Sunteți pe pagina 1din 134

CAPCAUNII

Un Căpcăun este un monstru cu forma de om, imens și hidos. Ei se regasesc


în multe povești din folclor, fiind prezentați ca ființe extrem de crude, care se
hranesc cu carne de om. În mitologia românească, Capcaunul apare ca un personaj
supranatural, uneori cu două capete, iar alteori cu cap de câine și trup de om. În
luptă, un singur Căpcăun este mai puternic decât o jumătate de duzină de bărbați
obișnuiți. Căpcaunul are mai mult de 5 metri în înălțime, iar corpul său musculos
este încoronat de un cap mic și bestial, apropiat de dimensiunea gâtului. Brațele
sale vânjoase au grosimea trunchiului unui barbat adult și puterea de a distruge
pereții unei case. Picioarele lui sunt solide și neobosite, capabile să poarte trunchiul
său greoi. Dinții săi sunt groși și plați, asemănători cu colții unei bestii. Părul care
îi acoperă corpul este deșirat, lins și unsuros. Deși Căpcăunii sunt în general cheli,
fața le este acoperită de păr. Probabil, părul de pe față are rolul să împiedice
pierderea hranei care ar putea scăpa din gura sa lacomă.
Corpul Căpcăunului este bine protejat împotriva tuturor elementelor din
natură, pentru că sub țesutul său gros se află o mare masă de mușchi. Pielea sa este
ca o platoșă care se vindecă repede, fiind de două ori mai groasă decât pielea
oricărei ființe. Oricum, cea mai importantă caracteristică a Căpcăunilor sunt
intestinele lor. Un Căpcăun cu intestine dezvoltate este considerat sănătos și
puternic, deoarece trebuie să mănânce foarte mult pentru a ajunge la o asemenea
circumferință. Cea mai importantă preocupare a unui Căpcăun este mâncatul. Însă,
rolul intestinului este și acela de protecție, deoarece organele vitale ale
Căpcăunului sunt situate mai jos decât cele ale oamenilor. Aceste organe sunt
acoperite de un ghem de musculatură care poate să spargă și să macine cu o forță
teribilă, permițând Căpcăunului să digere aproape orice. Pentru a-și proteja
abdomenul, Căpcăunii poartă o centură groasă, făcuta din metal, în care este
încrustat simbolul tribului din care face parte. Centura este strâns legată de talia
Căpcăunului printr-o curea rezistentă, în care își ține armele și uneltele necesare
pentru hrană. În afară de centură și curea, Căpcăunii mai poartă și cizme solide,
care îi protejează picioarele. Uneori, Căpcăunii mai bogați își confectionează
armuri, însă majoritatea, atunci când merg la război, își acoperă trupul cu tatuaje
înspăimântătoare, pentru a intimida adversarii. Când merg prin porțiunile
înzăpezite ale munților, Căpcăunii își acoperă corpul cu pieile animalelor pe care
le-au devorat.
În general, fiecare Căpcăun face parte dintr-un clan, împreună cu care își
anihilează prada. Membrii clanului îl trag înapoi în peșteră atunci când este rănit,
evitând astfel să piardă prea mult sânge. Cei care alcătuiesc un trib, poartă
bandane, țepi și ținte asemănătoare, iar măiestria cu care își confectionează
accesoriile este un indicator al statului pe care îl ocupă – cei cu decorații simple
1
sunt considerați a fi sărăci și nepricepuți. Un Căpcăun are încredere deplină în
clanul său și nu îl va ataca decât în condiții disperate. Căpcăunii sunt considerați
niște fiinte puțin inteligente, dar foarte agresive. Se spune însă, că au suficientă
îndemânare pentru a construi arme aproape din orice obiecte. Uneori au și
mașinării de razboi pe care le iau, le schimbă sau le câștigă de la alte rase.
Căpcăunii au un apetit de nesatisfăcut pentru distrugere și pentru mâncare.
Chiar și în perioadele de relativă pace, ei vânează și ucid fiarele care populează
peșterile munților. Ei poartă în permanență războaie între clanuri. Se știe, de
asemenea, că au obiceiul să călătorească si pot fi întâlniți în toate cele patru colțuri
ale lumii, luptându-se organizați în grupuri mici, care lasă urme aproape invizibile
ale trecerii lor prin acele ținuturi. O migrație a Căpcăunilor poate fi devastatoare,
distrugând populații întregi, în timp de numai câteva zile. Despre existența
Căpcăunilor se știe din picturi pline de cruzime găsite în peșteri și din legende
aparținând vechilor tradiții. Una dintre cele mai vechi legende, povestește că într-o
seară Căpcăunii au capturat Soarele. Dar, datorită arsurilor puternice cu care au
fost pedepsiți, l-au eliberat în dimineața următoare.

Mitologia românească ne poate oferi cele mai interesante legende privitoare


la cele mai curioase făpturi care, în viziunea omului din popor, au existat la
începutul timpului pe pământ. Una dintre acestea este căpcăunul, mostru ce apare
în numeroase basme ce
ne-au încântat copilăria.
Dar care este de fapt originea acestei înfiorătoare creaturi?

Legendele antropogonice româneşti ne dezvăluie faptul că au existat patru


cicluri antropogonice, prin care cele două fiinţe gemelare, Fârtatul şi Nefârtatul, au
încercat să creeze o făptură demnă de a stăpâni pământul. Astfel, antropogonia,
ramură care încearcă să explice creaţia omului ca făptură cosmică pe pământ,
cuprinde: spiţa căpcăunilor, spiţa uriaşilor, spiţa oamenilor şi spiţa uricilor (sau a
blajinilor). Întâia spiţă, cea a căpcăunilor, a fost rezultatul încercărilor de început
ale celor doi creatori ai lumii, şi sunt primele făpturi pe care mitologia românească
le menţionează la începutul erei antropogonice. Aceştia, numiţi şi „catcăuni”, au
reprezentat o încercare nereuşită: aveau o înfăţişare monstruoasă, erau chinocefali
(cap de câine), lătrau în loc să vorbească şi erau antropofagi. Aveau, de asemenea,
capacitatea de a vedea zece oameni cu un singur ochi. Locuiau în peşteri şi
văgăuni, se ocupau cu culesul roadelor sălbatice şi cu vânătoarea şi se mâncau între
ei, iar puţinii căpcăuni care au supravieţuit în al doilea ciclu antropogonic, au
mâncat şi oameni.
Căpcăunii au fost distruşi de către uriaşi, reprezentanţi ai celui de-al doilea
ciclu, şi creeaţi de către Fârtat şi Nefârtat în primul rând cu scopul de a stârpi prima
2
spiţă nereuşită. După ce au fost înfrânţi, câteva exemplare răzleţe de căpcăuni au
supravieţuit până în era omului – Muma Pădurii, Fetele Pădurii, Păduroiul şi Tatăl
Pădurii. Aceştia îşi găsesc locul în poveştile populare cu substrat mitic. Spre
exemplu, din basmul Cotoşmanul Năzdrăvan, de Petre Ispirescu, aflăm că
ameninţarea cu Muma Pădurii este mai îngrozitoare pentru slujitorii zmeilor decât
pedeapsa ce ar fi venit din partea stăpânilor de drept: „Întâlnind turmele, spuse
aşijderea ciobanilor ce să zică şi ei, căci de unde nu, Muma Pădurii îi va chinui
băgându-le mânile în căldarea cu jăratic, până vor muri, şi sufletele lor vor ajunge
la munci nesfârşite.” Extraordinar de interesantă este prezenţa în cadrul Bisericii
Creştine Române a unui sfânt mucenic înfăţişat cu cap de câine – Hristofor.
Originea acestuia este discutată pe baza unor documente istorice care atestă
existenţa unui trib de chinocefali în zona Indiei. Se pare că sursa cea mai credibilă
ar fi cartea Indica, a geografului antic Ktesias (secolul al V-lea), unde un întreg
capitol este dedicat acestui „trib indian”.
Sfântul Mucenic Hristofor este prăznuit la data de 9 mai şi este cel mai
uimitor sfânt al Bisericii lui Hristos. În ceea ce priveşte particularitatea sa fizică,
există două variante. Prima, care ţine mai mult de tradiţia populară creştină, spune
că Hristofor ar fi fost un tânăr neînchipuit de frumos care s-a rugat la Dumnezeu
să-i ia frumuseţea, pentru a nu mai sminti oamenii. A doua variantă spune că făcea
parte dintr-un trib de chinocefali. Deoarece s-a convertit la creştinism, a fost ucis şi
astfel a devenit martir. În unele icoane este reprezentat purtându-şi capul de câine
pe o tavă. Revenind la antropogonia românească, uriaşii, care au curăţat pământul
de odioasele făpturi antropofage, vor dispărea la rândul lor în lupta împotriva
Fârtatului şi a Nefârtatului. Vor fi urmaţi de oameni, în al treilea ciclu
antropogonic, care se află încă în desfăşurare. Blajinii, care vor domina al patrulea
ciclu, există deja pe pământ, trăiesc în umbra oamenilor şi îi ajută, iar atunci când
era oamenilor va ajunge la un final, blajinii vor fi consideraţi în sfârşit fiinţele
perfecte, în stăpânirea cărora trebuie să se afle pământul.
Oamenii cu cap de câine, numiti si “chinocefali”, sunt mentionați încă din
cele mai vechi timpuri. Astfel, se știe despre existenta acestora într-un trib din
deșertul de peste Siria. Tzetzis, un comentator istoric bizantin, se referă la aceștia
ca la niște locuitori ai Indiei, în zona actualului Pakistan. În varianta grecească a
vietii Sfantului Hristofor, se spune că a venit în lumea romană trecând prin deșertul
Persiei, iar Marco Polo îi mentionează pe aceștia drept locuitori ai insulelor din
Oceanul Indian. Se poate ca aceștia să fie viețuitorii acelorași triburi pe care le-a
întâlnit și Alexandru cel Mare, în drumul său spre țărmul mării de lângă deșertul
Gedrosian. Principala sursă despre existența chinocefalilor rămâne însă personajul
Ktesias, un binecunoscut geograf antic, farmacist și istoric din Knidos, ale cărui
scrieri au fost luate foarte în serios de Patriarhul Fotie cel Mare. În cartea lui
Ktesias “Indica”, folosită de însuși Sfântul Fotie, există un întreg text închinat
3
chinocefalilor, “un trib indian”. Marco Polo a văzut un asemenea trib, pe care l-a și
numit “al chinocefalilor”, pomenind și faptul că fețele le erau asemănătoare cu ale
câinilor din rasa buldog. Aceștia obișnuiau să își taie obrajii, să își pilească dinții,
să își ciuntească urechile și să remodeleze capetele copiilor încă de mici. Toate
acestea erau făcute spre a căpata o înfățișare înfiorătoare, numai cu scopul de a se
apara pe ei însiși de atacurile invadatorilor. Daca mergi astazi în unele dintre
triburile ce viețuiesc în zona sub-Sahariană, de-a lungul Nilului, în Rwanda, de-a
lungul Amazonului sau în Noua Guinee, vei observa faptul că fețele acelor oameni
sunt adesea înfiorătoare. Aceștia sunt înfiorători în estetică, însă nu și în obiceiuri.
Aceasta este o caracteristică a oamenilor primitivi, săvârșită în scopul
autoapărării.
Sinaxarul din Minei ne spune că Sfântul Mucenic Hristofor era un tânăr de o
frumusețe rară, care, din dragoste pentru Hristos, a ales să renunțe la viața sa
normală. În orice loc ajungea, el stârnea ispite prin frumusețea trupului și chipului
său, lucru ce facea ca orice fata să se tulbure și să-și piardă liniștea. Vesnic întristat
de mâhnirile pe care le pricinuia în mod involuntar, tânărul Hristofor s-a rugat lui
Dumnezeu să-i ia frumusețea, pe care tot El i-o și dăduse. Rugăciunea acestuia,
facuta cu durere în inimă, a fost ascultată, prin urmare, a doua zi el s-a văzut lipsit
de acea cruce grea a frumuseței, în loc de cap de om el având cap de câine. Cea de-
a doua variantă cunoscută – Hristofor cel din tribul chinocefalilor – ține mai mult
de cele dintâi relatări scrise. Cel mai vechi manuscris haghiografic privind viața
sfântului cu cap de câine aparține episcopului Teofil Indianul și a fost scris în limba
greacă, pe la jumătatea secolului al IV-lea. Potrivit acestuia, Sfântul Mucenic
Hristofor era un soldat originar din nordul Africii. Tânărul soldat avea un chip
nemaivăzut, fața lui semăna cu cea a unui câine, iar cuvintele îi erau stâlcite. Cu
toate că acesta înfiora pe tot omul care îl vedea, el nu avea un comportament
fioros. Prins de către armata romană, el ajunge prizonier în temnițele unde creștinii
erau adesea aruncați și ei. Intrând în contact cu iubitorii de Hristos din Antiohia, el
se convertește la creștinism. În cele din urmă, alături de mulți alți creștini și tînărul
Hristofor va fi omorât pentru nelepădarea dreptei credințe.
În legendele populare româneşti, căpcăunii apar ca prezenţă istorică, un
popor care a invadat în trecut Moldova şi a distrus cetatea Sucevei. În legenda
întemeierii Sucevei, căpcăunii sunt descrişi ca fiinţe cu cap de lup şi cu un singur
ochi în frunte. Probabil că legenda medievală care situa oamenii cu cap de cîine în
regiunile de nord ale Rusiei îşi are sâmburele de adevăr, iar “căpcăunii” care, după
legendă, au ars casele Sucevei şi biserica de lemn şi au dărâmat cetatea au fost un
neam migrator ai cărui războinici purtau măşti de lup. Tot după legendă, invazia
căpcăunilor este anterioară celei a tătarilor, deci e vorba de migratori vechi, nu de
evenimente din cursul evului mediu. După unele surse Căpcăunii sunt popor venit
din stepa rusă în care, în antichitate, trăia tribul “lykantropic” al neurilor ,
4
menţionaţi de Herodot. Unele opinii susţin că neurii ar fi strămoşi ai slavilor, luând
în considerare atât situarea geografică, cât şi faptul că legendele despre “vârcolaci”
sunt des întâlnite la toate popoarele slave. Războinici-lupi apar însă la popoarele
germanice; sunt reprezentaţi şi pe Columna lui Traian, în scena 36, aceștia fiind
probabil germani batavi. Nu e exclus ca acei “căpcăuni” care au devastat Suceava
să fi fost goţi, războinici “ulfhednar”.
CICLOPII
Ciclopii sunt fiinţe fabuloase, reprezentate ca nişte uriaşi cu un singur ochi
în frunte. Ciclopii erau de mai multe categorii: erau ciclopi uranieni (Arges,
Brontes şi Steropes) – născuţi din Uranus şi Gaea, – ciclopi păstori (Polyphemus)
care populau coastele Siciliei şi, în sfârşit, ciclopi făurari, ajutoarele lui
Hephaestus. Aceştia din urmă lucrau în muntele Aetna, alături de zeul făurar, arme
pentru oameni şi pentru zei. Au fost ucişi de Apollo drept răzbunare pentru faptul
că au lucrat trăsnetul cu care Zeus l-a ucis pe Asclepius.

Unii cred că ciclopii au fost fiinţe care au existat cu adevărat, prezenţa unui
singur ochi fiind rezultatul unor mutaţii genetice provocate de radiaţiile la care au
fost expuşi în vremurile străvechi oamenii.
În Odiseea lui Homer sunt povestite faptele de vitejie ale lui Ulise şi ale
tovarăşilor lui, printre care şi o întâmplare cu aceşti ciclopi. Întorcându-se din
războiul Troiei, în călătoria spre casă a avut parte de multe experienţe dificile. În
timpul navigării pe mare, o furtună foarte puternică a împins corăbiile pe mal, unde
cei aflaţi la bord au fost nevoiţi să se refugieze. Locuitorii acestei insule erau
ciclopii, uriaşii cu un singur ochi, mâncători de oameni. Unul dintre ciclopi, numit
Polifem (în traducere – “Multă faimă”), i-a prins pe călători şi i-a închis într-o
peşteră la uşa căreia a pus un bolovan foarte mare. În fiecare dimineaţă mânca câte
doi dintre ei. În situaţia aceasta dificilă, Ulise i-a adunat pe toţi tovarăşii săi de
călătorie, ca să alcătuiască un plan în vederea eliberării lor. Au adunat toată rezerva
de băutură şi, când seara a venit, planul era gata. Cu băutura în mână, Ulise s-a dus
la gura peşterii, unde stătea de obicei ciclopul, şi i-a dat să bea din licoarea
ameţitoare.
Acestuia i-a plăcut mult şi l-a întrebat care îi este numele:
- Numele meu este “Udeis”, adică “Nimeni”, a răspuns Ulise.
În timp ce fiara ameţise de aburii alcoolului, tovarăşii lui Ulise au pregătit un lemn
ascuţit pe care l-au înfipt cu toată puterea în ochiul adormit. La ţipetele de durere
ale ciclopului, au venit tovarăşii lui din alte peşteri şi l-au întrebat:
Cine ţi-a făcut asta?Nimeni, Nimeni!

