor de învățământ pentru
formarea polițiștilor, respectiv cursanții din instituțiile de învățământ pentru formarea funcționarilor publici cu statut special din
sistemul administrației penitenciare care sunt numiți în funcțiile prevăzute mai jos primesc, începând cu data de întâi a lunii
următoare numirii în funcție, pe lângă indemnizația lunară, și o indemnizație suplimentară diferențiată după cum urmează:
a) student sau elev comandant/șef de grupă — 130 lei;
b) student sau elev locțiitor comandant de pluton/șef de clasă — 152 lei;
c) student sau elev plutonier de companie/monitor de detașament (similare) — 174 lei;
d) student sau elev plutonier major de batalion/monitor de an (similare) — 196 lei;
e) student sau elev plutonier adjutant/monitor de instituție de învățământ — 217 lei.
(4) Persoanele declarate ADMIS la cursul de formare a cadrelor militare în activitate au dreptul la o indemnizație lunară,
stabilită după cum urmează:

7LSXOFXUVXOXL ,QGHPQL]D‫܊‬LHOHL
&XUV GH IRUPDUH D PDL‫܈‬WULORU PLOLWDULVXERIL‫܊‬HULORU vQ

DFWLYLWDWH
&XUVGHIRUPDUHDRIL‫܊‬HULORUvQDFWLYLWDWH 
94 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

(5) Prevederile alin. (4) se aplică în mod corespunzător și formare a cadrelor militare și funcționarilor publici cu statut
elevilor și studenților din instituțiile de învățământ pentru special din sistemul administrației penitenciare, precum și
formarea polițiștilor, respectiv cursanților din instituțiile de elevilor și studenților din instituțiile de învățământ pentru
învățământ pentru formarea funcționarilor publici cu statut formarea polițiștilor, care se deplasează în interes de serviciu și
special din sistemul administrației penitenciare. cărora nu li se pot asigura masa și cazarea gratuit în unități din
(6) Pentru alte situații privind acordarea drepturilor bănești localitatea unde se execută misiunea.
reglementate prin prezenta secțiune, ordonatorul principal de (8) Indemnizațiile prevăzute la alin. (1), (3) și (4) se
credite stabilește indemnizația prin asimilare. actualizează proporțional cu evoluția salariului de bază minim
(7) Drepturile prevăzute la art. 16 se acordă și elevilor și brut pe țară garantat în plată, prin hotărâre a Guvernului.
studenților instituțiilor de învățământ pentru formarea Art. 64. — (1) Militarii în termen au dreptul la o indemnizație
personalului militar, persoanelor care urmează cursurile de lunară, astfel:

*UDGXOSUHYă]XWvQVWDWXOGHRUJDQL]DUH
,QGHPQL]D‫܊‬LHOHL
SHQWUXIXQF‫܊‬LDFHRvQGHSOLQHVF
6ROGDW 
)UXQWD‫܈‬ 

(2) Indemnizația prevăzută la alin. (1) se actualizează proporțional cu evoluția salariului de bază minim brut pe țară garantat
în plată, prin hotărâre a Guvernului.

SECȚIUNEA a 8-a acest caz, diferența până la nivelul soldelor lunare, respectiv
Salarizarea personalului militar, a polițiștilor salariilor lunare cuvenite în calitate de personal militar, polițist
și a funcționarilor publici cu statut special sau funcționar public cu statut special din sistemul administrației
din sistemul administrației penitenciare detașați penitenciare se acordă de către instituțiile publice de apărare,
în afara instituțiilor publice de apărare, ordine publică ordine publică și securitate națională de unde personalul a fost
și securitate națională sau în regii autonome detașat.
ori în companii naționale aflate în subordinea/coordonarea (5) Pentru personalul militar, polițiștii și funcționarii publici cu
acestora, precum și salarizarea cadrelor militare statut special din sistemul administrației penitenciare detașați în
și personalului civil de specialitate din structurile militare afara instituțiilor publice de apărare, ordine publică și securitate
ale autorității judecătorești națională se prevăd funcții în statele de organizare „Anexa M”,
§1. Salarizarea personalului militar, a polițiștilor și a în condițiile reglementărilor în vigoare. Pentru alte cazuri în care
funcționarilor publici cu statut special din sistemul administrației personalul militar, polițiștii și funcționarii publici cu statut special
penitenciare detașați în afara instituțiilor din sistemul administrației penitenciare sunt detașați în afara
Art. 65. — (1) Personalul militar, polițiștii și funcționarii publici instituțiilor publice de apărare, ordine publică și securitate
cu statut special din sistemul administrației penitenciare, națională, asimilarea funcțiilor îndeplinite, precum și a soldelor
detașați în afara instituțiilor publice de apărare, ordine publică și de funcție/salariilor de funcție se stabilesc prin ordin al
securitate națională sau în regii autonome ori în companii ordonatorului principal de credite, cu avizul Ministerului Muncii
naționale aflate în subordinea/coordonarea acestora beneficiază și Justiției Sociale.
de următoarele drepturi salariale: (6) Soldele de funcție/salariile de funcție pentru personalul
a) salariul de bază al funcției îndeplinite, indemnizații, premii, militar, polițiștii și funcționarii publici cu statut special din sistemul
sporuri, precum și alte drepturi de natură salarială care se administrației penitenciare cărora le încetează detașarea și care
acordă personalului civil din entitățile unde își desfășoară sunt puși la dispoziție pentru încadrare ori trecere în
activitatea, potrivit reglementărilor care se aplică în entitățile
rezervă/retragere/încetare a raporturilor de serviciu sunt cele
respective;
corespunzătoare gradului militar/gradului profesional stabilit
b) solda de grad/salariul gradului profesional deținut.
conform alin. (5).
(2) Drepturile prevăzute la alin. (1) lit. a) se plătesc de către
(7) Personalul prevăzut la alin. (1) poate beneficia de premiile
entitățile unde personalul detașat își desfășoară activitatea.
care se acordă personalului militar în activitate, polițiștilor și
(3) Drepturile prevăzute la alin. (1) lit. b) se plătesc de către
instituțiile publice de apărare, ordine publică și securitate funcționarilor publici cu statut special din sistemul administrației
națională de unde personalul a fost detașat. penitenciare, calculate, în condițiile reglementate pentru aceștia,
(4) În situația în care drepturile salariale lunare prevăzute la care se achită din fondurile instituțiilor din sistemul de apărare,
alin. (1) sunt mai mici decât cele ce li s-ar cuveni ca militari, ordine publică și securitate națională de unde personalul a fost
polițiști sau funcționari publici cu statut special din sistemul detașat.
administrației penitenciare încadrați în instituțiile publice de (8) Personalul instituțiilor publice de apărare, ordine publică
apărare, ordine publică și securitate națională, pe funcții stabilite și securitate națională care își desfășoară activitatea la
potrivit alin. (5), cei în cauză pot opta pentru soldele lunare, compartimentele speciale din ministere și alte organe centrale
respectiv salariile lunare, corespunzătoare acestor funcții. În beneficiază de o compensație de 10% din salariul de bază.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 95