Ciclopii au dat din cap miraţi şi au plecat, convinşi că tovarăşul lor a


înnebunit. În timpul acesta, Ulise şi tovarăşii lui au fugit, scăpând astfel de moarte.
5
Ciclopi (sau Cyclopes) au fost în mitologia greacă ființe fabuloase,
reprezentate ca niște uriași cu un singur ochi în frunte. Ciclopii sunt asemanatori cu
oamenii dar difera prin marimile gigantice. Initial erau doar trei: Brontes, Steropes
si Arges. Tot mitologia greacă este cea care ne spune că Ciclopii au fost un grup de
uriaşi, care posedau un singur ochi aşezat în mijlocul frunţii. S-a spus despre ei că
erau muncitori pricepuţi iar grecii îi acreditează pe aceştia ca fiind creatorii
zidurilor a mai multor oraşe antice. Romanii credeau că Ciclopii lucrau la Muntele
Etna cu Hefaistos, zeul focului, al metalelor şi al metalurgiei. Poetul grec Hesiod a
scris despre 3 dintre ciclopi: Brontes (tunet), Steropes (fulger) şi Arges (strălucire).
Fii ai cerului şi ai pământului, aceşti ciclopi au fost alungaţi de către tatăl lor,
Uranus, în Tartarus, imediat după ce s-au născut. Ei, în cele din urmă, i-au dat lui
Zeus darurile tunetului şi fulgerului cu care i-a învins pe Titani şi a devenit astfel
conducătorul Universului. Mai târziu, autorii au relatat că Zeus l-a ucis pe
Asclepius, fiul lui Apollo, determinându-l pe Apollo să îi ucidă pe Ciclopi pentru a
se răzbuna. Noţiunea de Ciclopi poate avea originea din practica metalurgiştilor
antici, aceştia purtând un gen de protectie pentru ochi, în scopul de a se proteja de
scântei în timp ce lucrau cu metalul încins. Aceasta explică strânsă asociere a
Ciclopilor cu prelucrarea metalelor şi zeul Hefaistos. O altă teorie, sugerată prima
dată de către paleontologul Othenio Abel la începutul secolului al XX-lea, se referă
la craniile elefantului pitic, ce ar fi putut conduce la miturile Ciclopilor. Craniile
acestor elefanţi, care au trăit în urmă cu circa opt mii de ani în urma, înfăţişând o
cavitate nazală adâncă direct în centrul craniului. Această cavitate ar fi putut uşor
confundată cu o cavitate oculară uriaşă, în special de către persoanele care nu au
văzut elefanţi vii. Ciclopii sunt de obicei asociaţi cu focul şi fulgerul. Mai târziu
Ciclopii cum ar fi Polifemus spre deosebire de Ciclopii originali simbolizează
sălbăticia şi fărădelegea.
Nici poveştile din mitologia românească nu sunt lipsite de personaje ce
seamănă cu ciclopii; una dintre ele zice că trăia, cândva, ascuns într-o văgăună a
Ceahlăului, un căpcăun. El era o mare năpastă pe capul oamenilor căci ademenea
fetele tinere, le ducea pe platoul muntelui şi le transforma în stane de piatră cu
înfăţişări ciudate. Într-o zi, un gospodar din Vatra Călugărenilor (localitate din
zonă), a cărui fată fusese răpită în ajun de căpcăun, i-a convins pe ceilalţi oameni
din sat să se înarmeze cu topoare, coase, paloşe, buzdugane şi să se aşeze la pîndă
în Gura Bistricioarei, pentru a-l răpune pe căpcăun. Şi ei aşa au făcut. Din vîrful
muntelui însă, căpcăunul i-a zărit şi, furios, s-a tot gîndit cum să-i distrugă pe
răzvrătiţi. Odată cu căderea nopţii, el a dezlănţuit o furtună teribilă apoi, când
potopul era în toi, a smuls din creştetul Ceahlăului o stîncă uriaşă şi a pornit cu ea
în zbor să o prăvălească peste satul răzvrătit. Dar duhul cel bun al muntelui
Ceahlău, pe care oamenii locului şi l-au închipuit întotdeauna ca pe un moşneag
albit de ani, s-a prefăcut într-un voinic chipeş şi, călăre pe un cal înaripat, a pornit
6
după căpcăun. Urmărirea a fost aprigă, vicleanul căpcăun făcînd tot felul de
mişcări înşelătoare, doar doar o reuşi să ajungă deasuspra oamenilor să slobozească
bucata de munte pe capetele lor. Mai abil, duhul Ceahlăului a reuşit să lovească cu
spada peste ghearele căpcăunului şi uriaşa stîncă a căzut în afara satului, pe malul
Bistriţei, acolo în locul unde vedem şi astăzi Piatra Teiului (sau Piatra Dracului,
cum mai este denumită de către localnici).
Stîncile de la poalele sitului arheologic Cetăţuia par a fi fost azvîrlite de
uriaşii care mişună prin legendele locale. Se spune că aici s-au descoperit şi
schelete de uriaşi, dar, ca şi în alte zone ale României, nimeni nu ştie unde au fost
duse. Pe malul lacului Cernica,în Căldăraru au fost descoperiţi uriaşi, ridicîndu-se
ulterior acolo un monument. Denumirea acestor uriaşi este de “novaci”, fiind
descoperite femururi şi maxilare de dimensiuni impresionanate. În judeţul
Teleorman există o localitate numită Ciolăneşti, care îşi trage numele de la faptul
că în zonă au fost descoperite, cu sute de ani în urmă, nişte oase uriaşe de oameni
(ciolane). În România, schelete de uriaşi au mai fost descoperite la Polovragi, în
mai multe etape de săpături, finalizate până în 1994, la Cetăţeni, două schelete,
deshumate în 2005, din dealul de sub mănăstirea Negru Vodă. Acestea au dus la
descoperirea unor oseminte umane şi de animale în peşteri din România.
Mandibula omului numit Ion, veche de 40.000 de ani, cu siguranţă nu este întreagă,
la fel cum întreg nu e nivi craniul lui Vasile (un pic mai tînăr). Din comuna
Pantelimon – Lebăda, în octombrie 1989, au fost scoase 20 de schelete de uriaşi.
În M-ţii Buzăului, d-l Vasile Rudan a participat la exhumarea unor schelete
cu înălţimi cuprinse între 2,4 – 2.5 m. “Faptul că în urmă cu 200 – 300.000 ani şi
până relativ recent, acum 30.000 ani, planeta întreagă a fost locuită, cel puţin în
insule izolate, de persoane mai înalte decît noi, este de necontestat, deoarece
scheletele sunt de tip humanoid şi nu de tip tarsieri (maimuţe).” Scăieni este o
aşezare străveche situată în M-ţii Buzăului, atestată ca obşte moşnănească pe la
1600. Sătenii spun că, în vremurile de demult, pe cînd zmeii se băteau prin
fundăturile pădurilor, acolo fusese o „aşezare tătărască“, adică locuită de uriaşi.
Necropola acelui sat, pierdut în negura timpului, este plină de schelete umane ce
măsoară în jur de 2,40 m. La Scăieni, necropola de uriaşi a fost descoperită de
localnici, în 1985. Au fost scoase două schelete, dar situl nu a fost niciodată
cercetat cu atenţie. Cercetatorul Vasile Rudan, a semnalat faptul că “poveştile”
oamenilor din comuna Bozioru despre uriaşii care au locuit pe acele meleaguri au
şi dovada concretă: o necropolă cu schelete de uriaşi. Aceasta a fost descoperită
întîmplător, în urmă cu peste 20 de ani, cînd s-a hotărît ca în Scăieni să se planteze
o livadă de meri. Săpând pe o colină, sătenii au descoperit schelete uriaşe,
măsurînd în jur de 2,40 metri, chiar mai mult. Drăgoi Ilie, unul dintre cei care au
lucrat atunci la livada de meri, duce câţiva arheologi la faţa locului. Până la
“culmea” unde fuseseră plantaţi pomii, se coboară o pantă abruptă, pe o uliţă
7
înecată de noroi. Odată ajunşi, nea Ilie le arată întreaga livadă, care acum nu mai
rodeşte: “Peste tot sunt mormintele uriaşilor. Făceam gropi, să plantăm puieţii,
când dau de o căpăţînă de om, mare cît un dovleac de prăsilă.. Nici că mai văzusem
aşa ceva. Ne uitam toţi cruciţi. Sap mai departe şi dau şi de nişte oase de la
picioare, cît aracii de vie.
Muncitorii din livada de la Scăieni au găsit multe morminte. Unde săpau,
dădeau de ele. Au scos doar cîteva, restul le-au lăsat să se odihnească în pământ,
săpând rândurile în aşa fel încât să le ocolească. Pe lângă schelete s-au găsit şi
„cioburi“, adică fragmente de olărie, dar acestea nu a suscitat un mare interes
autorităţilor sau arheologilor, pentru că
„în plan era să se planteze livada. Am strâns scheletele şi cioburile şi le-am predat,
au fost duse la muzeu, am auzit că au ajuns la Bucureşti. Au fost şi măsurate.
Aveau în jur de 2,40 metri“. De atunci, nimeni n-a mai dat importanţă
necropolei de uriaşi, de parcă ar fi fost ceva obişnuit, la ordinea zilei. Pentru sătenii
din Scăieni, chiar nu mai reprezintă o curiozitate. S-au mai mirat ei la prima recoltă
de mere. „Deşi erau un soi obişnuit, fructele s-au făcut mari cît nişte pepenaşi. Ne-
am gîndit că din cauza uriaşilor îngropaţi aici“. Ilie Drăgoi se oferă să sape, să
arate şi un schelet, dar trebuie să urce iar uliţa aceea abruptă, sa ia de acasă o
lopată, un hârleţ. Când să plece spre casă, se întunecă din senin şi începe un vânt
aprig ce dă fiori. Locul devine parcă o imagine din filmele cu strigoi. Se renunţă la
idee şi, cum oamenii ajung la drumul principal, vremea se îndreaptă la fel de brusc.
Vântul se opreşte şi apare soarele. Ce să fi fost asta? „Nimic“, ne linisteşte
nea Ilie. „Aşa e pe aici“.
Moşnenii constituie o populaţie foarte veche, organizată mai întîi pe familii,
apoi în obşti, care, în timp, a dat cele mai vechi familii de nobili autohtoni. De
moşnenii stabiliţi în partea superioară a râului Buzău pomenesc şi cronicarii antici.
Pliniu îi numea mossyni, Strabo le zicea mossynoeci şi-i localiza lângă ţinutul
colchilor (astăzi Colţi, în vecinătatea ţinutului vechilor moşneni). Locuinţele lor de
lemn aveau o particularitate anume. Erau foarte înalte şi aveau formă de turn,
denumite astăzi „cule“. Ele erau construite din trunchiuri întregi de copaci, tăiaţi la
o margine de pădure. „Talpa“ turnului sau fundaţia era formată din primii patru
copaci doborâţi – cărora din tăiere li se dădea direcţia de cădere – sub care se
aşezau pietre mari. Şi astăzi sătenii din Scăieni păstrează acelaşi mod de
construcţie a temeliei, fără să se respecte canoanele străvechi, pentru care era
nevoie de o forţă deosebită, pe care numai uriaşii o aveau. Familiile de moşneni au
dat cei mai buni căpitani lui Negru Vodă, enigmaticul erou despre care există o
mulţime de legende, dar care nu a fost identificat. Se spune că acest Negru Vodă
avea şi el o înălţime impresionantă, judecînd după „scaunele“ sale săpate în stînci,
pe culmile munţilor din zonă. Moşnenii (sau muntenii cum li se spune astăzi) erau
păstrătorii multor „tainiţe“.
8
Fiind o zona des călcată de triburi cotropitoare, moşnenii organizaseră un
sistem foarte eficient de apărare, bazat pe puncte de supraveghere aşezate pe cele
mai înalte culmi, tuneluri subterane care ieşeau în peşteri cu galerii mari, unde se
puteau adăposti sătenii cu vite cu tot şi pâlcuri de călăreţi care ştiau cum să răsară
ca din pămînt asupra năvălitorilor şi să dispară apoi ca înghiţiţi de ceaţă. Reţeaua
de „tainiţe“ folosite de moşneni şi de căpitanii lui Negru Vodă era foarte veche,
după cum reiese din „Legendele plaiului“, povestiri din bătrâni culese de Ilie
Mândricel, profesor de română în comuna Bozioru. „Două subterane construite sub
nişte stânci enorme datează de pe vremea tătarilor“. Vom vedea despre care „tătari“
este vorba. Pentru vechii locuitori, ascunzătorile ideale erau aşezările rupestre şi
pădurile seculare, dintre care pădurea Tainiţa, de pe muntele cu acelaşi nume, era
cea mai sigură, fiind şi astăzi foarte greu de străbătut. Aici se află Stâlpii Tainiţei,
„stâlpi colosali de piatră care se ridică în formă de coloane în mijlocul pădurii
inaccesibile“ şi care nu au putut fi cercetaţi, deoarece nu se poate ajunge până la ei.
Cine a săpat tunelurile prin piatră dură, cine a ridicat acei stâlpi în inima pădurii,
cine a sculptat pe stânci, la mari înălţimi, „scaunele“ domneşti? Toţi oamenii spun
că tătarii. Dar nu poporul de năvălitori, ci „ceilalţi“, care au trăit mult înaintea
moşnenilor şi de la care aceştia au preluat multe obiceiuri. Locurile unde se
descoperă vestigii ale acestei civilizaţii preistorice sunt numite în popor „sălişti
tătărăşti“. Cum este şi Siliştea Scăienilor.
Cele mai vechi notiţe cu referire la ciclopi le aflăm de la poetul epic grec
Homer. Acesta ne spune că ciclopii erau un popor prin excelenţă pastoral, locuind
pe munţii cei înalţi din nordul Traciei ( Daciei) distingându-se prin statura lor
uriaşă. Prin urmare şi aceşti ciclopi erau uriaşi. Când trebuie să-i localizeze pe
aceşti ciclopi, Homer ne spune că trăiau în vecinătatea lui Pontos, cuvânt prin care
grecii întelegeau Pontul Euxin (Marea Neagră). Ciclopul Polyphem cu care se va
întâlni Ulise este descris ca un uriaş enorm ce părea că este un pisc înalt de munte
cu creştetul acoperit de păduri. În limbaj demitizat aceasta însemnând că avea o
statură extrem de mare şi puternică, iar locul în care se vor întâlni va fi de fapt o
construcţie ciclopică, în speţă, un staul situat lângă Polovragi, construcţie săpată de
mana omului în stâncile naturale, având dimensiuni colosale. Ceea ce vine să
confirme ipoteza noastră că ciclopii, ce aparţineau de fapt clasei uriaşilor sau
Titanilor, numiţi si giganţi, este faptul că poporul numeşte acest loc Oborul
Jidovilor sau al urieşilor
Pliniu cel Bătrân ne spune că primii care au construit turnuri sau fortificaţii
pe înălţimi au fost ciclopii, iar în acest sens ar fi interesant de specificat legenda
uriaşilor de pe muntele Ceahlău. Se spune că pe muntele Ceahlău ar fi trăit cândva
un neam de uriaşi, popor de oameni grozav de înalţi şi de tari. Şi-au adus cu dânşii
nişte vite, un soi de bouri, cu coarne scurte, şi-i păşunau toată vara pe plaiurile
muntelui, până da omătul. Atunci coborau oamenii cu vitele lor, către apus şi
9
miază-zi, spre Valea Jitanului, care de atunci şi până acum aşa îi spune. Dar într-o
iarnă, a dat în ei o molimă de s-au prăpădit bătrâni şi tineri şi bouri. Ar mai fi
scăpat doi, o fată şi un băiat. Aceştia, luând puţinii bouri ce erau feriţi de crunta
boală, s-au urcat sus în plaiul muntelui. Şi numai ce le-a trecut prin gând celor doi
tineri: să ridice acolo sus fiecare câte un turn, doar i-o vedea şi oamenii dinspre
soare răsare. Şi aşa au tot cărat lespezi şi stânci; băiatul a ridicat un turn mai mare
şi mai lat, iar fata unul mai mic, după puterile ei. Oamenii din văi priveau miraţi
cum se ridică zi de zi aceste piscuri prea măreţe. Numai că în ziua în care îşi
schimbă codrul faţa verde, ziua de Probajini, numai ce trăsni în pereţii muntelui,
nori de zloată şi de gheaţă s-au prăbuşit, curmând orice viaţă pe tot cuprinsul
muntelui. Şi peste ceasuri, când mândrul soare şi vânturile limpeziră hăul, cu-n
stânjen se săltase Ceahlăul… După ce s-au scurs puhoaiele, oamenii din vale
nemaivăzând pe cei doi tineri uriaşi şi nici o mişcare în munte, s-au urcat pe culme
şi i-au căutat. Într-un târziu au dat de ei turtiţi sub greutatea gheţii.
Le-au zidit mormânt de piatră, acolo unde-i aflară. În anul celălalt au venit iar
oamenii, tot de Probajini, şi au adus o toacă pe care au înţepenit-o acolo sus, pe
vârful cel mai înalt. Şi de atunci, în fiecare an, de ziua aceea, poporul de prin văi şi
lunci, bărbaţi, femei şi copii, fac o slujbă în sobor, cinstind mormântul acelor
uriaşi. Şi iaca aşa, de atunci, turnului mai mare îi zice Toaca, iar celuilalt îi spune
Panaghia.

URIASII
Uriaşii, acest popor fantastic al tradiţiilor româneşti, ne este prezentat ca
aparţinând primelor timpuri ale antropogenezei. Ei sunt cunoscuţi în tradiţia
populară sub diferite nume precum: urieşi, jidovi, tătâni, tartori sau tătari. Ei ar fi
locuit pământul înaintea oamenilor obişnuiţi iar legendele povestesc multe lucruri
ciudate despre neamul lor.
Uriaşii făceau parte din categoria oamenilor giganţi, un singur uriaş fiind
echivalentul a douăzeci şi cinci de oameni obişnuiţi. Datorită puterilor lor
extraordinare sunt numiţi cu epitetele de „pozniţi” şi „voinici fără pereche”.
Dimensiunile lor erau colosale. Capul lor era cât o bute mare, părul lung şi încâlcit,
ochii extrem de mari, trupul planturos, mâinile şi picioarele lungi şi mersul
şleampăd. Când se deplasau călcau din deal în deal, puteau duce o vacă în spate
fără vreun efort, puteau transporta copaci imenşi din care îşi construiau case iar
când se delasau prin pădure, prăvăleau în urma lor copacii făcând pârtii largi prin
pădure. Când beau secau pâraiele şi râurile, revărsau lacurile când se scăldau, cu
ciocanele lor erau în stare să prăvălească stânci enorme, iar paloşele lor erau în
stare să reteze vârfurile munţilor. Femeile uriaşilor erau voinice, muncitoare,
guralive şi posedau un caracter mult mai blând decât al soţilor lor.

10
Deşi deseori amintiţi în legende şi basme ca luptători, uriaşii erau paşnici de
felul lor, devenind periculoşi numai când erau agresaţi sau înfuriaţi. Deşi există
menţiuni mitico-folclorice despre uriaşi antropofagi (posibil căpcăunii cunoscuţi şi
sub denumirea de
cap-câni) aceştia nu mâncau carne de om ci mai degrabă trăiau în bună înţelegere
cu oamenii. Se spune că stirpea uriaşilor a dispărut în urma potopului lui Noe. De
altfel, unul dintre cele mai cunoscute motive în poveştile despre uriaşi este tocmai
acela al luării oamenilor în poală de către fata de uriaş dimpreună cu boii şi cu
plugul cu care aceştia lucrau pămantul. Motivul semnifică, aşa cum se va vedea, o
acţiune civilizatoare a uriaşilor asupra oamenilor obişnuiţi, aceşti uriaşi nefiind
chiar atât de fantastici pe cât par. Revelatoare în acest sens este o legendă din satul
Căpâlna (jud Sălaj) : Familia de uriaşi de la Podu Gogoronii, unde se află Casa
Uriaşului, avea trei copii, doi feciori şi o frumuseţe de fată pe nume Nimilica, care
este descrisă ca fiind foarte prietenoasă cu oamenii ”mici” pe care-i ocrotea şi
îngrijea. Nimilica cea frumoasă (Nimilica in limba traco-daca ar fi însemnat
Nimicuţa, Micuţa), culegând hribe prin pădure, ajunse la marginea unei poeniţe
unde vede nişte făpturi mici – de acolo de sus le vede ca pe nişte furnici –
scormonind pamântul cu un cârlig tras de boi, şi aceştia mici, după măsura lor. Şi-a
zis frumoasa Nimilica: Ce bine m-aş juca cu acele mici jucării, hai să le iau
acasă…
Nimilica se coborî în vale, luă jucăriile în zadie, şi le duse acasa şi se jucă cu
ele. Soseşte tatăl şi vede acele mici făpturi cu care se juca frumoasa Nimilica şi o
întrebă: De unde le ai fetica mea?… De jos de lângă râul mare, acolo scormonesc
pamântul cu un cârlig. Şi mai sunt şi altele, toate scormonesc pamântul şi şesul de
lângă râu… Fetica mea, nu ai făcut bine că le-ai luat de la rostul lor, du-le-n grabă
şi le aşează frumuşel de unde le-ai luat. Aceste mici făpturi sunt urmaşii noştri pe
aceste plaiuri. Noi suntem trecători pe aici dar ei vor moşteni dealurile, pădurile,
văile şi râurile care acum sunt ale noastre… du-le fiica mea acolo de unde le-ai
luat… Nimilica adânc s-a întristat, a ascultat însă povaţa tatălui şi le-a pus din nou
în zadie şi le-a dus la locul lor. Frumoasa Nimilica ieşea deseori pe culmea dealului
şi privea spre valea râului cel mare şi admira micile făpturi. A trecut vremea zi de
zi… Dar într-o zi uriaşii şi-au strâns lucrurile şi au plecat.
Toponimia românească, de asemenea, cuprinde numeroase denumiri ce
derivă din numele uriaşilor. Există o seamă de peşteri cu nume ciudat precum :
Peştera Uriaşilor, Pivniţa Uriaşului; o seamă de dealuri sau denivelări ale terenului,
posibili tumului ce poartă nume ca : Movila Uriaşului, Mormântul Uriaşului; şi
construcţii megalitice, aparţinând artei construcţiilor ciclopice ce poartă denumiri
ca Cetatea Uriaşului sau Jgheabul Uriaşilor, nume de localităţi precum :Novaci, un
alt nume sub care sunt cunoscuţi uriaşii în legendele româneşti, Zidina,Jidova,
Jidovina . Uriaşii conform mai multor relatări locuiau şi în cetăţile istorice pe care
11
nu se stie când le-au părăsit, existând numeroase mărturii orale despre rămăşiţele
pământeşti ale uriaşilor. O asemenea mărturie ne aduce Ioniţă Florea, un locuitor al
comunei Popeşti (jud Giurgiu) în vârstă de 80 de ani , care a participat la săpăturile
efectuate de Dinu V. Rosetti la Argedava, o cetate dacică ieşită din comun prin
mărimea ei şi care în opinia lui Vasile Pârvan a fost prima cetate de scaun a lui
Burebista. “Eu am început să sap aici în 1947 cu echipa de arheologi. Ei au angajat
vreo 30 de oameni din sat. Aveam atunci vreo 18 ani, eram cel mai tânăr, şi m-am
dus pentru că ne dădeau 400.000 de lei pe zi. Puteam să cumpăr cu ei doar un
kilogram de mălai. Era sărăcie la acea vreme. Odată, după ce am săpat la o
adâncime de patru metri, am găsit o glavă (craniu – n.r.) foarte ma¬re, cam de vreo
două sau trei ori cât al unui om. Le-am spus arheolo¬gilor. Şeful era atunci
Ro¬setti. Ne-a trimis imediat aca¬să pe noi, sătenii, şi au săpat doar ei. Oasele le-
au pus într-un camion cu prelată. Unde le-au dus, nu ştiu. Am săpat aşa timp de trei
ani şi am mai găsit uriaşi. Să zic aşa, aveau vreo patru metri lungime. Când
gă¬seam oasele, arheologii ne tri¬miteau a-casă, să nu ve¬dem noi ce e acolo. Dar
noi ve¬deam, că nu eram orbi. Şi uite aşa am dezgropat uriaşi cu mâ¬na mea în
1950″.
La aceasta se adaugă mărturiile orale ale tăranilor din Orlat şi Sibiel,
localităţi situate în Mărginimea Sibiului. Aceste mărturii vin să întărească relatările
mitico- fabuliste cum că oamenii obişnuiţi au convieţuit în buna înţelegere cu
uriaşii în primele timpuri ale istoriei.

Cercetările asupra miturilor despre uriaşi, destul de abundente pe teritoriul


românesc şi cu o tipologie variată, ne arată că ele au la origine surse foarte vechi ,
arhaice, ce nu sunt influenţate de înrâuriri biblice. Unele dintre legendele despre
uriaşi se pare totuşi că au suferit un minim proces de încreştinare dar există
oarecare reticenţe privind acest proces având în vedere că biblia, atât în Noul cât şi
în Vechiul Testament vorbeste despre Uriaşii Gog şi Magog veniţi dinspre
miazănoaptea cea îndepărtată. O asemenea legendă ne spune că oamenii obişuiţi au
dorit pentru ei Ţara de Lapte şi Ţara de Miere dar când au ajuns la ea au găsit-o
ocupată de uriaşi. Oamenii plângându-se lui Dumnezeu, Preaputernicul le-a zis că
i-ar fi făcut şi pe ei la fel de mari dacă erau la fel de credincioşi, dar aşa vor trebui
să se înapoieze.

Legendele despre uriaşi abundă în teritoriul românesc ele extinzându-se pe


întreg spaţiul carpato-daubiano-pontic. Ceea ce este si mai ciudat însă în aceste
legende este faptul că, în conştiinţa celor care mai stiu aceste poveşti, uriaşii sunt
implicaţi direct în filiaţia
pelasgi-daci-români, excluzând aproape în totalitate elementul roman. Un ţăran din
Sibiel, loc din Mărginimea Sibiului unde legendele despre uriaşi se îmbină cu cele
12
despre daci şi Decebal, spune cu mult prea multă convingere : „Traian nu i-o putut
birui pe daci!”…”Da’ nu-i bai că i-o bătut că noi tot din daci ne tragem”…” …noi,
românii, am fost mereu ăi mai viteji din Europa. Noi şi sârbii şi grecii. De zece ori
mai viteji decât italienii, care se trag din Traian. Asta înseamnă că noi ne tragem
din daci, pentru că şi ei erau ăi mai viteji din Europa şi nu se temeau de nimica.
Noi nu ne putem trage din romani. Aşe simt io”
Cei mai vechi şi mai renumiţi dintre neamurile uriaşilor au fost Titanii care
în miturile arhaice erau numiţi „genul antic pământean” şi „Fii Terrei”. Hesiod ne
spune că primii copii ai Geei din împreunarea cu Uranus au fost tocmai aceşti
titani, în număr de doisprezece, şase bărbaţi şi şase fete. Faptul că Hesiod aduce
vorba despre prima formă de religiozitate întâlnită în lume, anume credinţa în Cer
(Uranus) şi Pământ (Geea) precum şi denumirile acestor copii ai Geei (a se înţelege
cu sensul de autohtoni) ne fac să credem că patria de origine a Titanilor se afla la
Dunărea de Jos iar grecii înţelegeau prin acestă numire o denumire etnică. Cu atât
mai mult cu cât vechii greci numeau autohtonii din Dacia, pe daci, cu numele de
geţi ce ar însemna „născuţi din Geea” iar pelasgii, înainte mergătorii dacilor, erau
„născuţi din pământul negru”, fapt ştiut tot din izvoarele mitico-istorice greceşti.
Mai mult, numele acestor titani se pot reduce la numiri geografice din zona Dunării
de Jos.. Unul dintre aceşti titani purta numele de Hyperion, ce poartă înţelesul de
Ţara de Dincolo, denumire ce face referire la Dacia întregă percepută ca
Hiperboreea mitică în imaginarul grecesc sau , reducând la scară, dar rămânând în
acelaşi teritoriu , numai la Transilvania care în cronicile maghiare era numită Ţara
de dincolo (de păduri).
Că Hyperion înseamnă ( din) Ţara de Dincolo ne stă mărturie şi Odiseea
(VI.4) care aminteşte de Hyperia, regiunea aflată în apropiere de locurile ciclopilor
de unde au emigrat pheacii, un alt nume al pelasgilor în izvoarele greceşti. Ceilalţi
unsprezece titani îşi reduc de asemenea numele la râuri sau munţi din Dacia. De
aici, se deduce că patria neamului urieşesc al titanilor era lângă Okeanos Potamos,
Okeanos fiind chiar numele unuia dintre titani şi care nu este altul decât fluviul cel
sfânt al antichităţii dacice, adică Istrul sau Dunărea. După cum patria titanilor nu
era Grecia, la fel nici numele lor nu este grecesc. Homer făcând referire la aceştia îi
numeşte pe titani cu epitete precum „protopărinţii oamenilor distinşi”. Prin urmare,
grecii îi percepeau pe titani ca părinţi ai oamenilor după cum arată şi rădăcina
„tata” la care se reduce în cele din urmă cuvântul titan. Forma grecizată titanes,
prin radicalul „tata” la care poate fi redusă, este identică în fond şi formă cu forma
românească a cuvântului „tătâni”, nume sub care mai sunt cunoscuţi uriaşii în
tradiţia populară românească, tătâni însemnând în limba română taţi, părinţi.
Pe langă denumirea de tătâni, uriaşii mai sunt cunoscuţi în tradiţiile româneşti sub
numele de tătari. Despre acesti tătari tradiţia culeasă de Nicolae Densuşianu ne
spune că odată formau un popor puternic, care locuise înainte vreme pe teritoriul
13
provinciei româneşti Valahia, înaintea românilor iar dacii nu erau decât un fel de
tătari. Imediat ne putem da seama că nu este vorba despre triburile tătarilor care au
tranzitat şi ţara noastra la 1241, mai ales că este vorba şi de filiaţia tătari- daci-
români de care vorbeam ceva mai devreme. Acestora li se atribuie unele resturi de
ceramica descoperite în acestă provincie şi unele menhire care erau considerate a
marca mormintele uriaşilor, unele chilii săpate în stânci asemenea acelor din zona
Întorsurii Buzăului sau de la Corbii de Piatră, unele dintre cetăţile cu ziduri sau din
pământ cum este Argedava, prima cetate de scaun a lui Burebista şi nu în ultimul
rând mormintele tumulare sau toponimia unor sate părăsite, unde s-au descoperit şi
resturi de construcţii antice, sate denumite cu termenul generic de sălişti tătăreşti.
Această numire de tătari atribuită uriaşilor în tradiţiile populare româneşti nu este
în fond decât o altă formă a numirii tătâni cu care Homer şi ţăranii români îi
investiseră pe titani. Procesul lingvistic care a dat naştere acestei denumiri de tătari
pentru a desemna neamul uriaşilor este tranformarea literei „n” din tătâni în „r”
rezultând astfel termenul de tătari, căci rădăcina acestui nume etnic se reduce
defapt tot la radicalul „tata”. Această particularitate lingvistică se va păstra în ţările
române până la mijlocul Evului Mediu. Dealtfel, forma tătân cu sensul de titan, în
care se văd oglindiţi uriaşii tradiţiei româneşti este consfinţită de Codicele
Voroneţian ce păstrează în paginile sale formulări precum: „Dumeneca a şaptea a
sfinţilor tătari (a se înţelege a sfinţilor părinţi), legea tătărească (legea părintească),
obicnitelor tătăreşti (obiceiuri tătăreşti, părinteşti).
Denumirea tartor, în sensul bun al cuvântului, adică acela de „cap, sef,
părinte” păstrată în popor se reduce la timpurile pelasgo-dace şi se fundamentează
pe unul dintre epitetele lui Zamolxe. De la unii autori antici, cum este Mnaseas din
Petrae, aflăm că dacii îl adorau pe Zamolxe ca pe Cronos iar Cronos în mitologia
romană este echivalentul lui Saturn şi de aici putem deduce echivalenţa Saturn-
Cronos-Zamolxe. Această identitate a divinităţilor în discuţie se datorează faptului
că vechii pelasgi porniţi din Dacia, care era patria lor după toate izvoarele greceşti
şi romane, au colonizat la un moment dat atât Grecia , cât şi Italia. Odată dedusă
identitatea dintre aceste divinităţi, în fond una şi aceeaşi, dar cu numiri etnice
diferite observăm că unul dintre epitetele de care se bucura Saturn/Cronos în
teogoniile greceşti este acela de Tartaros, identic ca formă şi sens cu românescul
„tartor”. Mai mult, pentru greci, forma Tartar reprezenta lumea de dincolo iar prin
inversiune fonetică obţinem Tătar. De-a dreptul ciudat este că în Transilvania, Tara
de Dincolo, se află o localitate cu numele de Tărtăria, locul unde a apărut scrisul
pentru prima dată, mai vechi cu o mie de ani decât cel sumerian.
Prin urmare Saturn/Cronos/Zamolxe se legitima prin epitetul tartaros acordat
lui de lumea grecească drept zeul tătarilor, a tătânilor, a neamului uriaşilor.
Deasemenea, Egiptul îl cunoaşte pe Saturn cu epitetul de tatunen, denumire foarte
apropiată de românescul tătâne, fiind invocat sub titlul de „ părinte al părinţilor”.
14
Conform istoricului roman Suetonius, Apollo a cărui patrie se afla în părţile
Dunării de jos, după cum arată epitetul său de Hiperborean şi după tradiţiile
greceşti care plasa Hiperboreea în aceste ţinuturi, şi care pare a fi doar o formă,
aceea a luminii solare, a zeului suprem pelasgo-dac Zamolxe, era adorat în unele
părţi ale Romei cu epitetul de Tortor, foarte asemănător cu românescul tartor şi din
care pare a deriva, în acestă lumină, cuvântul tătar. Cel mai cunoscut reprezentat al
nemului titanilor este Prometheu, despre care întreaga antichitate avea imaginea
unui erou civilizator, cel mai înţelept dintre titani. După cum putem observa,
titanii, vechii uriaşi, nu erau altceva decât un neam pelasg, mai ales că în
genealogiile străvechi, Titan, părintele titanilor ar fi fost nepot al lui Pelasg. Gradul
de rudenie al acestor genealogii antice arată de cele mai multe ori filiaţia anumitor
triburi sau neamuri întregi la o anumită tulpină genealogica adică la un neam
mamă.
GIGANTII