Compensația se plătește de către entitățile unde personalul SECȚIUNEA a 9-a


detașat își desfășoară activitatea. Salarizarea și alte drepturi bănești
Art. 66. — (1) Personalul detașat între instituțiile publice de ale personalului din instituțiile publice de apărare,
apărare, ordine publică și securitate națională este salarizat în ordine publică și securitate națională care desfășoară misiuni
conformitate cu reglementările aplicabile categoriei de personal în afara teritoriului statului român
din care face parte, potrivit funcției îndeplinite în instituția unde
acesta este detașat. Art. 71. — (1) Personalul militar care participă la misiuni și
(2) Drepturile salariale pentru personalul prevăzut la alin. (1) operații în afara teritoriului statului român beneficiază de
se plătesc de către instituțiile unde acesta este detașat. următoarele drepturi salariale:
(3) Personalul detașat între instituțiile publice de apărare, a) solda de funcție, prevăzută prin ordinul de
ordine publică și securitate națională care participă la orice numire/detașare sau avută anterior, dacă este mai mare, solda
forme de pregătire este salarizat conform secțiunii a 6-a din de grad, gradațiile la care are dreptul și solda de comandă, după
prezentul capitol. caz;
(4) Drepturile salariale pentru personalul prevăzut la alin. (3) b) compensațiile, indemnizațiile, primele, sporurile prevăzute
se plătesc de către instituțiile de unde acesta este detașat. de reglementările în vigoare, în condițiile prevăzute prin ordin al
§2. Salarizarea personalului militar, polițiștilor și funcționarilor ordonatorului principal de credite;
publici cu statut special din sistemul administrației penitenciare c) o compensație lunară specifică teatrului de operații de
care își desfășoară activitatea în societățile comerciale, regiile până la 100% aplicată la solda de funcție, stabilită cu aprobarea
autonome și companiile naționale aflate în subordinea sau în ordonatorului principal de credite, pentru fiecare misiune în
coordonarea acestora parte;
Art. 67. — (1) Personalul militar, polițiștii și funcționarii publici d) o primă de campanie egală cu solda de funcție stabilită
cu statut special din sistemul administrației penitenciare care își potrivit prevederilor lit. a). Prima de campanie se acordă o
desfășoară activitatea în societățile comerciale, regiile singură dată pentru toată perioada desfășurării misiunii și se
autonome și companiile naționale aflate în subordinea sau în plătește la plecarea în misiune.
coordonarea instituțiilor publice de apărare, ordine publică și (2) Polițiștii și funcționarii publici cu statut special din sistemul
securitate națională beneficiază de salariul de bază al funcției administrației penitenciare care desfășoară misiuni și operații
îndeplinite, de premii, de sporuri și de alte drepturi potrivit similare celor prevăzute la alin. (1) beneficiază de următoarele
prevederilor prezentei legi, precum și de solda de grad/salariul drepturi salariale:
gradului profesional deținut. a) salariul de funcție, prevăzut prin dispoziția/ordinul de
(2) Drepturile prevăzute la alin. (1) se plătesc de către numire/detașare sau avut anterior, dacă este mai mare, salariul
entitățile unde personalul își desfășoară activitatea. gradului profesional deținut, gradațiile la care are dreptul, salariul
Art. 68. — Modul de acordare și de finanțare a drepturilor de comandă, după caz;
bănești cuvenite personalului militar, polițiștilor și funcționarilor b) compensațiile, indemnizațiile, primele, sporurile prevăzute
publici cu statut special din sistemul administrației penitenciare de reglementările în vigoare, în condițiile prevăzute prin ordin al
care îndeplinesc funcții în societățile comerciale, regiile ordonatorului principal de credite;
autonome și companiile naționale aflate în subordinea sau în c) o compensație lunară specifică teatrului de operații de
coordonarea instituțiilor publice de apărare, ordine publică și până la 100% aplicată la salariul de funcție, stabilită cu
securitate națională se stabilește, conform legislației în vigoare, aprobarea ordonatorului principal de credite, pentru fiecare
prin ordin al ordonatorului principal de credite. misiune în parte;
§3. Salarizarea judecătorilor și procurorilor militari, precum d) o primă de campanie egală cu salariul de funcție stabilită
și a personalului auxiliar de specialitate și personalului conex potrivit prevederilor lit. a). Prima de campanie se acordă o
militar și civil singură dată pentru toată perioada desfășurării misiunii și se
Art. 69. — (1) Pentru judecătorii și procurorii militari se aplică, plătește la plecarea în misiune.
în mod corespunzător, reglementările specifice personalului din (3) Personalul civil care participă la misiuni și operații în afara
sistemul justiției. teritoriului statului român beneficiază de următoarele drepturi
(2) Pentru procurorii militari din cadrul Direcției Naționale salariale:
Anticorupție se aplică, în mod corespunzător, reglementările a) salariul de bază;
specifice personalului din sistemul justiției. b) compensațiile, indemnizațiile, primele, sporurile prevăzute
(3) Pentru personalul auxiliar de specialitate și pentru de reglementările în vigoare, stabilite în condițiile prevăzute prin
personalul conex militar și civil de la instanțele judecătorești și ordin al ordonatorului principal de credite;
parchetele militare se aplică, în mod corespunzător, c) o compensație lunară specifică teatrului de operații de
reglementările specifice personalului din sistemul justiției. până la 100% aplicată la salariul de bază, stabilită cu aprobarea
(4) Pentru personalul civil al Ministerului Apărării Naționale ordonatorului principal de credite, pentru fiecare misiune în
din cadrul Direcției Naționale Anticorupție se aplică, în mod parte;
corespunzător, reglementările specifice personalului din d) o primă de campanie egală cu salariul de bază. Prima de
sistemul justiției. campanie se acordă o singură dată pentru toată perioada
Art. 70. — Pentru calitatea de cadru militar în activitate, desfășurării misiunii și se plătește la plecarea în misiune.
cadrele militare prevăzute la art. 69 mai beneficiază de solda de Art. 72. — Drepturile bănești cuvenite personalului care
grad. încadrează batalioanele mixte constituite între Armata României
96 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