Mărturii despre existenţa giganţilor există încă din timpuri biblice. De fapt,
majoritatea culturilor şi miturilor lumii vorbesc despre existenţa misterioasei rase
de uriaşi care popula pământul, alături de oameni, în timpurile de demult. Nimeni
însă nu a putut dovedi existenţa lor, s-au cel puţin aşa s-a crezut. Asta până în
secolul al XVI-lea, odată cu prima călătorie în jurul lumii a lui Fernando Magellan
şi a declaraţiilor uimitoare pe care aveau să le faca puţinii supravieţuitori ai
expeditiei. La 6 septembrie 1522, un vas fantomatic ancora în portul spaniol
Sanlucar de Barrameda. Era corabia Victoria, singura navă din cele cinci cu care
portughezul Fernao de Magalhaes (Fernando Magellan) plecase în prima încercare
reuşită de a înconjura pământul. Doar 18 marinari din cei 260 care ridicaseră
ancora cu trei ani în urmă, supravieţuiseră temerarei călatorii. Printre cei căzuţi se
afla însuşi Magellan, ucis în luptele cu băştinaşii din Filipine, cu mult timp înainte
ca nava Victoria să ajungă la destinaţie. Alături de supravieţuitori se afla, însă,
Antonio Pigafetta, geograful şi istoricul care notase în amănunt toate detaliile
călătoriei. Dincolo de valoarea incomensurabilă a documentului redactat de
Pigafetta, o menţiune a acestuia avea să stârnească mari controverse în cercurile
academice ale vremii şi să îi aduca o notorietate pe care, poate, acesta nu şi-o
dorise. „Într-una din zile, am zărit la ţărm un barbat de o statură uriaşă care cânta,
dansa şi îşi arunca praf deasupra capului. Căpitanul a trimis la mal unul dintre
marinari, care să execute acelaşi mişcări ca un semn de pace. După ce a făcut toate
acestea, omul l-a adus pe gigant până la marginea unei insule acolo unde căpitanul
îi aştepta. Atunci când gigantul ajuns în faţa căpitanului a fost atât de uimit încât ne
arata prin semne că suntem veniţi din ceruri. Era atât de înalt încât de abia îi
ajungeam până la mijloc.” Mai târziu, Pigafetta avea să îl citeze pe Magellan, care
îi numea pe uriaşi „Patagoni”, termen însemnând în spaniola veche, cel mai
15
probabil, „picioare uriaşe”. Avea să fie prima mărturie scrisă despre existenţa
ţinutului numit Patagonia şi a primilor săi locuitori care au venit în contact cu
civilizaţia spaniolă. Aproape 7 decenii mai târziu, în 1591, un alt explorator
celebru, Anthony Knivet, avea să aducă din Patagonia aceleaşi mărturii ca şi cele
ale supravieţuitorilor expediţiei lui Magellan. Knivet pomeneşte de întâlnirea cu
giganţii patagonezi şi estimează înălţimea acestora la peste patru metri. Ba mai
mult, chiar şi numele lui Francis Drake, renumitul căpitan englez, avea să apară
menţionat în jurnalul nepotului său, participant alături de acesta la călatoria în jurul
lumii, unde este pomenit contactul cu aceiaşi uriaşi misterioşi. Alături de numele
celebre care menţionează întâlnirea cu giganţii patagonezi se numară şi omul de
ştiinţă francez Charles de Brosses, cel care în a sa „Historie des navigations aux
terres australes”, publicată în 1756, avea să descrie ciudata rasă de oameni a cărei
medie de înălţime o estimează la circa patru metri. Chiar şi James Cook, căpitanul
englez de numele căruia se leagă descoperirea Noii Zeelande, avea să noteze în
jurnalul său existenţa acestor uriaşi. Echipajul său avea să captureze unul dintre
nativii patagonezi în încercarea de a-l aduce în Anglia. Bărbatul avea, însă, să rupă
sforile care îl legau şi va evada aruncându-se în ocean. Cook va mai menţiona că
deşi el însuşi avea o înălţime peste medie în lumea contemporanilor săi, ar fi
încăput cu uşurinţă sub braţul unui asemenea gigant. Descrierea sa pare, totuşi, mai
temperată şi considera că înălţimea patagonezilor nu ar fi depăşit doi metri şi
jumătate. În ciuda numeroaselor mărturii, au existat şi multi sceptici care să nege
existenţa uriaşilor din Patagonia, pe care îi considerau simple creaţii ale unor minţi
înflăcărate, dornice de celebritate. O serie întreagă de navigatori avea să străbată
ţărmurile Americii de Sud timp de trei secole, fără a întâlni măcar unul dintre
gigantii mentionaţi anterior. Pentru a ridica orice urmă de mister care învăluia
existenţa acestora, guvernul englez finanţează, în 1767, o expediţie condusă de
căpitanul John Byron. Scopul acestuia era de a călători până în Patagonia şi de a
rezolva odată pentru totdeauna problema aşa-zişilor giganţi. La bordul navei
H.M.S. Dolphin, Byron, unul dintre cei mai mari sceptici în problema uriaşilor,
avea să navigheze până în America de Sud, acolo unde va strânge o importantă
colecţie de date pe care o va prezenta în faţa oamenilor de ştiinţă ai epocii.
Concluzia sa avea să fie una şocantă: giganţii existau. În aceeaşi perioadă, presa
vremii avea să publice o imagine desprinsă din relatările lui Byron, care va face
înconjurul lumii în cel mai scurt timp: un bărbat european care oferă o bucată de
pâine unei femei patagoneze de statură uriaşă, în timp ce soţul acesteia priveşte
calm. Era nu numai o dovadă ca giganţii existau, dar şi că erau capabili să înţeleagă
noţiunile civilizate de comerţ, structura familială şi purtare civilizată, în ciuda
aspectului lor sălbatic. Cu toate acestea, în 1773, John Hawkesworth, un renumit
scriitor şi om de ştiinţă englez, va publica o antologie a voiajelor celor care
susţineau existenţa giganţilor patagonezi, antologie în care va ilustra o întreagă
16
serie de erori şi neconcordanţe, menită a distruge mitul care durase deja peste trei
secole. Urmarea acestui tratat se va face simţită puternic în Europa, acolo unde
intereseul pentru uriaşii patagonezi se va reduce simţitor fără a se mai reaprinde
vreodată.
Legenda giganţilor îşi are originile, de fapt, chiar la începuturile lumii, prima
data fiind menţionaţi în mitologia greacă. Giganţii sau Gigas, fiii lui Uranus şi ai
Geei erau nişte figuri uriaşe născute din picăturile de sânge care cădeau pe pământ,
după ce zeul Cronos i-a luat în luptă bărbăţia tatălui său, Uranus. Se spunea că
Geea i-ar fi născut pe giganţi ca să-i răzbune pe fraţii lor, titanii, închişi de către
Zeus în Tartarus. Giganţii erau sprijiniţi de mama lor (alungată de Zeus din Olimp),
şi de aliaţii lor, cei trei Hekatoncheiri. O plantă vrăjită de-a zeiţei Gaia le ajuta
giganţilor în lupta cu Olimpul. Aflând de aceasta, Zeus avea să interzică copiilor
titanilor Hyperion şi Theia, Eos (aurora), Selene (luna) şi Helios (soarele) să apară
înaintea terminării luptei. Deşi de origine divină, giganţii erau totuşi muritori:
puteau fi omorâţi, dar numai de către un zeu şi de către un muritor în acelaşi timp,
motiv pentru care zeii, în gigantomahie (lupta dintre olimpieni şi giganţi), au
chemat în ajutor pe Dionysos şi mai ales pe Heracles a cărui mamă era muritoare,
ambii fiind fiii lui Zeus. Giganţii au atacat cerul, aruncând cu stânci şi cu trunchiuri
de copaci fiind însă nimiciţi de către olimpieni.
La epicii greceşti, giganţii sunt înfăţişaţi ca un gen de oameni superbi,
violenţi şi impii, fiindcă nu aveau credinţă în zei. Statura lor era de o mărime
uimitoare. Ei aveau arme lucitoare şi lăncii lungi în mâini. Gaia sau Terra, scrie
gramaticul Apollodor, supărându-se pentru soarta nefericită a titanilor, nascu din
Uran pe Giganţi, care se distingeau prin mărimea corpului şi prin enormitatea
puterii lor; ei aveau o faţă teribilă şi pletele lungi le cădeau pe jos de pe cap şi de
pe barbă; aveau pe picioare solzi ca de balauri şi aruncau asupra ceriului cu petre şi
cu lemne aprinse. Giganţii formau prin excelenţă un popor de munte. În razboiul
ce-l avură cu noul cârmuitoriu al imperiului pelasg, ei ridicară munţi peste munţi,
ca să urce în Olymp; imensul Atlas se cutremură la asaltul lor şi pe lângă toate că
se aruncă asupra lor cu fulgere, zeii n-au fost în stare să-i învingă decât numai după
ce au cerut ajutoriul unui om muritoriu, al lui Hercule. Patria lor se afla pe
teritoriul Daciei, langa Oceanos Potamos, în aceeaţi regiune unde se născuseră şi
fraţii lor mai mari, titanii. În epoca romană, dacii erau consideraţi ca o posteritate a
vechilor titani şi giganţi. Pe teritoriul Ţarei Româneşti, în apropiere de Cerna, se
află muntele aşa-numit Pregleda. Lipsit de pădure, din cauza unor evenimente
depărtate, suprafaţa sa este acoperită numai cu stânci calcaroase şi arse. Este
vechea Phlegra din istoria giganţilor, care, după cum ne spun autorii greceşti,
primise numele acesta fiindcă a fost arsă de fulgerele din bătălia cu zeii. Identitatea
muntelui Pregleda cu Phlegra din legendele giganţilor o confirmă toate datele
geografice ce le avem în această privinţă. Lângă Phlegra giganţilor se află peştera
17
cea renumită a vechimii numita Avernus. Lângă poalele muntelui Pregleda se află
astăzi o comună românească de moşneni, numită Izvernea, cu o peşteră imensă,
estrem de complicată şi întunecoasă. Lângă Phlegra din geografia timpurilor eroice
au fost acoperiţi cu stânci şi munţi giganţii cei învinşi, numiti avernii, iar în
coastele muntelui numit Pregleda de la Izvernea se mai vede şi astăzi o surpătura
extraordinară sau o tăietura gigantică şi uimitoare, unică în felul său, ce se spune că
a fost făcuta de un urieş.
În partea de sud-vest a Retezatului, se află muntele aşa numit Gugu, iar în
jurul acestui munte trăieşte, din cele mai departate timpuri, o populaţiune de
pastori, oameni robuşti, bărbaţi şi femei de o statură înaltă, adesea uimitoare, cu
tip, cu port şi cu tradiţiuni particulare. Ei sunt numiţi gugani. O parte însemnată din
aceşti pastori gugani se află răspândiţi, încă din timpuri depărtate, prin regiunile
muntoase ale judeţelor Mehedinţi şi Gorj. Aici, ei formează cătunele şi comunele
lor proprii, ducând o viaţă mai mult izolată, de trib, ca şi când ei s-ar considera cei
mai vechi, mai de neam şi cu alt trecut istoric, decât ceilalţi locuitori ai acestei ţări.
Tradiţiunile populare spun despre aceşti gugani ca ei sunt originari din ţara
gugănească, care se află peste munte. Numele de gugani, ce se aplică la aceşti
locuitori munteni, era cunoscut şi antichităţii greceşti. O localitate din regiunea
unde se luptase giganţii cu zeii purta numele de Gigonus. Hercule, ale cărui
legende sub numele de Iorgovan sunt strâns legate de munţii Mehedinţilor, mai
avea la egipteni şi epitetul de gigon. În tradiţiunile române, el este numit „ficior de
mocan” sau de pastoriu de pe culmile Carpatilor. Ligurii (emigraţi de la Carpaţi),
ce locuiau în Italia pe un teren stâncos, aveau un fel de cai şi catâri numiti gygenoi
(adica gugăneţi sau de munte), după cum ne spun cele mai vechi manuscrise ale lui
Strabo. Stabilind astfel regiunea geografică unde îşi aveau locuinţele sale acest trib
de oameni înalţi, superbi şi violenţi, putem acum să ne dăm seama şi despre
originea numelui grecesc de Gigantes.
Cei mai mulţi dintre poeţii, gramaticii şi istoricii greceşti derivau aceasta
numire de la cuvantul „gegeneis”, adică născuţi din pământ, un epitet cari, de
almintrelea, se aplică în vechime la întreg poporul pelasg. Aceasta etimologie însă
nu este exactă. Cuvântul gigas, gigantes nu este de origine grecească. Numele
personal (şi familiar) de Gyges, adecă Guges, era foarte uzitat în timpurile
primitive pelasge. Giganţii, cari în timpurile primitive pelasge ajunsese la o
celebritate aşa de mare, sunt amintiţi şi în tradiţiunile ebraice. Aici figureaza sub
numele de Gog şi Magog. Cea mai veche legendă cu privire la Gog şi Magog o
aflăm la Ezechiel. În una din profeţiile sale, Ezechiel ameninţă pe ebrei ca Iehova
va aduce asupra ţarei lor pe regele Gog, din ţara Magog, cu oastea sa cea frumoasă
de cai şi călăreţi, înarmaţi cu scuturi, coifuri, săbii, lănci, piluri, arcuri şi săgeţi.
Aceştia, venind din fundul meazănoapţii, însoţiţi de alte popoare multe, călărind pe
cai, vor năvali ca o furtună asupra ţarei lui Israel, ca să o prădeze şi devasteze. Ei
18
vor cutreira pământul în triumf, vor duce pe ebrei în captivitate, apoi, împlinindu-şi
misiunea lor, vor fi distruşi cu toţii de mâna ceriului.
Profeţia lui Ezechiel avea, fără îndoială, în vedere tradiţiunile vechi despre
înfricoşatul război al giganţilor, când aceştia, urmărind pe zei, îi alungase până in
Egipt. Profetul Ieremia, care trăise cu puţin înainte de Ezechiel, vorbeşte despre
acelaşi popor, pe care-l numeşte numai simplu, prădătoriul ginţilor (praedo
gentium) care va veni dintr-o ţară depărtată, din părţile de meazănoapte, de la
capătul pământului, popor de călareţi şi arcaşi, vitează, puternic şi vechi, vorbind o
limbă pe care ebreii nu o înţeleg. Ei sunt un popor mare, cruzi şi fără milă; vocea
lor mugeşte ca marea şi vin pe cai mai iuţi decât vulturii, toţi în şiruri ca oameni de
război. Ei vor împresura cetatea Ierusalimului, vor distruge toate cetăţile cele
întărite ale lui Iuda şi vor preface ţara ebreilor într-o pustietate, încât nu va mai
rămâne om în Ierusalim, iar ebreii vor ajunge să fie sclavii străinilor, într-un
pământ cari nu este al lor. Cu şase secule în urma lui Ezechiel, face amintire, de
Gog si Magog, Apocalipsul lui Ioan Theologul. Vorbind despre timpurile cele din
urmă ale lumii, autorul Apocalipsului ne spune că atunci când se vor împlini o mie
de ani de când a fost închis într-un adânc balaurul cel vechi (Typhon, diavolul,
satana), atunci acesta va fi dezlegat şi, ieşind din închisoarea sa, va aduna pe lângă
sine şi va conduce la război pe popoarele Gog şi Magog ce sunt răspândite în cele
patru colţuri ale lumii şi al căror număr este cât năsipul mării. Aceştia se vor
revărsa peste suprafaţa pământului, vor asedia cetatea cea iubită a Ierusalimului, în
urmă însă, focul ceresc va cădea asupra lor şi-i va nimici. În Apocalips, după cum
vedem, noi avem numai o simplă variantă din tradiţiunile de cari ne vorbeşte
Ieremia şi Ezechiel, ori, cu alte cuvinte, din legenda cea veche a giganţilor sau a
pelasgilor de la Carpaţi. Sub numele de Gog şi Magog, cei vechi înţelegeau cu
deoasebire pe geţi şi messageţi. Însă Sântul Augustin, mai mult telog decât istoric,
a cercat să interpreteze pasagele Apocalipsului cu privire la Gog şi Magog, mai
mult în sens eclesiastic. Însă, cu toate acestea, cuvintele sale sunt remarcabile; ele
constată un adevăr istoric, că o parte din autorii vechimii, credincioşi tradiţiunilor
moştenite, înţelegeau sub Gog si Magog, pe geti şi messageti. „Ginţile acestea”,
scrie dânsul, „pe cari Apocalipsul le numeşte Gog şi Magog, nu sunt a se înţelege
astfel ca şi cum ar exista în unele părţi ale pământului oarecari barbari constituiţi
sub numele acesta sau precum îi numesc unii geţi si messageţi”. Tot astfel rezultă,
din oraculele sibiline, că ţările în cari loicuiau popoarele Gog şi Magog, se aflau
situate în nordul Thraciei. Tradiţiunile despre Gog şi Magog ni se prezintă şi în
legendele epice despre Alexandru cel Mare. Ţara popoarelor numite Gog şi Magog
e descrisă în naraţiunile acestea ca neospitalieră, salbatică şi sterilă; ea este expusă
vânturilor, ploilor şi gerului de meazănoapte, însă, câteodată, ţinuturile aceste sunt
înfăţişate ca un pământ fecund şi având o climă foarte blândă.
CARTILE APOCRIFE
19
Pe lângă cărţile pe care le găsim în Noul Testament şi care au fost acceptate
ca fiind canonice, au existat şi altele care au circulat în perioada bisericii primare şi
pe care noi le cunoaştem sub numele de „cărţi apocrife”. Termenul de „apocrif”
înseamnă ascuns, secret. Acest lucru se referă la faptul că mesajul conţinut în ele
era rezervat unui număr restrâns de persoane. Sub denumirea aceasta se regăseau
cărţile care nu fuseseră acceptate în canon. Mai târziu, acest termen a desemnat
cărţile pe care biserica a refuzat să-şi bazeze doctrina şi credinţa şi, deci, nu a
autorizat lectura lor publică în cadrul celebrărilor liturgice. După încheierea
formării canonului biblic, termenul de „apocrif” desemna cărţile care au fost
atribuite în mod fals apostolilor. Îndată după înălţarea la cer a lui Isus, apostolii au
început să predice vestea cea bună la toate neamurile. Creştinii constituiau o
minoritate într-o lume păgână sau în lumea iudaică. Astfel, primii creştini au simţit
nevoia de a se justifica în faţa păgânilor, care aduceau diferite acuzaţii şi afirmaţii
calomnioase la adresa lor. Apoi mai era şi dorinţa de a transmite mesajul creştin la
toate neamurile, iar de acest lucru se simţeau responsabili cu toţii, cuprinşi fiind de
un entuziasm nemaiîtâlnit. Un alt motiv care a dus la redactarea cărţilor apocrife a
fost descoperirea unor aspecte din viaţa lui Isus şi a Sfintei Familii care nu apăreau
în cărţile canonice. În această categorie intră „Protoevanghelia lui Iacob” şi
„Evanghelia lui Toma”. Prima dintre ele vorbeşte despre naşterea Sfintei Fecioare
Maria din părinţi sterili, Ioachim şi Ana, şi aducerea ei la Templu căutând să
clarifice unele răspunsuri referitoare la naşterea feciorelnică, păstrarea fecioriei
Mariei după naştere, descendenţa davidică a lui Isus şi dacă acesta a mai avut sau
nu fraţi.
În legătură cu această ultimă problemă, „Protoevanghelia lui Iacob” spune că
fraţii lui Isus provin dintr-o căsătorie anterioară a lui Iosif. Oricum, în centrul
„Protoevangheliei lui Iacob” se află figura Sfintei Fecioare Maria şi astfel poate fi
considerată drept o evanghelie de pietate populară. Bazându-se pe aceste relatări,
Biserica a instituit o serie de sărbători ale Preacuratei cum sunt Naşterea Sfintei
Fecioare sau Sfânta Marie Mică, Intrarea în Templu a Sfintei Fecioare Maria şi
Adormirea Maicii Domnului, sărbători de o deosebită importanţă pentru toţi
creştinii. „Evanghelia lui Toma” conţine o serie de relatări cu privire la copilăria lui
Isus. Ca şi copil, Isus este prezentat ca fiind capricios, se distra făcând miracole
etc. Dintre faptele prezentate de această evanghelie apocrifă unele s-au păstrat până
în zilele noastre în pietatea populară din ţara noastră şi în tradiţii, de exemplu în
colindul ce vorbeşte despre Isus care plantează în grădina sa un trandafir, din care
să fie împletită cununa încoronării sale. Pe lângă aceste două evanghelii mai
importante există şi altele mai puţin cunoscute cum sunt „Evanghelia evreilor”,
„Evanghelia nazarinenilor” şi „Evanghelia ebioniţilor” (iudeo-creştini care nu
acceptau convertirea păgânilor fără tăierea împrejur şi respectarea pietăţii iudaice),
apoi „Evanghelia lui Filip”, „Evanghelia lui Petru” şi „Evanghelia Adevărului”.
20
Există de asemenea fapte apocrife ale apostolilor, lucrări ce dezvoltă cu
predilecţie elementul miraculos din viaţa apostolilor. Exemple sunt Faptele lui
Toma, ale lui Andrei, ale lui Petru şi ale lui Pavel. Scrisorile apocrife sunt scurte
tratate de teologie. Dar există apocalipse apocrife ca „Păstorul” lui Hermas,
„Apocalipsa lui Petru” ce arată condiţia păcătoşilor şi a drepţilor după moarte şi are
rolul pastoral de a speria păcătoşii şi a-i încuraja pe cei buni. „Apocalipsa lui
Pavel” pretinde să detalieze viziunea din Corinteni capitolul 12, în care apostolul
este ridicat până la al treilea cer. Apocrifele au fost atribuite în mod fals apostolilor
sau persoanelor ce s-au bucurat de o oarecare autoritate pentru a le face mai
credibile. Unele dintre aceste scrieri conţin elemente din diferite erezii care
circulau în perioada respectivă şi de aceea au fost declarate de către biserică drept
necanonice şi nefondate. Altele dintre ele au doar aspect de roman. Toate apocrifele
sunt valoroase pentru literatura creştină. Biserica nu încearcă să ascundă conţinutul
lor, de fapt textele apocrife sunt accesibile tuturor în librării. Este nevoie însă ca ele
să fie citite în spiritul credinţei creştine şi cu asistenţă de specialitate.
În istoria literaturii române, rubrica cărţilor apocrife se cuprinde aşa-numita
literatură bisericească apocrifă, adică poveşti anonime despre diferite întrebări, la
care nu răspunde Biblia şi aşa-numitele pseudepigrafe, cărţi atribuite persoanelor
biblice. Ele ne-au venit prin slavi, care le-au luat de la bizantini şi multe din ele au
fost răspândite de secta religioasă a bogomililor. Dr. Gaster începe cu zidirea lumii
şi cercetează comentariile eretice asupra diferitelor puncte, aşa cum se oglindesc în
literatura slavilor din sud: Adam şi Eva, dracii, Cain şi Abel, Melhisedec, Avraam,
Moise, Solomon, din Vechiul Testament, Hristos, Pilat, Apocalipsul Apostolului
Pavel, Epistolia Maicii Domnului, Minunile sf. Sisoe, Vasile cel Nou, din Noul
Testament. Unele din aceste legende se găsesc în colindele româneşti, în basme, în
manuscrise de întrebări şi răspunsuri, în descântece sau în broşuri speciale.
Legenda lui Melhisedec s-a tipărit întâia oară în 1812 în Iaşi. Trăia la hotarele
Palestinei un fecior de împărat păgân, închinător la idoli. El a avut doi fii: Melhi şi
Melhisedec. Tatăl trimise pe Melhisedec să aducă oi de la cireadă, pentru jertfă.
Tânărul umblând pe câmp, se pătrunse de puterea lui Dumnezeu şi voi să întoarcă
pe tatăl său de la cultul idolilor. Acesta se înfurie şi vru să-l jertfească zeilor.
Intervenind soţia sa, traseră sorţi şi căzu să fie jertfit Melhi. Melhisedec se duse
atunci la muntele Tavorului şi se rugă lui Dumnezeu să prăpădească cetatea şi aşa
se făcu. Şi stete şapte ani Melhisedec acolo şi i se făcu pe spate o coajă ca de
broască, şi-l află, mai târziu, Avraam şi fiindcă nu mai rămăsese nimeni din neamul
lui Melhisedec, i s-a zis că e fără mamă şi tată.
În Apocalipsul Apostolului Pavel e vorba despre vedenia ce a avut Apostolul Pavel,
care a văzut locaşul sfinţilor şi cum iese sufletul din om. Îngerul stă la capul
omului şi când îi iese sufletul îi zice de trei ori: vezi, suflete, să cunoşti acest trup,
căci cu el te vei împreuna la vremea judedăţii. Dacă e bun îl plimbă prin iad ca să
21
vadă ce e acolo şi apoi îl duce în rai, unde se aşază într-un pat sub un pom şi
aşteaptă ziua judecăţii. Se ştiu două redacţiuni româneşti: una pe scurt publicată de
Hasdeu în Cuvinte den bătrâni (vol. II); alta pe larg, dar din acesta cunoaşte dr.
Gaster numai un fragment. Epistola Maicii Donului este una din cărţile poporane
cele mai răspândite la noi până în ziua de azi, pentru că se crede că ea are putere de
talisman, aşa că au obişnuit s-o cumpere chiar oamenii care nu ştiu citi, de vreme
ce, pentru a-şi face efectul e destul s-o pui sub perna unui copil sau unui bolnav. În
cele mai multe ediţiuni se cuprind, sub acest titlu, trei cărţi deosebite: Călătoria
Maicii Domnului la Iad, Visul Maicii Domnului şi Epistolia lui Hristos. Ele se află
tipărite şi separat fiecare. a) Cea mai veche redacţiune românească a Călătoriei este
cea publicată de Haşdeu în „Cuvente den bătrâni” şi datează din sec. al XVI-lea.
Sfânta Maria se rugă de Dumnezeu să trimită pe arhanghelul Mihail pe pământ.
Când se coborî îl întrebă: câte munci sunt şi unde se muncesc oamenii?
Arhanghelul o duse în iad ca să vadă unde şi cum se muncesc oamenii. Urmează
descrierea muncilor: unul spânzurat de picioare şi mâncat de viermi, pentru că a
cumpărat aur prin înşelăciune; o femeie spânzurată de urechi pentru că a ascultat
pe la vecini şi a învrăjbit oamenii; spânzuraţi de limbă mincinoşii şi clevetitorii
ş.a.m.d. Maica Domnului s-a rugat lui Dumnezeu să-i ierte şi li s-a îngăduit să
locuiască în rai din ziua de Paşti până la duminica mare. b) Redacţiunea cea mai
veche a Visului se găseşte într-un manuscris nepublicat încă şi citat de dr. Gaster ca
datând din 1874. E o povestire scurtă, în care se vede că Maica Domnului
adormind, a văzut în vis pe fiul său judecat, bătut, răstignit, iar Hristos i-a spus că
toate acestea are să le pătimească pentru norodul omenesc. c) Epistola lui Hristos,
numită şi Legenda Duminicii, înfăţişează cea mai veche redacţie în citata colecţie
studiată de Haşdeu. Într-o zi a căzut o piatră din cer, mică la vedere, dar grea la
ridicare. Patriarhul Ierusalimului a adunat vlădicii şi a făcut rugăciuni ca să afle ce
este. Un glas din cer le-a spus să desfacă piatra. Desfăcând-o au găsit închisă
epistola prin care Hristos ceartă pe oameni, pentru că nu respectă ziua duminicii.
Le cere deci să se îndrepte şi făgă duieşte răsplată celor ce vor urma sfatul şi
pedepse grozave celor ce nu-l vor asculta.
Şi pentru legenda Sfintei Vineri, redacţia cea mai veche e publicată de
Haşdeu. Textul e o copie după un original scris probabil în regiunea Braşovului,
întrucât se poate judeca după particularităţile de limbă. Sf. Vineri, identică cu sf.
Paraschiva, era fiica unor părinţi care multă vreme doriseră să aibă copii şi cărora
îngerii le prevestise că vor dobândi unul. Când se făcu mare, plecă din casa
părintească pentru a propovădui creştinismul. Ajungând la un împărat păgân, fu
pusă la chinuri: dar ea scăpă neatinsă din toate încercările şi ajunse de boteză şi pe
oamenii împăratului şi chiar pe împărat. Aşa se mai întâmplă şi în alte cetăţi, până
când i se împlini şi ei soarta şi muri pentru credinţă. De aceea ziua de vineri trebuie
serbată cu post şi rugăciune. Tot aşa de răspândită ca Epistolia Maicii Domnului
22
este povestea sfântului Sisoe sau Sisin. E compusă din două letende: Avestiţa, aripa
Satanei şi Minunile sf. Sisoe. Avestiţa, aripa Satanei, este întâmpinată de
Arhanghelul Mihail tocmai în momentul când vrea să se ducă să omoare pruncul ce
avea să nască Fecioara Maria. O apucă de păr, o bate şi o sileşte să spună cele 19
nume şi să dea încredinţare că unde se vor găsi scrise aceste nume nu se va
apropia. Sfântul Sisoe avea o soră, mumă a şase copii, dintre care pe cinci îi luase
Diavolul. Când intră sfântul în casă, se strecură şi Diavolul şi peste noapte fură şi
celălalt copil. Sfântul alergă după el şi aflându-l îl sili să dea pe cei şase copii: ba
chiar îl făcu să dea încredinţare că unde se va citi povestea aceasta şi se va pomeni
numele lui Sisoe, nu se va apropia. Se vede că aceste legende au un element
comun: încredinţarea ce dă Dracul că nu se va apropia de un anumit loc. Acest
element comun explică contopirea celor trei legende. Redacţiunea veche, din sec.
al XVI-lea pe care o publică Haşdeu, cuprinde povestea simplă a Sfântului Sisoe.
Redacţia modernă este contopită. Aci vorbeşte Sf. Sisoe, care a văzut cum a
pedepsit Arhanghelul pe Avestiţa. Reproducem numai încheierea: “Eu mă fac
muscă – zice duhul necurat – eu mă fac păianjene, eu mă fac ogar şi toate
nălucirile, văzute şi nevăzute şi merg de smintesc femeile şi iau copiii şi am 19
nume… Dar unde se vor găsi numirile mele scrise nu mă voi apropia de 7 mile de
loc de acea casă, nici de nimeni câţi vor fi în acea casă, până va fi cerul şi
pământul”.