și armatele altor țări, precum și cele constituite din polițiști h) funcția de telefonist, telegrafist, telexist IV—I, cu funcția
români și polițiști ai altor țări se stabilesc prin hotărâre a de muncitor calificat IV-I;
Guvernului. i) funcția de șef formație pază și ordine II—I, cu funcția de
Art. 73. — Personalul militar, polițiștii și funcționarii publici cu administrator II—I;
statut special din sistemul administrației penitenciare trimiși în j) funcția de agent pază, agent însoțire II—I, cu funcția de
afara teritoriului statului român pentru a participa la cursuri, stagii muncitor calificat II—I.
de practică și specializare, perfecționare sau care desfășoară Art. 78. — Alte funcții specifice pentru personalul contractual
orice fel de activitate în străinătate, în interesul unității din instituțiile publice de apărare, ordine publică și securitate
trimițătoare, mai puțin cele menționate la art. 71, beneficiază pe națională se stabilesc prin ordin al ordonatorului principal de
timpul acestor activități, în țară, de solda de funcție/salariul de credite, cu avizul Ministerului Muncii și Justiției Sociale.
funcție, solda de grad/salariul gradului profesional deținut,
SECȚIUNEA a 11-a
gradații și, după caz, de solda de comandă/salariul de comandă,
precum și de celelalte drepturi salariale avute, stabilite potrivit Alte dispoziții
reglementărilor în vigoare. Art. 79. — Personalul militar, militarii în termen, polițiștii și
Art. 74. — Personalul din instituțiile de apărare, ordine funcționarii publici cu statut special din sistemul administrației
publică și securitate națională, trimis în misiuni permanente sau penitenciare, rezerviști, pe timpul concentrării, beneficiază de
temporare în străinătate, potrivit legii, beneficiază de toate drepturile bănești prevăzute de prezenta lege pentru personalul
drepturile prevăzute pentru personalul trimis în misiune militar, militari în termen, polițiști și funcționari publici cu statut
permanentă sau temporară de către Ministerul Afacerilor special din sistemul administrației penitenciare, de la unitățile
Externe, precum și de către celelalte ministere, organe și unde sunt concentrați.
instituții de specialitate ale administrației publice centrale. Art. 80. — Funcțiile personalului din instituțiile publice de
Art. 75. — În măsura în care prezenta lege nu prevede altfel, apărare, ordine publică și securitate națională sunt prevăzute în
dispozițiile sale se completează cu celelalte prevederi din statele de organizare elaborate de aceste instituții, pe baza
cuprinsul actelor normative speciale referitoare la drepturile și structurilor organizatorice aprobate, și cuprind, după caz,
obligațiile ce revin personalului trimis în misiune permanentă sau prevederile referitoare la gradul militar/profesional sau treapta
temporară în străinătate de către ministere și celelalte organe profesională, nivelul studiilor, solda de funcție/salariul de
și instituții de specialitate ale administrației publice centrale. funcție/salariul de bază.
Art. 81. — Pe timp de mobilizare sau război se aplică
SECȚIUNEA a 10-a prevederile prezentei legi, precum și unele reglementări
Unele reglementări privind salarizarea personalului civil specifice stabilite prin hotărâre a Guvernului.
Art. 82. — Prevederile anexei nr. X la Decretul nr. 163/1975
Art. 76. — (1) Personalul civil din instituțiile publice de
se aplică în continuare, până la data intrării în vigoare a actului
apărare, ordine publică și securitate națională beneficiază de
normativ care reglementează modul de stabilire a drepturilor pe
drepturile salariale reglementate prin prezenta lege, potrivit
timp de mobilizare sau război.
categoriei de personal și domeniului în care își desfășoară
Art. 83. — (1) Prevederile referitoare la contribuțiile pentru
activitatea.
asigurări sociale de stat nu se aplică personalului militar,
(2) Personalul civil prevăzut la alin. (1) care desfășoară polițiștilor și funcționarilor publici cu statut special din sistemul
activități în condiții similare cu cele ale personalului militar sau administrației penitenciare.
polițiștilor ori funcționarilor publici cu statut special din sistemul (2) Prevederile referitoare la contribuțiile pentru asigurările
administrației penitenciare, după caz, beneficiază de drepturile de șomaj nu se aplică personalului militar, polițiștilor și
salariale prevăzute expres pentru personalul civil în prezenta funcționarilor publici cu statut special din sistemul administrației
anexă. penitenciare.
Art. 77. — Funcțiile specifice pentru personalul contractual (3) Prevederile referitoare la contribuțiile privind asigurarea
din instituțiile publice de apărare, ordine publică și securitate pentru accidente de muncă și boli profesionale nu se aplică
națională se asimilează astfel: personalului militar, polițiștilor, funcționarilor publici cu statut
a) director Centru de reeducare cu director din cadrul anexei special din sistemul administrației penitenciare și personalului
nr. VIII cap. II lit. B; civil.
b) director adjunct Centru de reeducare cu director adjunct (4) Prevederile referitoare la contribuția pentru concedii și
din cadrul anexei nr. VIII cap. II lit. B; indemnizații de asigurări sociale de sănătate nu se aplică
c) funcția de criptanalist III cu funcția de cercetător științific, personalului militar, polițiștilor și funcționarilor publici cu statut
cercetător științific III; special din sistemul administrației penitenciare.
d) funcția de responsabil (șef) grup popote; responsabil (șef) Art. 84. — (1) Drepturile prevăzute de prezenta lege se
popotă II cu funcția de administrator II—I; acordă în condițiile exercitării, potrivit reglementărilor în vigoare,
e) funcția de șef spălătorie mecanică debutant, III—I, cu a controlului financiar preventiv propriu.
funcția de tehnician debutant, II—IA; (2) Controlul financiar preventiv propriu se exercită, prin viză,
f) funcția de însoțitor de bord debutant, III—I, cu funcția de de persoanele din cadrul structurilor de specialitate, desemnate
referent debutant, II—IA; potrivit reglementărilor în vigoare.
g) funcția de radiotelegrafist, radiogoniometrist, operator (3) Cadrele militare în activitate, polițiștii și funcționarii publici
control spațiu aerian III—I, cu funcția de tehnician II—IA; cu statut special din sistemul administrației penitenciare care
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 97