ZMEII
Considerat în trecut o fiinţă fabuloasă, asemănătoare dragonilor sau trolilor,
zmeul şi-a dovedit în ultima vreme, gratie celor mai bine de douăzeci de exemplare
capturate vii şi a numeroaselor fosile, realitatea biologică, în considerentele
anatomice care urmează ne vom referi în special la zmeul comun, cel mai numeros
şi mai studiat. Celelalte rase si varietăţi de zmei sînt construite pe o schemă
asemănătoare, cu unele particularităţi semnificative.
Zmeii sînt animale inteligente, înrudite de departe cu specia umană. Din
punct de vedere biologic, diversele rase de zmei şi-au dovedit o origine comună.
Cu circa 15 milioane de ani în urmă, un strămoş al omului numit Ramapithecus a
suferit o mutaţie datorată, probabil, consumului aproape exclusiv de mandragore
(popular, mătrăgună). Glanda pineală, aflată la baza craniului, a crescut de circa o
sută de ori în zece milioane de ani, transformîndu-se într-o pungă plină cu lichid
inflamabil. Două canale osoase pornesc de aici, deschizîndu-se în nările
animalului, care poate astfel proiecta după voinţă lichidul vezi-cant, care se aprinde
în contact cu aerul, producînd jeturi de flacără divers colorate. Altă modificare con-
23
stă în trei organe speciale de simţ, inexistente la om. Primul, organul prinţeso-
receptor, asemănător a două scurte antene penate, violete, crescute în dosul ure-
chilor, îi serveşte la detectarea prinţeselor, femele umane speciale, cu care zmeii
masculi (singurii care posedă acest organ) pot procrea. Al doilea este organul
voinicoreceptor, situat în osul tîmplelor, prin care e detectată vigoarea şi tăria în
luptă a altor zmei sau a masculilor umani. Se crede că zmeul poate zări, prin trupul
celui cu care se înfruntă, o fiolă de lichid roşu scînteietor, mai plină sau mai goală,
după tăria adversarului. Ultimul e simţul cristalomandibular, cu care detectează
prezenţa cristalelor de beriliu, de cuarţ de stîncă etc. pe alte planete. Organul co-
respunzător creşte, ca un ţurţure de gheaţă, din bărbia a foarte putini zmei si mai
ales zmeoaice si se curbează-n sus, deschizînd în vîrf un fel de floricică de dantelă
crem. Zmeii dotaţi cu organul cristalomandibular nu luptă, ci dorm întreaga zi, iar
noaptea ies la suprafaţă şi rămîn încremeniţi, sub stele, numărînd cristalele de pe
alte planete. Zmeii normali îi numesc „puah", ceea ce s-ar putea traduce
aproximativ prin „poeţi".
Există deosebiri importante între masculi şi femele în cazul zmeilor. Primii
au cranii groase de cel puţin cinci centimetri, pline de umflături corespunzînd
principalelor trăsături de caracter. Cu cît un zmeu are mai multe cucuie în ţeastă, cu
atît e mai respectat. Cea mai mare umflătură e cea dintre sprîncene, corespunzînd
pungii cu venin. Ochii masculilor sînt tari ca piatra şi sînt protejaţi, în cursul
luptelor, de o pleoapă fumurie. Femelele au pe ţeastă numai trei corniţe colorate,
înclinate după unghiuri care variază cu moda, si glandele lacrimale mari cît porto-
calele, de pleoapele de jos fiind mai mereu atîrnaţi puii, ce se hrănesc cu lacrimi.
Creierul zmeilor nu este împărţit în emisfere. Prin cercetări de laborator s-a
demonstrat că ei îl folosesc mai ales pentru funcţia de „vrăjire", o mică zonă
servind şi funcţiei de „blestem", ambele inexistente la om. Treburile de fiecare zi
sînt rezolvate de doi ganglioni cerebrali, mari cît merele domneşti, localizaţi în
fese. Dentiţia arată că zmeii sînt prădători periculoşi, care şi-au dezvoltat suprafeţe
de masticaţie speciale pentru zdrobirea accesoriilor umane: platoşe, catarame,
ceasuri de mînă, bijuterii.
Corpul zmeilor ar fi avut, poate, o înfăţişare destul de asemănătoare cu a
omului dacă, acum zece milioane de ani, o femelă neatentă nu s-ar fi lăsat vrăjită
de un dragon de Komodo. Rezultatele au fost semnificative pentru evoluţia speciei:
O creastă de solzi laţi, ca de stegozaur, începe la ceafa şi se termină la noada
zmeului, coloraţi în verde la masculi şi transparenţi (cu cîte-un peştişor exotic
24
înotînd în fiecare) la femele. Gheare puternice, adaptate pentru scormonit pămîntul,
pornesc din cele patru degete de la mîini şi de la picioare. Toracele cu pectorali
puternici cuprinde două inimi, care pompează către organe un sînge foarte rece şi
foarte albastru. Intestinele sînt şerpi reali, înghiţiţi odinioară în cursul evoluţiei şi
trăind azi în simbioză cu gazda lor. Nu există organe de reproducere. Femelele de
zmeu rărnîn însărcinate în mod reflex prin îndrăgostire, dar zmeii rezultaţi astfel
sînt sensibili la boli, şi mulţi nu supravieţuiesc. Este motivul pentru care zmeii cei
mai viguroşi răpesc prinţese (numite uneori si domniţe, iar cele mai reuşite —
cosînzene), femele umane cu sînge albastru, compatibil cu al lor. Pe acestea le
fecundează prin vrăjire (proces asupra căruia vom reveni). Femelele îndrăgostite
dezvoltă în stomac mai mulţi embrioni semitransparenţi, atît de verzi încît se pot
vedea prin pîntece, care se devorează reciproc pînă rămîne unul singur, eliminat în
cele din urmă într-o năframă de mătase şi pus imediat la ochiul mamei, de genele
căreia se prinde bine. Va suge aici mai bine de doi ani. Cei născuţi din prinţese se
dezvoltă mult mai greu, atingînd maturitatea în jurul vîrstei de opt ani, cînd sînt
destul de mari ca să verse flăcări pe nări. De-atunci sînt consideraţi adulţi si
pornesc în căutarea domniţelor. Dacă nu e ucis de vreun voinic — duşmanul
natural cel mai important al speciei —, zmeului mediu îi rămîn de trăit aproximativ
două sute de ani.
Specia este pe cale de extincţie, mai cu seamă datorită stingerii treptate a
marilor case domnitoare, singurele furnizoare de prinţese, înlocuirea lor cu in-
telectuale snoabe s-a dovedit un eşec, acestea fiind prea greu de întreţinut.
RASE ŞI VARIETĂŢI
Pe lîngă zmeul comun, prezentat în capitolul precedent, mai există o serie de
rase şi varietăţi cu trăsături specifice, dobîndite datorită izolării geografice a unor
grupuri în vremuri istorice îndepărtate. Cum specimenele din grupuri ce au evoluat
diferit se mai pot împerechea încă între ele, indivizii rezultaţi fiind însă sterili,
putem considera că toate aparţin aceleiaşi mari specii a zmeilor. Prezentăm în
continuare cele mai caracteristice rase de zmei, spe-cificînd că au fost observate şi
exemplare neapar-tinînd nici uneia dintre ele.
Zmeul zmeilor
Exemplar foarte rar, mai masiv si mai feroce decît zmeii comuni. Odinioară
răspîndit din Carpaţiîn Tibet, supravieţuieşte azi doar în cîteva grădini zoologice
particulare americane. Are un craniu masiv, din cristal deosebit de limpede şi de
dur, pentru care a fost vînat din cele mai vechi timpuri. Mărgică de după măseaua
25
de minte este si ea foarte rîvnită datorită puterii sale de a concentra gîndirea. Pur-
tată-ntre sprincene, se crede că asigură succesul la orice examen. Zmeul zmeilor se
naşte numai dintr-un alt zmeu al zmeilor şi dintr-o cosînzeană, subspecie a
prinţeselor. De aceea, în loc de solzi are pe spinare o coamă blondă, pe care si-o
unge bine cu seu. Vine pe lume deja împlătosat si cu buzduganul în mînă. In cursul
vieţii năpârleşte de cîteva ori, lepădînd, în ordine, o platoşă roz, una verde, una
bleu si rămînînd cu cea finală, transparentă ca si craniul, din acelaşi cristal foarte
dur. Totuşi, cum se mînjeste cu noroi si frunze moarte din motive de camuflaj,
rareori se pot zări prin crustele sale exterioare organele interne. Trăieşte cu un veac
mai mult decît zmeul comun şi este cu un cot mai înalt, de aceea i se acordă
întîietate înfricoşată în orice habitat locuit de zmei. E recunoscut de la distanţă
datorită coifului cu cleşti de homar pe care-l poartă pe cap. Flacăra pe care-o scoate
pe nări are cam 15 metri lungime şi e verde pal, cu turbioane mai curind estetice
decît eficiente. De f apt, în luptase bizuie mai mult pe cleşti şi buzdugan.
Zmeul sur de văgăună
Este cel mai viclean şi, în pofida dimensiunilor reduse (cam cît un copil de
zece ani), cel mai vorace. Poartă permanent pe linieri, în chip de epoleţi, două
tarantule negre, cu smocuri de culoarea flăcării la articulaţiile picioarelor.
IntrezifU'u şi păianjenii uriaşi există o strimăsimbioză: zmeul vede exclusiv prin
cei cinci ochi ca boabele de rouă ai fiecărui păianjen, care îl ghidează spre pradă în
speranţa că se vor hrăni cu sîngele ei proaspăt. Această specie, da zmeu arc pielea
palidă datorită eternului întuneric m care trăieşte, in văgăunii?, sak subpămîntene.
Construieşte labirinturi subterane în care-si lîrăşte victimele. E posac şi banal în
conversaţii. Cin d îşi fac vizite, familiile de zmei suri de văgăună se plictisesc atu
de groaznic, în cît nu rareori se măcelăresc între ele. De aceea, preferă să
socializeze cu cei din alte specii, mai ales cu cîinii de zmeu, răbdînd fericiţi luările
peste picior şi (iluziile grosolane. Uneori mor de foame tot ascultînd glumele şi
sporovăială altora. Atunci tarantulele, întotdeauna mascul si femelă, le găuresc
pieptul, le devorează inimile şi plămînii şi, în biserica austeră a cutiei toracice,
rămîn să slujească unui cult straniu, din care rezultă mii de tarantule, minuscule şi
golaşe.
Zmeul cu colţi
Dinţii săi îngrozitor de strimbi, fiecare dăltuit în alt mineral, de altăculoare,
au făcut să-nflorească din vremuri străvechi pe tărimul zmeilor arta stomatologiei.
Dentiştii lor au metode primitive dar eficiente, care elimină tratarea atît de
26
îndelungată, pe canale, a dintelui cariat. O simplă lovitură năpraznică de pumn sau,
în cazuri mai complicate, de buzdugan pestefalc,a suferindă elimină răul. Urmează
înfigerea în alveolele goale a unor pietre de nu frumos şlefuite.
Clinele de zmeu
S-a crezut multa vreme că faimosul,,Am dat de tine, dine de zmeu!" răcnit
de voinici era doar o expresie injurioasă. In realitate, Feţii-Frumosi se confruntau
cu o varietate specială, patrupedă, din rasa zmeilor de cîmpie. Cîinele de zmeu nu
scoate foc pe nări, ci doar un fum mirosind a friptură de purceluş de lapte bine
rumenit, preparat cu hasmaţuki, umplut cu castane coapte, cu sandul crăpat pe
spinare, sei~vit la tavă înconjurat de feliuţe străvezii de ridichi. Mireasma aceasta
nespus de îmbietoare e mai eficientă decît flăcările, căci stîrneste în stomacul
voinicilor nişte ghiorăieli atît de stridente, încît caii speriaţi îi azvîrl din şei pînă-n.
nouri, de se fac mici-fărimici. Clinii de zmeu trăiesc în castele comode, în care nu
lipseşte niciodată biblioteca si salonul literar. Se hrănesc, în general, cu porci de
dine, varietate domestică de facocm. Deşi merg în patru labe, se consideră mai
luminaţi decît ceilalţi zmei. Se înmulţesc prin înmugurire.
Muma zmeilor
Mare cit o casă cu două caturi, aduce la-nfălişare cu o bătrinică. Totuşi e
întotdeauna mascul, obsedat de răpirea de prinţese. Acestea nu se alarmează prea
tare cină, ieşite la cules de ciuperci, întîlnesc o băbuţă, fie ea şi mătăhăloa-să.
Spaima vine mai tîrziu, cînd, îndeobşte, e prea tîrziu.
Zmeul mioritic
Trăieşte în peşterile adinei de sub munţii Carpaţi, aşa-zi-sul Celălalt Tărîm,
unde şi-a întemeiat un imperiu. Lumina acestui enorm spaţiu subteran provine de la
lacurile de lavă care proiectează pe tavan mirifice aurore boreale. Aici sînt codri
concentrici de aramă, de argint şi de aur, plantaţi artificial ca să ascundă, la mijloc,
palatele zmeilor. Zmeul mioritic are o organizare socială matriarhală: şefa clanului
e o zmeoaică bătrînă, în jurul ei trăind feciorii şi fetele ei, ginerii şi nurorile. Fesele
bogate ale femelelor arată că sînt mult mai inteligente decît soţii lor. Cu toate
acestea, îi răsfaţă, le iartă stîngăciile si grosolănia, ba tolerează şi rivalitatea cu
cîteva nefericite prinţese ascunse prin cotloane. Zmeul mioritic este deosebit de
nătîng. Forţa lui fizică enormă nu intimidează, căci îl încurci cu cea mai simplă
cimilitură, cu care-şi bate capul săptămîni întregi. Dacăte-a apucat însă între
degete, nu-i a bună: înfige-n tine gheare de-un cot, nu prea curate, şi tepîrleste cu
două jeturi groase de foc. Masculii poartă cămeşă ţesută cu amici, iţari şi opinci din
27
piele de cerb, iar femelele ie şi catrinţă. Totuşi, zmeilor tineri le miroase mult mai
rar a catrinţă decît a crinolină.
Animicstiutorul
Rasă neatestată ştiinţific, poate legendară. Urmele faimosului Toiag cu
Urechi, ca si ale ghetelor de plumb ce îi sînt atribuite tradiţional s-arfi găsit
imprimate într-un strat de şisturi bituminoase din Caucaz. Din relatările zmeilor
asiatici, Animicstiutorul ar trăi în regiuni muntoase inaccesibile, acoperite de
gheţuri veşnice. Locuinţa sa arată ca o bulă de aer într-un enorm gheţar. Focul pe
care-l scoate pe nări nu arde, ci încălzeşte sufletele, umple inimile cu iubire. E
motivul pentru care zmeii se tem de el mai mult decît de orice, căci nu pot
supravieţui decît o dată unei întîlniri cu el. A doua oară le plezneşte şi cea de-a
doua inimă sub povara unei duioşii ucigătoare. In ochii acestui zmeu poţi vedea, se
zice, neantul de dinaintea facerii lumii. Nenumărate vorbe de înţelepciune îi sînt
atribuite. Dar despre acestea, într-un alt capitol.
Zmeul zmeelor
Confundat, din cauza numelui, cu puternicul zmeu cu coarnă blondă, nimic
nu este totuşi mai deosebit de el. Zmeul zmeelor e o fiinţă inofensivă, delicată, pe
care-o zăreşti din cînd în cînd survolînd pajişti şi fineţe, încurcat în sforile a vreo
douăzeci de zmee cu cozi lungi şi colorate, pe care le înalţă simultan. Vînează
păsări si animale mici, scuipînd cu precizie asupra lor. Se asociază cîte trei sau
patru masculi pentru a răpi o prinţesă. O dată răpită, e măsurată cu un metru de
croitorie şi i se dă drumul înapoi. Tot ce depăşeşte 1,85 m e păstrat.
Zmăul
Un troglodit, în toate sensurile cuvîntului. îşi duce viaţa în peşterile pline de
cristale şi minereuri de pe celălalt tărîm. E războinic, încăpăţînat, de o viclenie
primitivă. Solzii de pe spinare sînt de aramă coclită, iar craniul e dotat cu zece
coarne de jur-împrejur, de la care provine si denumirea de zmeul cu coroană, sub
care mai e cunoscut. Pectoralii îi sînt groşi ca nişte mamele, iar pulpele, ca
trunchiurile de copac. Extrem de dezvoltat e simţul voinicoreceptor, deschis ca
nişte opercule pline de branhii în tîmple. Detectează un om viu de la o depărtare de
peste 10 kilometri. Ascuns pe sub poduri — însoţit cîteodatăde tovarăşul său de
prădăciuni, balaurul cu douăsprezece capete —, iese în faţa voinicilor şi-i provoacă
la luptă. Din aversiune pentru neamul omenesc, pe care a jurat să-l extermine pînă
la Judecata de Apoi (sau, eventual, după), zmăul vrăjeşte numai femele din propria