desfășoară activități de control financiar preventiv propriu și, (2) Drepturile bănești stabilite a fi acordate polițiștilor și
după caz, de audit beneficiază de majorarea soldei de funcționarilor publici cu statut special din sistemul administrației
funcție/salariului de funcție cu până la 10%, în condițiile penitenciare, prin alte acte normative, în raport cu salariul de
prevăzute prin ordin al ordonatorului principal de credite. bază se vor calcula față de salariul de funcție aflat în plată.
Art. 85. — (1) Ofițerii, polițiștii și funcționarii publici cu statut Art. 88. — (1) Prin excepție de la prevederile art. 21 din
special din sistemul administrației penitenciare care ocupă prezenta lege, pentru activitatea desfășurată de personalul
funcții de demnitate publică beneficiază, pe lângă drepturile militar, polițiști, funcționari publici cu statut special din sistemul
salariale cuvenite acestei funcții, și de solda de grad/salariul administrației penitenciare și personalul civil în zilele de repaus
gradului profesional deținut, ca drept al titularului acestuia. săptămânal, de sărbători legale și în celelalte zile în care, în
(2) Persoanele prevăzute la alin. (1) pot opta pentru conformitate cu reglementările în vigoare, nu se lucrează, se
drepturile salariale cuvenite pentru calitatea de cadru militar în acordă un spor de până la 100% din solda de funcție/salariul de
activitate, polițist sau funcționar public cu statut special din funcție/salariul de bază.
sistemul administrației penitenciare. (2) Dreptul prevăzut la alin. (1) se stabilește proporțional cu
(3) Ofițerii, polițiștii și funcționarii publici cu statut special din timpul efectiv lucrat în zilele respective și se determină pe baza
sistemul administrației penitenciare care ocupă funcții asimilate raportului dintre baza de calcul și durata normală a timpului de
celor de secretar de stat/subsecretar de stat pot opta pentru lucru, iar condițiile de acordare se stabilesc prin ordin al
indemnizațiile lunare stabilite pentru funcțiile de demnitate ordonatorului principal de credite.
publică. (3) Munca astfel prestată și plătită nu se compensează și cu
Art. 86. — (1) Cuantumul zilnic/orar al elementelor soldei timp liber corespunzător.
lunare cuvenite personalului militar se determină prin raportare Art. 89. — Acordarea drepturilor bănești reglementate prin
la numărul zilelor lucrătoare corespunzătoare fiecărei luni a prezenta lege se face în limita fondurilor bugetare aprobate
anului/durata normală a timpului de lucru. anual cu această destinație în bugetele instituțiilor publice de
(2) Cuantumul zilnic/orar al elementelor salariului lunar apărare, ordine publică și securitate națională.
cuvenit polițiștilor și funcționarilor publici cu statut special din Art. 90. — În aplicarea prezentei legi, instituțiile publice de
sistemul administrației penitenciare se determină prin raportare apărare, ordine publică și securitate națională emit norme
la numărul de zile lucrătoare din luna respectivă/durata normală metodologice, aprobate prin ordin al ordonatorului principal de
a timpului de lucru, cu excepția situațiilor pentru care drepturile credite.
cuvenite sunt prevăzute a fi acordate pentru zile calendaristice. Art. 91. — În caz de deces al personalului militar, polițiștilor
(3) Soldele lunare/salariile lunare ale personalului se plătesc și funcționarilor publici cu statut special din sistemul
o dată pe lună, în perioada stabilită potrivit reglementărilor în administrației penitenciare, soția sau soțul supraviețuitor ori
vigoare, pentru luna precedentă. copiii, iar, în lipsa acestora, părinții, beneficiază de un ajutor egal
(4) Soldele lunare ale personalului militar, respectiv salariile cu 12 solde de funcție/salarii de funcție, fără a fi necesară
lunare ale polițiștilor și funcționarilor publici cu statut special din îndeplinirea condițiilor referitoare la trecerea în rezervă sau
sistemul administrației penitenciare sunt confidențiale, instituțiile direct în retragere/încetarea raporturilor de serviciu, cu drept la
din sistemul de apărare, ordine publică și securitate națională pensie, a celor decedați.
având obligația de a lua măsurile necesare pentru asigurarea Art. 92. — (1) Personalul militar, polițiștii, funcționarii publici
confidențialității. cu statut special din sistemul administrației penitenciare care
(5) Soldele lunare ale personalului militar în activitate, dețin grad didactic și își desfășoară activitatea în instituții militare
respectiv salariile lunare ale polițiștilor și funcționarilor publici cu de învățământ sau în instituții de învățământ pentru formarea
statut special din sistemul administrației penitenciare nu pot fi polițiștilor ori în instituții de învățământ pentru formarea
urmărite decât în cazurile și în limitele prevăzute de funcționarilor publici cu statut special din sistemul administrației
reglementările în vigoare. penitenciare, precum și personalul militar, polițiștii, funcționarii
(6) Pe timpul absențelor nejustificate de la unitate/serviciu publici cu statut special din sistemul administrației
nu se acordă solda de funcție/salariul de funcție/salariul de bază penitenciare — personal de specialitate medico-sanitar — din
și nici alte drepturi salariale. sistemul de apărare, ordine publică și securitate națională,
(7) În Ministerul Apărării Naționale și Ministerul Afacerilor indiferent de funcția pe care este încadrat, pot opta, în locul
Interne, structura financiară centrală, prin componenta soldei lunare brute/salariului lunar brut, pentru salariul lunar brut
organizațională specializată în domeniul salarizării, asigură stabilit potrivit prevederilor din familiile ocupaționale Învățământ
îndeplinirea sarcinilor ordonatorului principal de credite din și Sănătate și asistență socială, la care se adaugă solda de
domeniile reglementării, implementării, coordonării grad/salariul gradului profesional deținut.
metodologice, asistenței de specialitate, monitorizării și gestiunii (2) Pensia și alte drepturi specifice care se acordă, potrivit
sistemului de salarizare. legii, se stabilesc în raport cu soldele lunare brute/salariile lunare
(8) În Ministerul Apărării Naționale și Serviciul de brute cuvenite în calitate de personal militar, polițist sau
Telecomunicații Speciale, alocarea și scoaterea la și de la solda funcționar public cu statut special din sistemul administrației
de funcție/salariul de funcție/salariul de bază și la și de la alte penitenciare, corespunzătoare funcțiilor încadrate, potrivit legii.
drepturi salariale se fac prin ordin de zi pe unitate. Art. 93. — Drepturile specifice prevăzute la art. 32, 33, 34 și
Art. 87. — (1) Drepturile bănești stabilite a fi acordate, prin art. 45 alin. (2)—(5) din prezenta anexă nu se iau în calcul la
alte acte normative, în raport cu solda de bază sau solda lunară determinarea limitei sporurilor, compensațiilor, primelor, premiilor
se vor calcula față de solda de funcție aflată în plată. și indemnizațiilor prevăzută la art. 25 alin. (2) din prezenta lege.
98 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. VII

Reglementări specifice personalului din autoritățile și instituțiile publice finanțate integral din venituri proprii,
aflate în subordinea, sub autoritatea, în coordonarea Guvernului, ministerelor și a celorlalte organe de specialitate
ale administrației publice centrale și locale, din cele aflate în coordonarea prim-ministrului,
precum și din cele aflate sub controlul Parlamentului

CAPITOLUL I
Salarii de bază
Art. 1. — Salariile de bază ale personalului de execuție din autoritățile și instituțiile publice finanțate integral din venituri
proprii, aflate în subordinea, sub autoritatea, în coordonarea Guvernului, ministerelor și a celorlalte organe de specialitate ale
administrației publice centrale, din cele aflate în coordonarea prim-ministrului, precum și din cele aflate sub controlul Parlamentului
sunt diferențiate după nivelul studiilor.

6DODULXOGHED]ă±OHL
&RHILFLHQW
1LYHOXOVWXGLLORU $QXO
PLQLP PD[LP  PLQLP PD[LP 
6WXGLLVXSHULRDUH    
6WXGLL VXSHULRDUH GH VFXUWă  
GXUDWă    
6WXGLLSRVWOLFHDOH    
6WXGLLPHGLL    
6WXGLLJHQHUDOH    
*) Salariul de bază prevăzut la nivelul maxim cuprinde sporul de vechime în muncă la nivel maxim.

Art. 2. — Salariile de bază ale personalului de execuție din instituțiile publice finanțate integral din venituri proprii, aflate
în subordinea, sub autoritatea, în coordonarea celorlalte organe de specialitate ale administrației publice locale, sunt diferențiate
după nivelul studiilor.

6DODULXOGHED]ă±OHL
 &RHILFLHQW
$QXO
1LYHOXOVWXGLLORU
PLQLP PD[LP  PLQLP PD[LP 
6WXGLLVXSHULRDUH    
6WXGLL VXSHULRDUH GH VFXUWă
   
GXUDWă
6WXGLLSRVWOLFHDOH    
6WXGLLPHGLL    
6WXGLLJHQHUDOH    
*) Salariul de bază prevăzut la nivelul maxim cuprinde sporul de vechime în muncă la nivel maxim.

Art. 3. – Salariile de bază ale funcțiilor de conducere din autoritățile și instituțiile publice prevăzute la art. 1 din prezenta
anexă sunt stabilite pe două grade, astfel:

6DODULXOGHED]ă ±OHL
&RHILFLHQW
)XQF‫܊‬LD $QXO
*UDG, *UDG,, *UDG, *UDG,,
'LUHFWRUJHQHUDO    
'LUHFWRUJHQHUDODGMXQFW    
'LUHFWRU    
'LUHFWRU DGMXQFW LQJLQHU‫܈‬HI
   
FRQWDELO‫܈‬HI
‫܇‬HI VHUYLFLX ‫܈‬HI VHF‫܊‬LH ‫܈‬HI
   
ILOLDOă
‫܇‬HI ELURX ‫܈‬HI DWHOLHU ‫܈‬HI
   
RILFLX‫܈‬HIVHFWRU
*) Salariul de bază cuprinde sporul de vechime în muncă la nivel maxim.
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 99

Art. 4. – Salariile de bază ale funcțiilor de conducere din instituțiile publice prevăzute la art. 2 din prezenta anexă sunt
stabilite pe două grade, astfel:

)XQF‫܊‬LD  
6DODULXOGHED]ă ±OHL &RHILFLHQW
$QXO 
*UDG, *UDG,, *UDG, *UDG,,
'LUHFWRUJHQHUDO    
'LUHFWRUJHQHUDODGMXQFW    
'LUHFWRU    
'LUHFWRU DGMXQFW LQJLQHU‫܈‬HI
   
FRQWDELO‫܈‬HI
‫܇‬HI VHUYLFLX ‫܈‬HI VHF‫܊‬LH ‫܈‬HI
   
ILOLDOă
‫܇‬HIELURX‫܈‬HIDWHOLHU‫܈‬HIRILFLX
   
‫܈‬HIVHFWRU

*) Salariul de bază cuprinde sporul de vechime în muncă la nivel maxim.

Art. 5. — Salariile de bază ale conducătorilor din autoritățile Art. 10. — Personalul încadrat în autoritățile și instituțiile
și instituțiile publice finanțate integral din venituri proprii, aflate în publice finanțate integral din venituri proprii beneficiază
subordinea, sub autoritatea, în coordonarea Guvernului, suplimentar și de sporuri specifice pentru condiții de muncă,
ministerelor și celorlalte organe de specialitate ale administrației după cum urmează:
publice centrale, din cele aflate în coordonarea prim-ministrului, a) pentru condiții periculoase sau vătămătoare, un spor de
precum și din cele aflate sub controlul Parlamentului se stabilesc până la 10% din salariul de bază, corespunzător timpului lucrat
de către persoanele împuternicite să numească aceste la locurile de muncă respective;
persoane. b) pentru condiții grele de muncă, un spor de până la 15% din
Art. 6. — Salariile de bază ale conducătorilor din instituțiile salariul de bază, corespunzător timpului lucrat la locurile de
publice finanțate integral din venituri proprii, aflate în subordinea, muncă respective;
sub autoritatea, în coordonarea celorlalte organe de specialitate c) personalul care lucrează, potrivit contractului individual de
ale administrației publice locale, se stabilesc de către muncă, în zone izolate sau unde atragerea personalului se face
persoanele împuternicite să numească aceste persoane. cu greutate beneficiază de un spor de până la 20% din salariul
Art. 7. — Pentru personalul de execuție, nivelul individual al de bază;
salariilor de bază se stabilește de către conducătorul autorității d) pentru consemn la domiciliu, un spor de până la 15% din
sau instituției publice finanțate integral din venituri proprii, pe salariul de bază;
baza criteriilor de evaluare a performanțelor profesionale e) pentru siguranța navigației, siguranța feroviară, siguranța
stabilite de către acesta. rutieră și siguranța aeronautică, un spor de până la 20% din
Art. 8. — Echivalarea funcțiilor specifice utilizate în prezentul salariul de bază.
capitol cu funcțiile prevăzute în anexele la prezenta lege se face Art. 11. — Personalul încadrat în autoritățile și instituțiile
de către Ministerul Muncii și Justiției Sociale, la solicitarea publice finanțate integral din venituri proprii beneficiază și de
ordonatorului principal de credite. celelalte drepturi aplicabile personalului din administrația publică
centrală, respectiv locală, în funcție de subordonare.
CAPITOLUL II
Art. 12. — Drepturile de natură salarială ale personalului
Sporuri și alte drepturi încadrat în autoritățile și instituțiile publice finanțate integral din
Art. 9. — Personalul încadrat în autoritățile și instituțiile venituri proprii sunt stabilite de către ordonatorul de credite, cu
publice finanțate integral din venituri proprii beneficiază de încadrarea strictă în resursele financiare alocate anual și în
sporurile și indemnizațiile aplicabile domeniului de activitate în numărul de posturi stabilit potrivit legii, prin bugetul de venituri și
care este încadrat. cheltuieli.
100 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
ANEXA Nr. VIII

FA M I L I A O C U PA Ț I O N A L Ă D E F U N C Ț I I B U G E TA R E „ A D M I N I S T R A Ț I E ”

CAPITOLUL I
A. Salarizarea funcționarilor publici
I. Salarii pentru administrația publică centrală
a) Funcții corespunzătoare categoriei înalților funcționari publici