28
specie. E singura rasă care nu produce, totuşi, puah, ci doarzmăi în toată firea.
Campioni la aruncarea cu buzduganul.
Incălţaţii
Faimoşii stăpîni ai Morii de pepite au pierit cu toţii, în mod tragic, în asediul
cetăţii Desp-Air (6372 î.Cr.). Vinovate de masacru au fost armatele unite ale
zmeilor comuni, zmei-loi~ zmeelor şi zombalilor, urmate şi de mercenari din alte
rase, lacomi să pună mînape Moară, încălţaţii erau numiţi astfel datorită cizmelor
de metal uşor pe care le purtau. Erau, pare-se, zmei înalţi si puternici, cu creste
stacojii. In semn de frăţie îşi sărutau unul altuia buricul, lăsat descoperit printr-un
orificiu în platoşele de sidef. Era şi punctul lor slab, de care au profitat inamicii.
Femelele năşteau cîte cinci pui, din care ucideau patru. Al cincilea primea, la
majorat, cizmele si sărutarea pe buric, pe care trebuiau s-o întoarcă, în aceeaşi zi,
tuturor celor cîteva mii de membri ai poporului lor. Buzele celor mai mulţi se
toceau în cursul acestei obositoare corvezi, aşa încît încălţaţii păreau mereu că
rînjesc.
Zmeul asiatic (sau zombalul)
Acoperit cu solzi sticloşi de culoare galbenă. Ochi oblici şi sprîncene extrem
de-ncruntate. Răcneşte cu gura pînă la urechi, neîncăpătoare de colţi încovoiaţi.
Caninii, mult mai lungi, sînt sfredeliţi şi străbătuţi de inele cu mărgăritar. E cel mai
adaptabil dintre zmei, cel mai harnic şi mai respectuos ierarhic. In ultimele decenii
pare să fi sărit direct din era turnirelor şi expediţiilor de jaf în cea a
microelectronicii. Sub imensele plăci tectonice ale Asiei au fost detectate, săpate
direct în stîncă, hale în care se fabrică chip-uri si memorii, plăci 3D şi sound-
blastere. Unele produse ale lor par să fi pătruns, fraudulos, pe pieţele occidentale,
unde sînt uşor de detectat, avînd fiecare încrustată, în plăcuţa de siliciu plină de
circuite, o boabă de chihlimbar cu o insectă înăuntru. Din fericire, concurenţa f
acută industriilor umane nu e gravă, datorită populaţiei modeste de zmei asiatici
care mai trăiesc astăzi — cam 14 exemplare.
GEOGRAFIE
Existenţa enormului spaţiu subteran numit de geograful danez care a efectuat
primele expediţii, G. Laardsen (1876-l915), Tărîmul întunecimii era deja cunoscută
în mitologiile şi folclorul popoarelor euro-asiatice. Legende despre Walhalla,
Agartha sau Shambala, Celălalt Tărîm din basmele româneşti etc. sînt amintiri
îndepărtate ale continentului subteran. Laardsen a efectuat trei expediţii între 1907
şi 1915, coborînd iniţial prin singura intrare cunoscută pe-atunci, peştera
29
Bourrasque, şi descoperind consecutiv altele, în prima dintre ele a înaintat spre
sud-vest şi, după două săptămîni de mers, a trebuit să se oprească, dînd de un
perete de stîncă. Jurnalul său aduce primele revelaţii despre tulburătoarea lume
subpămînteană: „Măreţ şi melancolic ţinut! Plafonul neregulat, plin de ţurţuri de
sare si cuarţ, se ridică la sute de metri peste capetele noastre... Imense şi fierbinţi
lacuri de lavă aruncă lumini spectrale la kilometri în jur... Pretutindeni tufe uriaşe
de licheni fosforescenţi, fojgăind de insecte oarbe, lungi cît braţul... Coline din
sticla cea mai limpede şi mai lustruită, imposibil de urcat, se ridică pînă aproape de
tavan... Flori cleioase, cu limbi şi spini complicaţi, mecanici aş zice, îşi înfig
rădăcinile chiar în lava clocotită... Prin aer zboară molii livide, al căror corp e mare
cît un stat de om... Ne aşezăm tabăra lîngă un perete încărcat de pirită... Ţipetele
bestiale ale moliilor ne trezesc din minut în minut. Animale necunoscute întind
către noi picioare si trompe transparente... Multe se ard în foc, aici focul pare
necunoscut..." în următoarele expediţii, Laardsen (însoţit şi de Feijenoord)
înaintează cîteva sute de kilometri către est, descoperă vestigiile cetăţii Alma —
după numele soţiei lui Laardsen —, vechi aşezămînt al zmăilor de sub Alpi şi
coboară spre sud unde — aproximativ sub oraşul Civitavecchia — găseşte Frescele
Albastre. Rămaşi fără provizii, cei unsprezece exploratori ajung să se hrănească cu
păianjeni de stîncă şi broaşte gelatinoase, apoi, disperaţi, se devo-rează-ntre ei prin
tragere la sorti. Feijenoord piere, iar Laardsen şi încă patru tovarăşi (vor rămîne în
cele din urmă doar doi) se-ntorc spre Alpi, unde găsesc, la poalele Mont-Blanc-
ului, o nouă ieşire. De-acolo a pornit a treia expediţie, care a atins ca punct extrem
Carpaţii, ieşind prin peştera Ohaba Ponor. Zmei vii n-au fost găsiţi nici acum, dar a
fost identificată o specie nouă de mamifer inteligent, numită provizoriu Omul-de-
flori-cu-barba-de-mătase. Totuşi, scrie exploratorul, „zmeii trebuie să fie undeva...
Ii pot aproape mirosi... Simt în ceafă, uneori, privirea lor arzătoare... Uneori mi se
pare că..." Sînt ultimele cuvinte din jurnal, găsit, cu coperţile parcă mestecate
furios, lîngă corpul dezmembrat al îndrăzneţului călător.
Din 1915 şi pînă la al doilea război mondial au fost întreprinse numeroase
alte expediţii, care-au conturat aproximativ spaţiul subteran. Există şi azi, totuşi,
numeroase pete albe. Un culoar îngust porneşte din Anglia, aproximativ de sub
monumentul megalitic de la Stonehenge şi se lăţeşte treptat către est pînă sub
Lituania. Se extinde spre Urali, şi formează bucle si sinuozităţi către Kazahstan.
Altă ramură începe în Pirinei şi se extinde către Sardinia, coboară sub Mediterana,
străbate Carpaţii, Balcanii şi Turcia, face o imensă cavernă sub Orientul Apropiat şi
30
se uneşte cu prima ramură în dreptul oraşului Karagan-da. Patru mari coarne se-
ntind de-aici. Cornul nordic ajunge pînă la peninsula Taimîr sfîrşind sub insula
Bolşevik din arhipelagul Severnaia Zemlea. Cel median se-ntinde sub Mongolia şi
China pînă la munţii Xaoxinganling. Cel submedian coboară spre Himalaia, unde
se deschide-ntr-o cavernă de aproape un milion de kilometri pătraţi suprafaţă şi trei
kilometri înălţime în punctul cel mai înalt. Ultimul, Cornul de sud, coboară spre
sud-vest către Arabia Saudită. Numeroase enclave izolate, ca nişte mari vizuine,
există peste tot pe marginea giganticelor caverne.
Mari lacuri de lavă, de acid sulfuric şi de mercur reduc cu mult suprafaţa
locuibilă. Distingem, sub zona europeană, lacurile Laardsen I, II, III, IV si V,
marea Feijenoord şi aşa-zisele Fiorduri ale Devoraţilor (omagiu colectiv adus
anonimilor pieriţi prin tragere la sorţi). In zona asiatică avem Pata Argintie — cea
mai întinsă suprafaţă de mercur cunoscută — corespunzînd Chinei de sud — şi
cele 20 000 de Bălti Verniene, numite astfel după autorul Călătoriei spre centrul
Pămîntului.
După vestigiile paleontologice si istorice descoperite în această lume subterană,
putem deduce cu oarecare precizie habitatul originar al diverselor rase de zmei.
Conform hărţii alăturate, zona europeană a cunoscut de-a lungul timpului
convieţuirea, cînd paşnică şi cînd războinică, a patru rase, nu întîmplă-tor cele mai
frecvent menţionate în folclorul popoarelor de aici: zmeul zmeilor, zmăul, dinele
de zmeu şi zmeul mioritic. Incursiuni de pradă şi chiar regate temporare au mai
stabilit aici de-a lungul mileniilor zmeul comun (a cărui patrie e de fapt Caucazul)
şi muma zmeilor. Zona asiatică, mult mai întinsă, a fost împărţită între zombal,
zmeul zmeelor, zmeul sur de văgăună, zmeul cu colţi şi muma zmeilor. Enigma-
ticul Animicstiutor şi-ar fi plimbat faimosul Toiag cu urechi pe undeva, prin
Chomolugma. Situl arheologic de la Kokorro, dedesubtul peninsulei Indochina,
atestă legături comerciale cu regatul zmeului zmeilor. Se schimbau prinţese contra
praf de scărpinat.
Şapte aşezări urbane, descrise mai pe larg în alt capitol, există din vremuri
străvechi în lumea întunecimii, în hrankahranka Oului de Liliac ele sînt numite,
inspirat, Cele Şapte Bijuterii. Misticii, atît din neamul zmeilor cît si din cel
omenesc, au încercat să suprapună aşezarea lor cu cea a unor constelaţii, cu
osemintele unor animale sacre ca Filiala — un fel de sirenă din lacurile de mercur
— sau cu cele şapte chakra înşiruite de-a lungul corpului omenesc. Aceste cetăţi
sînt (de la vest la est): Unna, Dowa, Trikkta, Quatr'a, Phiimpha, Shiksta, Săpata.
31
Cea mai mare dintre ele, şi prima descoperită, sub Kiev, de însuşi Laardsen,
este grandioasa Quatr'a, ce ar fi adăpostit pînă la 25 000 de zmei din neamul
Zmăului. Minusculă e în schimb Dowa, de sub Perpignan, fantezie a unui singur
cîine de zmeu care şi-a clădit vreo zece case înconjurate de un zid gros, cu
sclipiciuri de mica. în piaţeta din faţa casei din mijloc acest original îşi instalase
cortul în care locuia cu cele cinci soţii şi cu unicul copil. Marea majoritate a
zmeilor a preferat însă, dintotdeauna, să locuiască în peşteri, în bule de aer din
gheţari sau în vizuine săpate cu ghearele. Un mare zid, asemănător celui chinezesc,
construit pe la 3500 î.Cr., separa, aproximativ pe sub albia fluviului Enisei, spaţiul
subteran în două zone. A fost construit, probabil, de zmeii „europeni" ca apărare în
faţa năvălirilor „asiaticilor". Zidul e azi în ruine. Ca o ciudăţenie merită amintit
faptul că, din loc în loc, zidul era străbătut de aşa-zisele „găuri pentru trădători",
mici porţi prin care trădătorii puteau ieşi ca să contacteze duşmanii. Zmeii
consideră trădarea o necesitate şi o-ncurajează ca atare. Ea nu poate schimba soarta
unui război, pentru că trădările dintr-o tabără se anulează cu cele din tabăra opusă,
în schimb, cînd se-ntorceau de la întîlnirile secrete cu duşmanul, trădătorii aduceau
cu ei daruri şi mărfuri de contrabandă, foarte apreciate. O ghildă a trădătorilor
funcţiona în orice oraş, iar starostele lor devenea automat membru în Dooma
Parochiei respective (vezi Organizarea politică).
întinse păduri de licheni fosforescenţi, străbătute de rîuri de lavă, formau obstacole
de nestrăbătut altădată pentru zmei. Ele trebuiau ocolite pe distanţe enorme.
Pădurile fojgăiau de animale cavernicole transparente: păianjeni, miriapozi, harpii,
tuute, zuuuze, fiuuuuuse, ţiuuuuuuuuuuuuuure şi miuuuuuuuuu-uuuuuuuuuuuuune.
Ultimele cinci specii sînt azi dispărute, iar harpiile mai supravieţuiesc doar
în captivitate. Deşi păianjenii erau uneori mari cît un stat de om slăveau glande de
venin cît o minge de fotbal, ei nu stîrneau atîta teroare ca faimoasa fiuuuuusă, un
delicat viermişor palid care pătrundea în nara zmeului adormit, ajungea-n creier şi
acolo întorcea comutatorul sexual, aşa încît zmeul devenea brusc zmeoaică, îşi
împletea cozi la modă şi atrăgea la marginea pădurii alţi zmei, pradă pentru
fiuuuuuse.
Din loc în loc, presărate de-a lungul si de-a latul Tărîmului întunecimii, se
mai pot zări încă si azi Ste-iurile şi Frescele. Steiurile sînt lame de stîncă galben-
31opalină, trandafirie sau indigo înălţate spre boltă, în interior au scări în spirală
care duc către o terasă din vîrf, uneori la peste o sută de metri înălţime. Sus te
întîmpină un zmeu mumificat, îmbrăcat în platoşă, cu coif pe cap si cu mari ovale
32
de jad în locul ochilor. De obicei e înfăţişat într-o ipostază marţială, bă-tîndu-se cu
pumnul în piept sau ridicînd ameninţător buzduganul. Ignoranţi ai artei sculpturii,
zmeii păstrau în acest chip memoria eroilor de altădată. O dată cu dezvoltarea
turismului în spaţiul subteran, aceste venerabile monumente au fost nu de puţine
ori vandalizate, acoperite cu inscripţii obscene, zmeilor li s-au pus ţigări în gură
etc. Faptele sînt reprobabile si ar trebui pedepsite prin lege. Alte monumente sînt
Frescele. Ele corespund, de asemenea, nevoii zmeilor de a consemna, pentru
eternitate, vechi fapte de arme. Pereţi enormi de stîncă au fost frumos neteziţi, iar
apoi, în lipsa ştiinţei picturii, generalii înşişi care-au cîştigat bătălia respectivă, îm-
preună cu numeroşi soldaţi de-ai lor şi cu prizonierii inamici, au fost ucişi şi
trupurile lor aşezate în tablou în poziţii corespunzătoare. Peste toţi a fost turnată
apoi lavă albastră sau cenuşie. Azi frescele se văd de departe, povestind, în
altoreliefuri sugestive, despre eroismul strămoşilor zmeieşti.
In zilele noastre Tărîmul întunecimii este exploatat de numeroase societăţi
miniere. Se extrag de-aici zinc, mercur, aur, beriliu, antimoniu si ojă de unghii.
Zmeii actuali trăiesc în rezervaţii, unde li s-a asigurat tot confortul necesar: lumină,
apă caldă, instalaţii igienice, îşi cîştigă existenţa ca actori în filmele despre zmei si
vînzînd diverse produse artizanale. Boli aduse de oameni, între care banala
fobofobie (teama ca nu cumva să ti se facă teamă), fac aici numeroase victime.
ISTORIE
Primele mărturii istorice care atestă culturi ale zmeilor pe (şi mai ales sub)
teritoriul Eurasiei — zmeii sînt complet absenţi pe celelalte continente — începînd
din mileniul al şaselea Î.Cr. au fost scoase la lumină în 1905 de către lordul
Humphrey. E vorba de faimoasele coifuri „cu ace de seringă" găsite în peştera
Bourrasque din Pirinei. „A fost cea mai fericită zi din viaţa mea", a declarat ulterior
lordul Humphrey. „Asemenea lui Schliemann, descoperitorul Troiei, am avut şi eu
încredere în vechile poveşti. Cum de mic îmi veneram mama, n-am putut crede nici
o clipă că minunatele istorii cu care mă adormea erau minciuni. Mama mea nu
putea minţi! Deci: zmeii trebuiau să existe pe undeva. Acum, cînd acest vis mi s-a-
ndeplinit, pot să mă dedic în continuare căutării lui Bau-Bau, fiinţă de a cărei
realitate istorică, de asemenea, nu mă-ndoiesc/' Pe lîngă coifuri, în peştera
Bourrasque a fost pentru prima dată găsită o intrare către Celălalt Tărîm, uriaş gol
subteran ce se-ntinde, extrem de sinuos, de la Stonehenge la Hi-roshima. Mai cu
seamă în acest spaţiu, în care domneşte crepusculul slabelor luciri ale florilor de
mină, lichenilor fosforescenţi şi lacurilor de lavă, s-au făcut descoperiri
33
arheologice fascinante. Exact dedesubtul Kievului a fost găsită o măreaţă
construcţie ruinată, din steiuri de piatră arătînd ca nişte lame de pumnal spre
tavanul cu stalactite al grotei. Ruina era încă locuită de un trib degenerat de zmei
cu colţi, care n-aveau însă nici o legătură cu străvechii constructori. Descifrînd
scrierea aşa-numită serpuită Z de pe unii monoliţi, istoricii au putut acoperi o parte
din istoria străveche a zmeilor. Se vorbea acolo despre triburi rătăcitoare, eroi si
masacre. Acum treisprezece mii de ani, Dragg-Onn a unificat triburile de zmei
asiatici. Toate celelalte rase, subjugate, au fost folosite la ridicarea unor cetăţi
nesăbuite, cu mari camere de tortură în pivniţele lor fără fund. Pe la 6500 î.Cr.
înregistrăm revolta lui Killar, cel care, reuşind să găsească Gemă înaltelor Trăsături
de Caracter (pare-se, un safir mare cît o portocală păzit de şerpi înaripaţi), a ajuns
stăpînul Regatului de Vest şi un semizeu mult cîntat în vechile epopei (vezi
Zurbele). Urmaşii lui Dragg-Onn n-au suportat ştirbirea vechiului teritoriu şi au
pornit un război necruţător contra urmaşilor lui Killar. Atunci şi-au inventat rasele
diversele buzdugane nimicitoare. Ca urmare a acestei încleştări de aproape 1500 de
ani, întreaga civilizaţie zrneiască neolitică s-a ruinat. Dinjfiecare rasă au rămas
doar cîţiva supravieţuitori (iar încălţaţii, constructorii Morii de Pepite de sub marea
Ohoţk, au pierit pentru totdeauna). De-atunci, într-un ultim efort de a păstra
amintirea trecutului glorios, supravieţuitorii au ridicat Babelul de sub Kiev si-apoi
s-au risipit în toate ungherele uriaşei caverne.
Cu 4000 de ani înainte de Cristos, zmeii au descoperit Suprafaţa, în căutare
de faguri ai albinei palide, spune legenda, cîţiva cîini de zmeu s-au căţărat pe o
stalactită groasă cît un trunchi de copac şi au împins cu umărul un enorm bolovan.
Conducătorul lor va rămîne în Zurbe cu numele de Okki-Mei-Okki-Mei (Cel care a
văzut lumina), pentru că, într-ade-văr, imensa boltă albastră de la suprafaţă si
străfulgerarea orbitoare a soarelui au fost atunci pentru prima dată zărite de neamul
zmeilor după cîteva zeci de milenii de recluziune în imperiul umbrelor. Ştim azi că
zmeul, iniţial un animal de suprafaţă, a trebuit să se retragă în adînc, în vremuri
imemoriale, din cauza hienei uriaşe care-l vîna cu predilecţie. Zurba „Platoşei de
rinocer" povesteşte cum grupul de zmei palizi ca moartea au înnoptat prima dată
sub diamantele stelelor si cum, dimineaţa, s-au răs-pîndit prin iarba înrourată,
smălţată de flori. Cum azurul înmiresmat, plin de fluturi, îi înspăimînta.
La suprafaţă, urmaşii acestei mici cete au găsit mine de aur şi antimoniu. Şi-au
construit palate în codri circulari. Au întîlnit prinţese visătoare, plim-bîndu-se la
pasul calului pe malul unor ape albastre ca si ochii lor, şi le-au intuit potenţialul
34
reproduc-tiv. Le-au răpit en gros şi en detail. Cosînzenele, prinţese cu coade blonde
şi cu un mic tatuaj pe fesa stingă, au generat noua şi puternica rasă a zmeului
zmeilor. Ieşirea din Pirinei a fost urmată, de-a lungul secolelor, de alte migraţii, pe
măsură ce erau descoperite, în peşteri din diverse masive muntoase, alte si alte
ieşiri. Secta stranie a poeţilor — cei ce aveau să producă atît de preţuitele Visse,
Zurbe şi Hrankahmnkas — şi-a dezvoltat simţul cristalomandibular pînă la per-
fecţiune. Oricare dintre ei, „mirosind" nopţi întregi viforul constelaţiilor, putea
spune cît la sută cuarţ si cît la sută zirconiu se găsesc pe al cincilea satelit al celei
de-a opta planete ce înconjoară steaua Arc-turus...
Ieşind la suprafaţă, zmeii s-au confruntat, inevitabil, cu specia umană, deja
destul de răspîhdită, mai cu seamă în bazinul mediteranean şi în Orientul Apropiat.
Iniţial, zmeii (în primul rînd zmeul comun, zmeul zmeilor si zmeul mioritic
ce a populat curbura Carpaţilor) i-au privit pe oameni exclusiv ca pe nişte animale
domestice, furnizoare de carne, lapte şi prinţese. Oraşele-state au fost atacate, pe
rînd, de hoarde zmeieşti care le-au dărîmat zidurile şi le-au obligat la plata unui
tribut. Au fost întemeiate, conform Vissei de la Saana, trei mari formaţiuni
prestatale zmeieşti, fiecare cu propria ei organizare si religie, numite kook-uri:
Noo-kook, Vann-kook şi Bang-kook (Regatul de Nord, de Vest si de Est). De
remarcat că numele oraşului actual Bangkok păstrează amintirea străvechiului
regat. Pe la 1400 î.Cr., puterea zmeilor de suprafaţă a atins amplitudinea maximă.
Au trecut secole pînă cînd oamenii, iniţial şocaţi de confruntarea cu noua şi
înspăimîntătoarea specie, să se trezească din amorţire şi să înceapă contraatacul. In
pericol de dispariţie, specia şi-a descoperit resurse neaşteptate. La 1200 î.Cr.
împăraţii Verde, Roşu şi Mov au iniţiat un complot ce avea să răstoarne situaţia.
Planul avea două părţi. Prima consta într-o acţiune ultrasecretă de spionaj
industrial. Printre sclavii care lucrau în atelierele de arme ale Regatului de Vest au
fost infiltraţi specialişti care au furat proiectele celor mai eficiente buzdugane, ca si
mostre de materiale. Au putut fi astfel reproduse faimoasele Toroy-Pan,
Buzduganul cu Trei Peceţi (altfel numit Cu Pernă) si Numele Tatălui. Enormele
arme erau însă imposibil de ridicat. S-a trecut, deci, la partea a doua a proiectului.
Au fost selectaţi din prostime flăcăii cei mai viguroşi, care-au fost apoi supuşi unor
minuţioase si istovitoare antrenamente de body-building. Li s-au dat cele mai
zdravene neveste. Fiii fiilor fiilor fiilor lor, după antrenarea intensă a fiecărei
generaţii, au reuşit să clintească un pic buzduganul, iar fiii fiilor fiilor acestora l-au
putut ridica pînă aproape de genunchi. Din fericire, omenirea n-a trebuit să mai
35
aştepte alte cîteva generaţii, căci Voinicul a^ apărut spontan, ca urmare a cine ştie
cărei mutaţii, într-o zi, un flăcău subţiratic, cu totul deosebit de pachetele de
muşchi ale celor „din plan", a ieşit în curte şi a smuls din rădăcini un stejar plin de
ghinde. L-a curăţat frumos de crengi şi a făcut o ditai ghioaga, bătută-n ţinte de
aramă, pe care-a az-vîrlit-o pînă-n nouri şi, după trei zile, a prins-o pe degetul mic.
împăraţii si culturiştii au rămas cu gurile căscate şi au aplaudat în silă. De-atunci,
voinici asemenea primului cutreieră veseli lunci şi văi, horind şi doinind, în căutare
de zmei.
Istoria medievală e în acelaşi timp foarte bogată si extrem de monotonă. Ea
abundă în nenumărate înfruntări între zmei şi voinici, al căror mobil este, de obicei,
femela umană. Aici, povestirile eroice zmeieşti si cele umane diferă radical, în
primele, schema este următoarea: l. zmeul detectează domniţa prin simţul
prinţesoreceptor. 2. zmeul se deplasează spre palatul domniţei. 3. zmeul supune
oastea împăratului (tatăl fetei) şi obţine prinţesa ca tribut. 4. o duce în propriul
castel si-o vrăjeşte. 5. zmeul detectează prin preajmă un voinic. 6. ajutat de
domniţă — care, de obicei, scoate ochii voinicului — zmeul îl ucide pe voinic. 7.
zmeul şi domniţa fac copii şi trăiesc fericiţi pîn-la adînci bătrîneţi. Povestirile
umane răstoarnă întrucîtva această schemă narativă: 1. zmeul răpeşte prinţesa. 2.
împăratul pune un premiu pe capul zmeului: fiica de soţie şi jumătate din îm-
părăţie. 3. mulţi voinici încearcă în zadar. 4. soseşte Voinicul. 5. el ajunge la palatul
zmeului. 6. ajutat de domniţă — care, de obicei, îl induce-n eroare pe zmeu —
voinicul îl ucide pe zmeu. 7. voinicul şi domniţa fac copii si trăiesc fericiţi pîn-la
adinei bătrîneţi. Punînd în cumpănă aceste cronici oarecum partizane, istoricul
ajunge, vrînd-nevrînd, la concluzia că uneori trebuie să fi cîştigat zmeul, alteori
voinicul şi că, tinzînd către un fel de hibridizare, rasa umană si cea zmeiască n-ar fi
fost, de fapt, atît de aprige duşmane cum s-a crezut pînă de curînd. Există, de altfel,
dovezi că, în decursul Evului Mediu, între ele au existat comerţ, contrabandă şi
schimb de idei.
Situaţia s-a dezechilibrat dramatic în momentul în care, poate printr-o nouă
mutaţie, către 1250 după Cristos, a apărut super-eroul umanităţii, purtînd numele
de Făt-Frumos (foetusformosus). Unele femei însărcinate — conform statisticilor
oficiale cam una la 100 000 — observau, în timpul scaldei, că pîntecele le-a
devenit străveziu ca un zgîrci şi că prin sticla lui se zăreşte un făt minunat, cu părul
numai bucle de aur. Ochii lui mari şi apoşi păreau că grăiesc. Primele femei care-
au vorbit despre vedenia aceasta au fost arse pe rug ca vrăjitoare. Altele au născut
36
în locuri ascunse. Mare le-a fost uimirea cînd, după trei zile, s-au pomenit cu cîte
un vlăjgan pletos, cu cercel în ureche, care le zicea „mamă". Feţii-Frumoşi s-au
dovedit imbatabili în înfruntările cu zmeii. Doar zmeul zmeilor si zmeul mioritic
le-au făcut oarecum faţă, nereuşind să cîstige nici ei, de altfel, mai mult de două
bătălii (setth-uri în limba zmeilor) din cinci. Din acel moment, soarta zmeilor de
suprafaţă a fost pecetluită. Ei si-au părăsit palatele şi s-au retras iarăşi în lumea
subpămînteană, jelindu-şi gloria apusă.
De pe la 1400 pînă la revelaţia lordului Humphrey amintirea zmeilor s-a
estompat în aşa măsură, încît cei mai multi oameni considerau zmeul doar un pro-
dus al imaginaţiei, o frumoasă legendă din folclorul popoarelor. Cîte o urmă de
picior imprimată în lut apărea din cînd în cînd, menţinînd treaz interesul publicului.
Cele mai multe se dovedeau falsuri grosolane. Chiar şi după 1905, un dispreţ
cvasi-unanim acoperea orice încercare neortodoxă de a privi istoria. Cu toate
acestea, recente sondaje în arhive arată că atît CIA cît şi KGB-ul erau la curent cu
existenţa reală a zmeilor si că posedau, în unităţi militare secrete, cîteva
buzdugane, intens studiate, încrucişări sinistre între cele două rase ar fi fost
încercate pentru crearea soldatului care să scoată flăcări pe nări. Azi, în faţa
zdrobitoarelor dovezi paleontologice, arheologice, istoriografice, ca să nu mai
vorbim de exemplarele vii capturate în subteran ca şi de cele, vechi de sute de ani,
prinse în gheţurile mării Bering, scepticismul omului de ştiinţă trebuie să cedeze.
Recentul congres internaţional cu tema „Zmeul, contemporanul nostru"
(Zimnicea, 1983) a marcat o definitivă acceptare a fenomenului.
ARME
Diferitele rase de zmei folosesc în luptă arme diferite. Totuşi, ele pot fi
grupate în cîteva categorii generale:
Arme de atac
Le putem, la rîndul lor, clasifica după cum urmează:
-arme biologice: jetul de lichid incendiar împroşcat din nări asupra adversarului,
colţii si ghearele năprasnice, scuipatul cu precizie (zmeul zmeelor), loviturile
violente de cap în gură (zmeul zmeilor), împunsul (zmeul cu coroană), trînta „că-i
mai dreaptă" (zmeul mioritic), în acest ultim caz toate trucurile sînt permise.
-arme verbale: înjurătura cu efect, blestemul în lung de linie, imprecaţia bifurcată,
bălmăjeala, gîn-găveala (zmeul sur de văgăună), imitarea, scălîm-barea (zmeul cu
colţi). Sudalma simplă, dublă şi triplă e mînuită cu deosebită dexteritate. Dar poate
cea mai eficientă armă verbală, mortală cînd e folosită de cîinele de zmeu sau de
37
muma zmeilor, este îmbălarea, care constă în lăudarea deşănţată, prelungă,
mieroasă si insistentă a adversarului. Prins într-un ghemotoc de fire umede care se
solidifică rapid în contact cu aerul, acestuia nu-i mai rămîne nici o şansă. Mai toţi
zmeii vorbesc morfolit, printre colţi. Cu desăvîrşire mut pare a fi Animicştiutorul
(de la care ne-au rămas totuşi comori de înţelepciune scrise pe coji de ouă).
Oratorii speciei sînt zombalii, care nu pronunţă cuvinte, ci clinchete de
ineluşe agăţate în colţi, deosebit de convingătoare (spun zmeii). Mai multe despre
limba zmeilor, într-un capitol special. ^ artefacturi: sînt armele propriu-zise,
fabricate de zmeii înşişi. Acestea sînt de trei feluri: contondente, tăioase si
energizante.
Armele contondente au toate ca model primordial buzduganul, evoluat dintr-
o simplă măciucă primitivă. Datele culese pînă în prezent ne îndrituiesc să credem
că absolut toate rasele de zmei, actuale sau fosile, au folosit sau folosesc
buzduganul. Arme enorme de piatră (mai tîrziu de bronz, fier şi chiar plumb)
imposibil de ridicat de mîna omului, se găsesc presărate în vadurile rîurilor sau în
situri arheologice, unde sînt exhumate alături de cranii cu mari orbite omeneşti, dar
cu colţi uriaşi pe mandibule şi prelungite cu o coloană vertebrală de sopîrlă. Buz-
duganele din muzeele lumii, mai vechi sau mai noi, sînt specifice fiecărei rase:
-Zmeul zmeilor foloseşte asa-numitul „Numele Tatălui", un soi de baros din
platină de o puritate atît de înaltă încît, prin calităţile sale conductoare, atrage
fulgerul din înaltul cerului si-l prăvăleşte asupra adversarului. Dacă acesta nu piere
din prima flacără albăstruie, primeşte direct în ţeastă o a doua lovitură, de data
aceasta cu buzduganul însuşi. Cei din urmă zmei ai zmeilor folosesc buzdugane de
titan, ca să nu poată fi detectate de radare.
-Zmeul sur de văgăună roteşte cu dexteritate deasupra capului ceea ce el
numeşte „Toroy-Pan" (literal: Distruge-Tot), o bilă de fier legată cu sîrmă,
asemenea ciocanelor din proba olimpică. O învîrte atît de repede, încît fierul se-
ncinge la roşu prin frecarea cu aerul. Cînd arma se găseşte pe linia adversarului,
tarantulele îi fac zmeului un semn cu labele pe umeri, iar acesta dă drumul bilei.
Vai de el, însă, dacă o face prea devreme sau prea tîrziu: bila atunci nu mai
porneşte, iar sîrma se învîrte în jurul corpului nefericitului zmeu, tăindu-l fin, în
feliuţe ca de salam. Acest accident se petrece, însă, destui de rar.
Buzduganul zmeului cu colţi constituie un frumos exemplu de simbioză cu
corpul posesorului. Cînd micul zmeu se naşte, tatăl său, în cadrul unui frumos
ceremonial, îi aşază în palma dreaptă o să-mînţă de Leucă (leuca draco), arbust de
38
esenţă dură care creşte doar pe platourile înalte din Altai. Pruncul simte-n aceeaşi
clipă o arsură în podul palmei şi-nce-pe să urle sălbatic, la care tatăl îl anesteziază
prompt cu buzduganul propriu. Lovit cu Leuca, pruncul a primit botezul obştii în
care se va integra. Din sămîn-ţă va creşte cu timpul o Leucă viguroasă, avînd rădă-
cini adînc împlîntate în zmeu, pe care-l parazitează, dar îl şi apără.
Pînă si dinele de zmeu, rasă patrupedă, are buzdugan. Renunţînd de milenii
la reproducerea sexua-tă, falusul său a fost eliberat de vechile atribuţii şi, sub
numele de Buul-Ann (onomatopee lipsită de conţinut noţional), a devenit o armă
redutabilă.
Muma zmeilor foloseşte Moaca, un cap de om preparat special ca să devină
dur ca bazaltul, înfipt într-o coadă de palisandru. Moaca apare cînd nu te-astepti în
mîna acestei bătrînici pe care ai tot trece-o strada, cînd înainte, cînd înapoi, din zori
si pînă-n seară...
Adevăratul buzdugan este cel Cu Trei Peceţi, arma de atac a zmeului
mioritic. După unghiul din care e privit, acest super-buzdugan poate părea în-
spăimîntător (partea cu ţepii) sau îmbietor (partea cu perna), într-adevăr,
inventatorul acestei adevărate lănci a lui Ahile, legendarul mioritic Ursan, „pletos
ca zimbrul, cu pieptul gros şi lat", este reprezentat în balade, hronir-uri, saga şi
bîlnii ca dormind „culcat pe buzdugan". La fel procedează toţi zmeii carpatini,
fiecare căptusindu-şi scula cu o perniţă dolofană. Buzduganul Cu Trei Peceţi,
azvîrlit în nouri, e prins de zmeu pe degetul mic, hipertonifiat prin îndelungate
flotări.
Animicştiutorul ar avea, în loc de buzdugan, faimosul Toiag cu Urechi. Nu
se ştie de ce acest toiag e atît de faimos, dar i se zice astfel, obligatoriu, aşa cum lui
Ahile i se zice „cel iute de picior" şi Arno-tenilor, „adevăraţii Arnoteni".
Zmeul zmeelor poartă, atîrnat de cureaua de la nădragi, un buzdugănuţ numit
Fîţă, niciodată folosit. Totuşi, un ins care si-ar pierde Fîţa ar ajunge de batjocura
semenilor.
Zmăul este marele campion la aruncarea cu buzduganul. Acesta se numeşte
Matrak (zeul suprem al zmăilor) si are nouăzeci şi nouă de ocale. Din fericire,
fiecare oca — bilă de aramă cu ghivent — poate fi desurubată din coadă şi
aruncată separat. La sfîrşit, se consideră că a fost aruncat buzduganul cu totul.
Ţinta favorită a zmăilor a fost întotdeauna discul rotund si luminos al lunii. O
prorocire spune că acel zmău care va ciobi cu buzduganul buza lunii va stăpîni