)XQF‫܊‬LLSXEOLFHGHVWDW 
1U 1LYHOXO
)XQF‫܊‬LD
FUW VWXGLLORU 6DODULLOHGHED]ă
OHL &RHILFLHQW
$QXO
*UDG, *UDG,, *UDG, *UDG,,
 6HFUHWDUJHQHUDO 6    
6HFUHWDUJHQHUDODGMXQFWFRPLVDU
 6    
JHQHUDO
 ‫܇‬HIGHSDUWDPHQW 6    
 ,QVSHFWRUJXYHUQDPHQWDO 6    
N O T Ă:
1. Gradul I al funcției de secretar general și secretar general adjunct se utilizează, de regulă, la nivelul autorităților și
instituțiilor publice din subordinea sau coordonarea ordonatorilor principali de credite din administrația publică centrală.
2. Gradul II al funcției de secretar general și secretar general adjunct se utilizează la nivelul autorităților și instituțiilor
publice care sunt ordonatori principali de credite din administrația publică centrală și pentru Agenția Națională de Administrare
Fiscală, Casa Națională de Pensii Publice, Casa Națională de Asigurări de Sănătate, Agenția Națională pentru Ocuparea Forței
de Muncă, Inspecția Muncii, Agenția Națională pentru Plăți și Inspecție Socială, Institutul Național de Statistică și altele asemenea,
cu un grad ridicat de complexitate a activității, stabilite de către ordonatorii principali de credite.

b) Funcții corespunzătoare categoriei înalților funcționari publici din aparatul de lucru al Parlamentului

6DODULXOGH
1U 1LYHOXO
)XQF‫܊‬LD ED]ăOHL &RHILFLHQW
FUW VWXGLLORU  
$QXO
 6HFUHWDUJHQHUDO 6  
 6HFUHWDUJHQHUDODGMXQFW 6  
 ‫܇‬HIGHSDUWDPHQWGLUHFWRUJHQHUDO 6  

N O T Ă:
1. Salariul de bază de la poziția 3 se aplică și funcției de reprezentant permanent al Camerei Deputaților/Senatului pe lângă
Parlamentul European.
2. Salariile de bază cuprind sporul de vechime în muncă la nivel maxim.

c) Funcții publice de conducere

)XQF‫܊‬LLSXEOLFHGHVWDW 
1U 1LYHOXO 6DODULLOHGHED]ăOHL
)XQF‫܊‬LD &RHILFLHQW
FUW VWXGLLORU $QXO
*UDG, *UDG,, *UDG, *UDG,,
'LUHFWRUJHQHUDOLQVSHFWRUGHVWDW‫܈‬HI
LQVSHFWRUJHQHUDOGHVWDWFRQWURORU
 6    
ILQDQFLDU‫܈‬HIFRPLVDUJHQHUDOSULP
DGMXQFW
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 101

'LUHFWRUJHQHUDODGMXQFWLQVSHFWRU
GHVWDW‫܈‬HIDGMXQFWLQVSHFWRUJHQHUDO
 6    
GHVWDWDGMXQFWFRQWURORUILQDQFLDU‫܈‬HI
DGMXQFWFRPLVDUJHQHUDODGMXQFW
'LUHFWRU‫܈‬HIFRPSDUWLPHQWLQVSHFWRU
‫܈‬HIFRPLVDU‫܈‬HIGLYL]LH‫܈‬HIVHFWRUOD
 &RQVLOLXO/HJLVODWLYFRPLVDU‫܈‬HI 6    
VHF‫܊‬LHGLUHFWRUH[HFXWLYWUH]RULHU‫܈‬HI
‫܈‬HIDGPLQLVWUD‫܊‬LHILQDQFLDUă
'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU
‫܈‬HILQVSHFWRU‫܈‬HIDGMXQFW‫܈‬HIVHFWRU
FRPLVDU‫܈‬HIDGMXQFWFRPLVDU‫܈‬HI
VHF‫܊‬LHGLYL]LHGLUHFWRUH[HFXWLY
 6    
DGMXQFWWUH]RULHU‫܈‬HIDGMXQFW‫܈‬HI
DGPLQLVWUD‫܊‬LHILQDQFLDUăDGMXQFW
FRPLVDU‫܈‬HIVHF‫܊‬LHDGMXQFW‫܈‬HIELURX
YDPDO
‫܇‬HIVHUYLFLXFRPLVDU‫܈‬HIGLYL]LH
 6    
VHF‫܊‬LH‫܈‬HIVHF‫܊‬LH
 ‫܇‬HIELURX‫܈‬HIRILFLX 6    
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

d) Funcții publice generale de execuție



1LYHOXO )XQF‫܊‬LLSXEOLFHGHVWDW 
1U
)XQF‫܊‬LDJUDGXOSURIHVLRQDO VWXGLLOR 6DODULXOGHED]ăOHL
FUW
U *UDGD‫܊‬LD &RHILFLHQW
  $QXO
 $XGLWRU
6  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
 &RQVLOLHUFRQVLOLHUMXULGLFH[SHUW
 LQVSHFWRU 6  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 5HIHUHQWGHVSHFLDOLWDWH
66'  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 66'  
JUDGSURIHVLRQDODVLVWHQW 66'  
JUDGSURIHVLRQDOGHEXWDQW 66'  
 5HIHUHQW
0  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 0  
JUDGSURIHVLRQDODVLVWHQW 0  
JUDGSURIHVLRQDOGHEXWDQW 0  
102 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

e) Funcții publice specifice de execuție


 
1LYHOXO )XQF‫܊‬LLSXEOLFHGHVWDW 
1U
)XQF‫܊‬LD VWXGLLOR 6DODULXOGHED]ăOHL
FUW U *UDGD‫܊‬LD &RHILFLHQW
   $QXO
 &RQVLOLHUSDUODPHQWDU 6  
 ([SHUWSDUODPHQWDU 6  
 &RQVXOWDQWSDUODPHQWDU 6  
 ‫܇‬HIFDELQHW 6  
‫܇‬HIFDELQHWUHIHUHQW
 66'  
VWHQRGDFWLORJUDI
‫܇‬HIFDELQHWUHIHUHQW
 3/  
VWHQRGDFWLORJUDI
‫܇‬HIFDELQHWUHIHUHQW
 0  
VWHQRGDFWLORJUDI
&RQWURORUGHOHJDWDO0LQLVWHUXOXL
 )LQDQ‫܊‬HORU3XEOLFH 6  
JUDGSURIHVLRQDOVXSHULRU
 ,QVSHFWRUYDPDOLQVSHFWRUGH
PXQFăLQVSHFWRUVRFLDOH[SHUW
6  
FRRUGRQDWRU
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 &RPLVDU
6  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 &RPLVDUDJHQWYDPDO
66'  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 66'  
JUDGSURIHVLRQDODVLVWHQW 66'  
JUDGSURIHVLRQDOGHEXWDQW 66'  
 &RPLVDUFRQWURORUYDPDOFDVLHU
WUH]RULHU 0  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 0  
JUDGSURIHVLRQDODVLVWHQW 0  
JUDGSURIHVLRQDOGHEXWDQW 0  
 &RQVLOLHUHYDOXDUH
 H[DPLQDUHH[SHUWHYDOXDUH
H[DPLQDUH 6  
JUDGSURIHVLRQDO
VXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 $QDOLVWHYDOXDUHH[DPLQDUH
JUDGSURIHVLRQDO 6  
VXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 103