39
întreg Tărîmul Celălalt. Cunoscînd ambiguitatea prorocirilor, mai toţi zmăii şi-au
alintat de-atunci soţiile cu numele gingaş de Luna.
Este cu neputinţă să spunem cum îşi numesc buzduganul zmeii asiatici, dar
îl numesc foarte convingător. Cel puţin aşa afirmă ceilalţi zmei. Singurul capturat,
păstrat la British Museum, este un obiect alungit, cu cîteva butoane roşii la
extremităţi. Specialiştii au convenit să-l numească Băţul Bucuriei. Nu se ştie cum
se utilizează.
In fine, zmeul comun foloseşte în luptă Buzduganul.
Armele tăioase nu sînt alintate cu nume şi porecle, dovadă a statutului lor
inferior faţă de cele contondente. Pur si simplu, toţi reprezentanţii rasei zmeilor,
indiferent de sex, poartă înfipte în brîu, atîrnate de cingătoare, ascunse în carîmbul
cizmei, bălăngă-nindu-li-se între picioare şi încurcîndu-i la mers tot soiul de lame
tăioase de tipul sabie, spadă, floretă, paloş, pală, iatagan, hanger, cuţit, pumnal,
stilet, briceag, brici, şiş, şuriu, topor, toporaş, toporişca, secure, bardă, halebardă,
satîr, machetă etc. Mai toate, dat fiind pronunţatul gust pentru baroc şi rococo-ul
tîr-ziu al zmeilor, sînt strunjite în forme atît de şerpuitoare, încît seamănă bine cu
florarele de plastic ale elevilor.
Armele energizante, specifice zmeilor comuni, sînt în număr de trei: cămaşa
de forţă, cravata de forţă şi costumul de forţă. Ele acţionează ca nişte acumulatori
de energie. Cînd un zmeu a îmbrăcat cămaşa de forţă — numită uneori şi cămaşa
morţii — se crede că poate capta culorile din mediul înconjurător pe care,
transformate într-o pastă vîscoasă, le proiectează asupra duşmanului. Peisajul din
jur ar ră-mîne mult mai palid pentru circa o săptămînă. Cravata şi costumul de forţă
ar extrage şi zgomotele, respectiv mirosurile din peisaj. Nu se ştie cît de real este
acest efect si cît e doar autosugestie.
Arme de apărare
Se subîmpart în subiective şi obiective. Subiective, în condiţiile defavorabile
care pot surveni în cursul unei lupte, zmeii recurg la cîteva strategii simple şi
eficiente:
Se fac că plouă. Cu paloşul voinicului în gît, zmeul deschide deasupra
capului o umbrelă şi, cu o expresie visătoare, fredonează ceva dintr-un film cu
Gene Kelly. Işi pun cenuşă-n cap. Presărată fin, serveşte, probabil, la camuflaj îl
iau pe Nu în braţe. „Nu" (corect, Nu) este un idol cu aspect de bufniţă, cioplit
grosolan în lemn de gutui despre care se crede că, legănat în braţe, îndepărtează
pericolul.
40
Se fac că nici usturoi n-au mîncat, nici gura nu le miroase. Speră astfel ca
voinicul să se apropie destul cît să-i poată sufla în nas un damf ucigător de mujdei.
Inchid ochii si — minune! — voinicul a dispărut.
Dau din colt în colţ. Clănţăne adică înfricoşător din dinţi.
Obiective. Pe lîngă pielea tăbăcită şi însolzată faţă de care cea a rinocerilor
este ca obrazul de fecioară, zmeii mai poartă şi diverse varietăţi de platoşe şi
cuirase din cele mai diverse materiale, bine lustruite, aurite, scînteietoare, pe care
şi le transmit din tată-n fiu. Pe ţestele noduroase au coifuri cu ţepi şi panaşe. în
dreptul ochilor, dispozitive de ochire cu fir de păr. Mîinile si picioarele rămîn,
tradiţional, neacoperite.
in luptă poartă şi scuturi, fie din lemn de balsa, atît de uşoare că le dă peste
cap fiecare pală de vînt, fie din oţel nituit, grele de abia le tîrăsc în urma lor,
conformîndu-se teoriilor tactice la modă. O legendă insistentă vorbeşte despre
Scutul Magnific ascuns de un strămoş divinizat al poporului zmeiesc, Baal-Aur, pe
rundul unui lac dinspre răsărit (identificat cu lacul Arai). Cine-l va găsi va dobîndi
invulnerabilitate fată de apă, foc, viscole, cutremure, artilerie si ţînţari, adică va
deveni eroul capabil să termine pentru totdeauna cu mişuna nefolositoare a
Prăpădiţilor de Suprafaţă, cum numesc ei rasa umană.
OCUPAŢII SI UNELTE
Zmeii sînt fiinţe harnice şi pricepute (cu excepţia zmeului cu colţi, harnic,
dar nepriceput şi a cîinelui de zmeu, priceput, dar teribil de leneş). Din timpuri
străvechi au dezvoltat numeroase meserii, în care s-au ilustrat după cum urmează:
Zmeul comun sapă-n pămînt în căutare de mandragore cu ajutorul unei unelte
numite gheară. Aceasta e un fel de mănuşă de fier cu cinci ciocuri ascuţite. Cînd
mandragora e dezgropată, ea ţipă ca un prunc nou-născut. De aceea, zmeul nu uită
niciodată să ia cu el şi al doilea instrument, suzeta. Doar cu suzeta-n gură
mandragora poate fi consumată în linişte. Cînd sînt descoperite într-un cuib mai
mult de nouă mandragore, acestea se pot apăra de zmeu cu formula magică „Fugi,
fugi, zmeule nebun!", rostită în cor pe două voci. Orice zmeu comun cunoaşte
contra-vraja („Nu fug, nu fug, mandragore delicioase!"), dar uneori uită ordinea
cuvintelor si atunci cuibul, înconjurat de o sferă de foc, devine de neatins.
Zmeul zmeilor e miner din tată-n fiu. Simte sulful, nichelul sau plumbul
după miros. Sapă tuneluri subterane cu ajutorul tirbuşonului, pe care-l înfige-n
granit, răsuceşte de cîteva ori voiniceşte, propteşte genunchiu-n stîncă, trage şi
scoate dopul lăsînd să curgă, zornăind, mii şi zeci de mii de smaragde scînteietoare.
41
Pasiunea cea mare a tuturor zmeilor zmeilor e colecţionarea florilor de mină.
Minunile de cuarţ şi pirită care ajung la noi, la suprafaţă, sînt doar flori moarte,
veştejite. Acolo, sub pămînt, ele se desfac şi respiră ca nişte crini transparenţi, şi-şi
împrăştie grăunţii de aur ai polenului în curenţii de aer. Zmeii le culeg şi le ţin
îngropate în pivniţe pe care nu le mai deschid niciodată. Nu le vede nimeni, dar ei
ştiu că sînt acolo, ca le aparţin, şi se bucură.
Zmeul mioritic e zidar vestit. Cele mai măreţe palate îi aparţin. Le clădeşte
în mijlocul unor codri circulari (de aramă, de argint şi de aur), şi cocoaţă pe ele
turnuleţe, donjoane şi foişoare, fiecare cu girueta sau flamura sa. Foloseşte la
zidărie firul cu băşică de porc, instrument care funcţionează după principiul invers
firului cu plumb, băşica fiind umplută cu un gaz mai uşor decît aerul. De mare aju-
tor îi este şi nivela cu manivelă, în fereastra căreia bula de aer e aşezată unde
trebuie cu ajutorul unui cric. Codrii circulari sînt tunşi zilnic, ca nişte garduri vii,
iar jivinele ce fojgăie prin ei se prezintă seară de seară la apel în careu.
Cîinii de zmeu cresc porci de cîini, cu care se hrănesc. Uneori, în vremuri de
mare foamete, mă-nîncă si pisici, pe care le atrag imitîndu-le cu măiestrie
mieunatul. Cum porcii de cîine cresc singuri, căutînd prin gunoaie, cîinii de zmeu
stau lungiţi de dimineaţa şi pînă seara în grotele lor, pălăvrăgind despre literatură.
Porcii de cîine ascultă la gura grotei, comentînd între ei tema-n dezbatere. Cînd,
nemaiputînd răbda, unul intră să-si spună si el părerea, zmeii tabără pe el şi-l
devorează. Numesc acest lucru „punerea la punct a diletantului".
Zmeii suri de văgăună, orbi ca liliecii, împletesc coşuri si fac perii. Ajutaţi
de tarantule, ei mai vînează insectele cavernicole, străvezii ca sticla, cu care se
hrănesc. Pentru aceasta, folosesc grebla, cu care piaptănă atent crîngurile de licheni
fosforescenţi, în muzee se păstrează minunate cămăşi de zale împletite cu drag de
zmeoaice pentru soţii lor, din fire de sîrmă ghimpată în patru culori.
Meseria de felcer e practicată din vechime de zmeul cu colţi, care scoate
dinţi, lasă sînge, extrage săgeţi, spînzură condamnaţii şi torturează duşmanii cu
mare dexteritate. Sînt atît de vestiţi, încît toate celelalte rase apelează la ei pentru
trebuşoare ca acestea. Se cunosc cazuri cînd războinici de peste şapte lacuri de
mercur şi şapte mări de lavă au venit cu prizonierii legaţi fedeleş ca să fie torturaţi
de zmeii cu colţi. Victimele sînt aşezate la biroul demonic şi li se dau de făcut
socoteli grele, de rezolvat probleme cu lupi, capre şi verze. După două-trei ore de
chin continuu, zmeii spun si laptele supt de la mamă-sa.