f) Funcții publice specifice de manager public


6DODULXOGHED]ă
1U 1LYHOXO OHL
)XQF‫܊‬LD &RHILFLHQW
FUW VWXGLLORU *UDGD‫܊‬LD
$QXO
0DQDJHUSXEOLF
 JUDGSURIHVLRQDO 6  
VXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6  
 JUDGSURIHVLRQDODVLVWHQW 6  
*) Funcții publice de stat, stabilite și avizate potrivit legii în cadrul aparatului Administrației Prezidențiale, al Parlamentului, al Guvernului, al ministerelor,
al Academiei Române, al Înaltei Curți de Casație și Justiție, al Consiliului Concurenței, al Curții de Conturi, al Consiliului Național pentru Studierea Arhivelor
Securității, al Consiliului Național al Audiovizualului, al Consiliului Legislativ, al Casei Naționale de Pensii Publice, al Casei Naționale de Asigurări de Sănătate, al
Agenției Naționale pentru Ocuparea Forței de Muncă, al Inspecției Muncii, al Agenției Naționale pentru Plăți și Inspecție Socială, al Autorității Naționale Sanitare
Veterinare și pentru Siguranța Alimentelor și structurilor subordonate, al Autorității Naționale pentru Protecția Consumatorului și structurilor subordonate, al Autorității
pentru Reformă Feroviară, al Agenției Naționale de Administrare Fiscală și unităților subordonate, al celorlalte organe de specialitate ale administrației publice
centrale, organismele intermediare pentru programele operaționale, precum și pentru funcțiile publice corespunzătoare categoriei înalților funcționari publici din
cadrul instituției prefectului.

N O T Ă:
1. Pentru funcția de consilier juridic din cadrul Administrației Prezidențiale și al Secretariatului General al Guvernului, care
desfășoară activități de reprezentare a interesului instituțiilor statului în relația cu terții, se acordă o majorare de 15% a salariului
de bază.
2. Pentru personalul de specialitate implicat în procesul legislativ din cadrul Secretariatului General al Guvernului, serviciilor
Parlamentului, Consiliului Legislativ și Administrației Prezidențiale, se acordă o majorare de 15% a salariului de bază. Stabilirea
personalului de specialitate implicat în procesul legislativ se face prin decizie a ordonatorului principal de credite, respectiv prin
hotărâre a Biroului permanent al fiecărei Camere, în cazul Parlamentului. Majorarea nu se acordă personalului asimilat din punct
de vedere al salarizării cu aceste categorii de personal.
3. Funcționarii publici din cadrul aparatului Ministerului Finanțelor Publice, Ministerului Muncii și Justiției Sociale,
Ministerului Mediului, Ministerului Dezvoltării Regionale, Administrației Publice și Fondurilor Europene, Ministerului Sănătății, Casei
Naționale de Asigurări de Sănătate și din instituțiile aflate în subordinea, coordonarea sau sub autoritatea acestora, funcționarii
publici din cadrul aparatului Ministerului Apelor și Pădurilor și Ministerului Justiției, precum și funcționarii publici parlamentari din
serviciile Parlamentului, cu excepția celor prevăzuți la pct. 2, beneficiază, pentru complexitatea muncii, de o majorare a salariului
de bază de 15%.
4. Majorările prevăzute la pct. 1—3, precum și cele prevăzute la art. 16 și 17 din prezenta lege nu se pot acorda cumulat
aceleiași persoane.
5. Salariile de bază prevăzute la lit. d)—f) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină prin
majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

II. Salarii pentru personalul din unitățile teritoriale


a) Funcții publice de conducere
)XQF‫܊‬LLSXEOLFHWHULWRULDOH 
6DODULLOHGHED]ă
1U 1LYHOXO OHL &RHILFLHQW
)XQF‫܊‬LD
FUW VWXGLLORU $QXO
*UDG
*UDG, *UDG,, *UDG,
,,
'LUHFWRUJHQHUDOFRPLVDUJHQHUDO
 6    
SULPDGMXQFW 
'LUHFWRUJHQHUDODGMXQFWLQVSHFWRU
GHVWDW‫܈‬HIDGMXQFWLQVSHFWRU
 6    
JHQHUDOGHVWDWDGMXQFWFRPLVDU 
JHQHUDODGMXQFW
'LUHFWRU‫܈‬HIFRPSDUWLPHQW
 LQVSHFWRU‫܈‬HIFRPLVDU‫܈‬HIGLYL]LH 6    

FRPLVDU‫܈‬HIVHF‫܊‬LHGLUHFWRUH[HFXWLY
'LUHFWRUDGMXQFWFRQWDELO‫܈‬HI
LQJLQHU‫܈‬HILQVSHFWRU‫܈‬HIDGMXQFW
‫܈‬HIVHFWRUFRPLVDU‫܈‬HIDGMXQFW
 6    
FRPLVDU‫܈‬HIVHF‫܊‬LHGLYL]LHGLUHFWRU 
H[HFXWLYDGMXQFWFRPLVDU‫܈‬HI
VHF‫܊‬LHDGMXQFW
‫܇‬HIVHUYLFLXDUKLWHFW‫܈‬HIODQLYHO
 6    
RUD‫܈‬FRPLVDU‫܈‬HIGLYL]LHVHF‫܊‬LH 
 ‫܇‬HIELURX‫܈‬HIRILFLX 6    
N O T Ă:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.
104 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017

b) Funcții publice generale de execuție



)XQF‫܊‬LLSXEOLFHWHULWRULDOH

1U 1LYHOXO
)XQF‫܊‬LDJUDGXOSURIHVLRQDO 6DODULXOGH
FUW VWXGLLORU
ED]ăOHL
*UDGD‫܊‬LD &RHILFLHQW
   $QXO
 $XGLWRU
6  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
 &RQVLOLHUFRQVLOLHUMXULGLFH[SHUW
 LQVSHFWRU 6  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 5HIHUHQWGHVSHFLDOLWDWH
66'  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 66'  
 JUDGSURIHVLRQDODVLVWHQW 66'  
JUDGSURIHVLRQDOGHEXWDQW 66'  
 5HIHUHQW
0  
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 0  
 JUDGSURIHVLRQDODVLVWHQW 0  
JUDGSURIHVLRQDOGHEXWDQW 0  
c) Funcții publice specifice de execuție

)XQF‫܊‬LLSXEOLFHWHULWRULDOH

1U 1LYHOXO
)XQF‫܊‬LD 6DODULXOGH
FUW VWXGLLORU
ED]ăOHL
&RHILFLHQW
*UDGD‫܊‬LD
   $QXO
 ,QVSHFWRUGHPXQFăLQVSHFWRU
VRFLDOH[SHUWFRRUGRQDWRU
6  
JUDGSURIHVLRQDO
VXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 &RPLVDU
6  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 6  
JUDGSURIHVLRQDODVLVWHQW 6  
JUDGSURIHVLRQDOGHEXWDQW 6  
 &RPLVDU
66'  
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 66'  
JUDGSURIHVLRQDODVLVWHQW 66'  
JUDGSURIHVLRQDOGHEXWDQW 66'  
MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017 105
J S 
 &RPLVDU
JUDGSURIHVLRQDO 0  
VXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 0  
JUDGSURIHVLRQDODVLVWHQW 0  
JUDGSURIHVLRQDOGHEXWDQW 0  
**) Funcții publice teritoriale stabilite și avizate potrivit legii din cadrul instituției prefectului, serviciilor publice deconcentrate ale ministerelor și ale celorlalte
organe ale administrației publice centrale din unitățile administrativ-teritoriale, precum și din structurile teritoriale ale Academiei Române.

N O T Ă:
1. În compartimentul Inspecție și Pază Ecologică al Administrației Rezervației Biosferei Delta Dunării va fi utilizată funcția
de inspector ecolog în locul funcției de consilier, pentru cei cu studii superioare, respectiv funcția de agent ecolog în locul funcției
de referent, pentru cei cu studii medii, fiind salarizați în mod corespunzător la nivelul funcției înlocuite.
2. Funcționarii publici din serviciile publice deconcentrate ale instituțiilor din subordinea, coordonarea sau sub autoritatea
Ministerului Mediului și Ministerului Muncii și Justiției Sociale beneficiază, pentru complexitatea muncii, de o majorare a salariului
de bază de 15%.
3. Majorarea prevăzută la pct. 2, precum și majorările prevăzute la art. 16 și 17 din prezenta lege nu se pot acorda cumulat
aceleiași persoane.
4. Salariile de bază prevăzute la lit. b) și c) sunt pentru gradația 0. Salariile de bază pentru gradațiile 1—5 se determină
prin majorarea salariilor de bază pentru gradația 0 potrivit prevederilor art. 10 din prezenta lege.

III. Nomenclatorul și ierarhia funcțiilor publice din administrația publică locală ***)
a) Funcții publice de conducere

1U 1LYHOXO
)XQF‫܊‬LD
FUW VWXGLLORU
 6HFUHWDUDOXQLWă‫܊‬LLDGPLQLVWUDWLYWHULWRULDOH
 'LUHFWRUJHQHUDO  6
 $UKLWHFW‫܈‬HI  6
 'LUHFWRUJHQHUDODGMXQFW 6
 'LUHFWRU‫܈‬HIFRPSDUWLPHQWGLUHFWRUH[HFXWLY 6
'LUHFWRUDGMXQFWFRQWDELO‫܈‬HILQJLQHU‫܈‬HI‫܈‬HIVHFWRUGLUHFWRUH[HFXWLY
 6
DGMXQFW
 ‫܇‬HIVHUYLFLXDUKLWHFW‫܈‬HIODQLYHORUD‫܈‬ 6
 ‫܇‬HIELURX‫܈‬HIRILFLX 6
1) Funcția publică locală se utilizează, în condițiile legii, în cadrul autorităților și instituțiilor publice din administrația publică locală cu un număr de
minimum 150 de posturi.
2) Funcția publică locală se utilizează la nivelul municipiilor și județelor.

NOTĂ:
Salariile de bază prevăzute la gradul I și gradul II cuprind sporul de vechime în muncă la nivel maxim.

b) Funcții publice generale de execuție



1U
1LYHOXO
FUW )XQF‫܊‬LD
VWXGLLORU

 $XGLWRU
6
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6
JUDGSURIHVLRQDODVLVWHQW 6
 &RQVLOLHUFRQVLOLHUMXULGLFH[SHUWLQVSHFWRU
6
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 6
 JUDGSURIHVLRQDODVLVWHQW 6
JUDGSURIHVLRQDOGHEXWDQW 6
106 MONITORUL OFICIAL AL ROMÂNIEI, PARTEA I, Nr. 492/28.VI.2017
J S 6
 5HIHUHQWGHVSHFLDOLWDWH
66'
JUDGSURIHVLRQDOVXSHULRU
JUDGSURIHVLRQDOSULQFLSDO 66'
JUDGSURIHVLRQDODVLVWHQW 66'
JUDGSURIHVLRQDOGHEXWDQW 66'
 5HIHUHQW
0
 JUDGSURIHVLRQDOVXSHULRU
 JUDGSURIHVLRQDOSULQFLSDO 0
 JUDGSURIHVLRQDODVLVWHQW 0
JUDGSURIHVLRQDOGHEXWDQW 0
***) Funcții publice locale, stabilite și avizate potrivit legii în cadrul aparatului de specialitate al primarilor municipiilor, orașelor și comunelor și al instituțiilor
înființate în subordinea, coordonarea sau sub autoritatea consiliilor locale.

N O T Ă:
Salariul de bază individual al administratorului public se stabilește de către primar, președintele consiliului județean sau
primarul general al municipiului București, în condițiile legii, în funcție de tipul unității administrativ-teritoriale și de atribuțiile stabilite
în fișa postului, între limite, astfel: limita minimă este nivelul salariului de bază al secretarului unității administrativ-teritoriale, iar limita
maximă este indemnizația viceprimarului, a vicepreședintelui consiliului județean sau a viceprimarului municipiului București, după
caz.

B. Reglementări specifice funcționarilor publici inferior sau, după caz, de execuție au dreptul la salariul de bază
Art. 1. — (1) Funcționarii publici beneficiază de un spor pentru funcția publică în care vor fi numiți.
pentru condiții periculoase sau vătămătoare de până la 15% din Art. 5. — Funcționarii publici care absolvă studii
salariul de bază, corespunzător timpului lucrat. universitare de licență, în domeniul de activitate al autorității sau
(2) Locurile de muncă, categoriile de personal, mărimea instituției publice, încadrați pe funcții publice cu nivel de studii
concretă a sporului, precum și condițiile de acordare a acestora inferior, se numesc, în condițiile legii, într-o funcție publică de
se stabilesc de către ordonatorul principal de credite, cu execuție care să le asigure cel puțin salariul de bază avut din
consultarea sindicatelor sau, după caz, a reprezentanților clasa corespunzătoare studiilor absolvite, păstrându-și gradația
funcționarilor publici, în limita prevederilor din Regulamentul avută la data promovării.
elaborat potrivit prezentei legi, având la bază buletinele de Art. 6. — (1) Funcționarii publici redistribuiți au dreptul
determinare sau, după caz, expertizare, emise de către
la salariul de bază pentru funcția publică în care vor fi
autoritățile abilitate în acest sens.
redistribuiți.
Art. 2. — Funcționarii publici care, în condițiile legii,
(2) Prevederile alin. (1) se aplică în mod corespunzător
exercită temporar o funcție publică de conducere sau o funcție
și funcționarilor publici reintegrați, dacă prin hotărârea
publică corespunzătoare categoriei înalților funcționari publici
judecătorească definitivă nu se prevede altfel.
au dreptul la salariul de bază corespunzător funcției publice pe
Art. 7. — (1) Funcționarii publici au următoarele drepturi
care o exercită cu caracter temporar.