42
Muma zmeilor împarte dreptatea. La el vin zmeii care au vreo neînţelegere.
Judecata se desfă-şoară-n felul următor. Muma zmeilor iese din cort purtînd pe
umăr bîta dreptăţii, o imensă măciucă ghintuită, folosită doar în acest scop, iar pe
cap are coiful hotărîrii definitive. Cei doi zmei împricinaţi se aşază la stînga şi la
dreapta sa, asteptînd plini de încredere verdictul. Muma zmeilor azvîrle bîta drept
în sus cu asemenea precizie, încît după trei zile ea cade exact pe vîrful cu două
pante al coifului de fier. Nimic (în afara suflării nevăzute a Zeului) n-o face s-o ia
într-o parte mai curînd decît în cealaltă. Timp de trei zile zmeii umblă după
treburile lor, apoi se reîntorc în formaţia iniţială, bîta cade, alunecă pe una din
pantele coifului si izbeşte pe unul dintre zmei taman în moalele capului. Dreptatea
s-a făcut.
Nu se ştie ce meserie cunoaşte Animicştiu-torul, nici ce unelte foloseşte, cu
excepţia faimosului Toiag cu Urechi. Totuşi, ştim din legende că el ar scrie — sau
ar fi scris — pe coaja ouălor preistorice tot soiul de sfaturi şi proverbe înţelepte.
Prin urmare, trebuie să fi folosit un mijloc de scriere. Pînă una alta, vom
numi ipoteticul instrument faimosul condei.
Zmeul zmeelor confecţionează zmee. Placaj, hîrtie creponată, pap de
tîmplărie, sfoară şi panglici colorate sînt îmbinate cu migală pentru ca pasărea
artificială să-şi poată lua zborul. Sula cu care găureşte placajul e unealta lui
principală. Se zice că unii folosesc şi fîţa în acest scop, dar ei sînt gratulaţi de
meseriaşii cinstiţi cu titlul puţin măgulitor de „fîţari" (cîrpaci). Zmeul zmeelor
trebuie să muncească din greu, zi şi noapte, căci doar douăzeci de zmee îl pot
ridica în aer, si multe sînt stricate de intemperii, de păsări şi de copiii răi.
Zmăul e prea ocupat cu arta războiului ca să mai pună şi mîna la treabă.
Totuşi, între două campanii, meştereşte scrumiere şi vaze ornamentale din
malachită, pe care-ncearcă să le vîndă altor zmei pe un preţ de nimic: cinci scalpuri
de voinic bucata. Rareori primeşte mai mult de trei. în acest meşteşug se ajută cu
proteza, trei dinţi din faţă, din oţel dur, pe care şi-i pune special pentru muncă.
Incălţaţii stăpîneau Moara de pepite, aşa că n-aveau de ce să
muncească.
Numai femelele lor se-n-grămădeau cu sutele pe malul lacurilor de acid sul-
furic ca să prindă borţoşi, un soi de peşti cu tentacule verzi si pîntece sferic.
Foloseau pentru asta canciogul, o plasă cu ochiuri atît de largi, încît peştilor nu le
era teamă să intre, fiindcă ştiau că pot să iasă oricînd.

43
Zmeii asiatici au părăsit de mult ocupaţiile tradiţionale pentru a se lansa pe
piaţa microelectronicii. Letconul e mînuit de ei din cea mai fragedă pruncie.
Aparatul nu e, totuşi, electric. Ciocul său se încinge prin vibraţiile stîmite în
coada lui de o specie de bărzăune tropical. Ca să poată depăşi în fineţe standardele
americane, zmeii asiatici se dau de trei ori peste cap şi devin aşa de mici, că se
plimbă pe firişoarele argintii ale unui circuit imprimat ca pe o şosea cu patru benzi.
ECONOMIE
Industria, astăzi mai curînd artizanală, a fost odinioară înfloritoare. Ramura
cea mai dezvoltată a fost întotdeauna industria minieră. Zmeul scurmă-n pămînt
din instinct si, dacă găseşte o pietricică strălucitoare, o ascunde cu gelozie de
ceilalţi. Pretutindeni în spaţiul subteran se află răspîndite mine de fier, plumb, zinc
si, bineînţeles, cărbune. Pe lîngă acestea, cunoscute si oamenilor, zmeii exploatau
şi zăcăminte speciale, din care extrăgeau pastă de dinţi, ketch-up, lapte demachiant
si zahăr, toate de cea mai bună calitate. Zăcăminte imense de sarmale, intens
exploatate acum două milenii, existau sub Peninsula Balcanică. Mercurul se
găseşte în Imperiul întunecimii din abundenţă. Zmeoaicele aduc zilnic din lac cîte
o vadră plină, cu care spală copiii pe cap ca să nu facă paraziţi. Minereul de fier
ajungea în marile centre economice precum Shiksta, Dowa şi Quatr'a unde existau
fierării care produceau arme, unelte şi potcoave (zmeii nu folosesc calul, dar poartă
la ei cîte-un şirag de potcoave pe care le oferă gratuit voinicilor; potcoavele sînt
aşa de proaste, încît se tocesc după primii douăzeci de paşi ai calului, care-ncepe să
schioapete, dezavantajînd voinicuHn luptă). Existau şi mori de pepite, în păstrarea
încălţaţilor. Industria uşoară prelucra (şi o mai face încă la scară locală) o anumită
specie de licheni fosforescenţi numită-n popor boom-bach (lineus draco). în tulpina
lor curge un fel de sirop negru ca zmoala din care se trag fire. Ţesăturile realizate
din ele în centre de mai mică importanţă ca Shuko sau Bifida sînt apoi colorate
într-un negru si mai intens, si din ele se confecţionează haine la Hrobba, pe malul
lacului Laardsen IV.
Agricultura. Nu se cultivă absolut nimic. Se culeg mandragore, care sînt însă
foarte viclene, iar ţipătul lor poate perfora timpanele groase cît degetul ale zmeilor.
Singurele animale domestice sînt porcii de cîine, consumaţi de cîinii de zmeu, dar
si de alte rase. Porcii de cîine sînt inteligenţi si, între anumite limite, stăpînesc
limbajul articulat, iar între altele, pe cel nearticulat. Nu sînt buni de mîncat decît
cînd „s-au copt" la minte.

44
Vînătoarea se confundă cu războiul, căci scopul celui din urmă e procurarea
de hrană şi de resurse reproductive. Zmeii devorează cu plăcere prizonierii de
război, indiferent de specie, rasă sau grad de rudenie.
Pescuitul e slab dezvoltat, îl practicau în trecut, cum se vede în fresce,
femelele de încălţaţi, care prindeau borţoşi cu canciogul.
Transporturile nu s-au dezvoltat prea tare, întrucît zmeii nu cunoşteau roata
şi călăria. Zmeii sînt destul de sedentari şi, dacă trebuie să trimită ceva dintr-o
cetate-n alta, preferă să azvîrle pachetul. Fac acest lucru cu atît de mare precizie
încît, după cîteva zile de zbor, cufărul se prăbuşeşte drept în creştetul des-
tinatarului. Răcnetul acestuia serveşte de confirmare a primirii. Mesaje mai uşoare
sînt transportate de zmeii zmeelor, prin văzduh. Ei nu le înmînează niciodată, ci le
lasă să cadă de sus, căci zmeii zmeelor sînt consideraţi o mare delicatesă printre
ceilalţi zmei. Comerţul folosea ca monedă de schimb scalpul, adică podoaba
capilară a voinicilor ucişi. Valuta forte era scalpelul, coama de aur a Fetilor-
Frumoşi. Curînd moneda a devenit atît de rară pe piaţă, încît în viaţa de zi cu zi
zmeii au început să folosească peruca. O vorbă dispreţuitoare a lor spune: „Nu face
nici cît două peruci." O formă specială a comerţului devenise acum cîteva secole
negoţul cu prinţese vii. Acestea nu mai erau folosite atît pentru reproducere, cît
pentru troc între cetăţi. E interesant de ştiut că, pentru o prinţesă vie în stare bună,
primeai cincizeci de porci de cîine sau un buzdugan de tipul „Matrak" sau
paisprezece zmei ai zmeelor dolofani sau, în sfîrşit, circa trei sute de Prăpădiţi de
suprafaţă (fiinţe omeneşti de rînd). Prinţesele moarte — mumificate, afumate,
împăiate sau îngheţate — aveau un preţ mai mic.
CIVILIZAŢIE
Zmeii sînt animale sociabile şi inteligente, mai mult sau mai puţin. Viaţa lor
de zi cu zi cuprinde numeroase reguli de comportare, ritualuri şi ceremonii,
încălcate însă atît de des încît e greu de distins între regulă şi excepţii.
Principala şi cea mai veche instituţie a zmeilor este familia. Ea nu e răspîndită si
structurată la fel la toate rasele. După cum se ştie, cîinii de zmeu au renunţat de
mult la reproducerea sexuată. Totuşi, n-au renunţat şi la familie. Literaţi din tată-n
mugure — ca să zicem aşa —, cîinii de zmeu se grupează după^â-milii de spirite,
entitate ce cuprinde, în general, membrii unui salon sau cenaclu împreună cu porcii
de cîine subiacenţi, numiţi în acest context Kara-kooda (cei-care-nu-înţeleg-nimic).
Zmeul mioritic şi zmăul au familii matriarhale, de unde popularitatea între ei
a doctrinei masculiste, care reclamă dreptul zmeilor să stea şi ei acasă, la cratiţă.
45
Muma zmeilor şi zmeul zmeilor ucid femelele la naştere şi formează familii doar
cu domnite umane şi Cosînzene, bine hrănite şi mult iubite, dar al căror orizont e
mult limitat de gratii. Zmeul zmeelor preferă, în general, să ducă o viată
singuratică. Doar în sezonul reproductiv el se asociază cu alţi cîtiva masculi ca să
poată răpi si duce prin văzduh o domnită. Pentru cîteva săptămîni,în jurul colibei
acesteia are loc o intensă viaţă socială. Apoi, domniţa e lăsată în plata Domnului (=
tariful pe care unele prinţese îl percep în aceste împrejurări). Animicstiutorul
formează o familie cu Sine însuşi, muşcîndu-si din coadă ca şarpele Ouroboros.
Cea mai mare armonie între masculi si femele s-ar fi întîlnit in societatea
încălţaţilor, dar e poate numai o legendă. Zmeul cu colţi şi zombalul, specii
asiatice, au dezvoltat haremuri. Fiecărui zombal îi corespund, astfel, 2,14 femele.
Zmeoaicele colţate sînt meştere în arta războiului familial. Soţii lor au
adesea ultimul cuvînt de spus, dar acesta e, invariabil, „Bine, dragă!" în fine, cazul
cel mai întunecat este cel al zmeului de văgăună, în grotele căruia plictisul familial
atinge cote fără precedent. Tinerii însurăţei sînt deja sătui pînă peste cap unul de
altul. După un an de la căsătorie ajung să se urască pînă şi tarantulele de pe umerii
lor. După doi ani, încearcă să se otrăvească reciproc. După trei ani prind să-si
spună glume răsuflate şi să joace tabinet la nesfîrşit, doar-doar unul va ceda.
Totuşi, căsniciile lor sînt foarte rezistente, iar moartea, la sfîrşitul unor ani lungi,
devine o mare uşurare. Zmeul sur de văgăună e dat mereu exemplu de fidelitate în
dragoste.
Pe lîngă familie, zmeii au dezvoltat instituţii politice, juridice şi
administrative în momentul în care au simţit nevoia unui duşman comun care să-i
ţină uniţi. Statul, numit de toate rasele Lew-Yathan, are întotdeauna în frunte, ales
de întreaga obşte, pe cel mai ticălos, mai corupt şi mai viclean cetăţean. Teoria
spune că, focalizînd ura tuturor, ca o lentilă, suveranul poate produce o rază
nimicitoare în confruntarea cu inamicul. Cînd cetatea e asediată, el e urcat pe
metereze şi se aşteaptă ca raza să-i ţîşnească dintre sprihcene. Dacă acest lucru nu
se-ntîmplă, e îndată căutat vinovatul: cel care-l iubeşte-n taină sau îl aprobă pe
tiran. Mulţimea îl sfîşie în bucăţi. Regele, numit Boss, e ajutat la guvernare de
miniştri. Fiecare zmeu trecut de majorat e numit ministru. Femelele nu pot fi
ministru, pentru ele existând numai funcţia de mi-nistră, moştenită din mamă-n
fiică. Copiii ajung încă de la naştere la demnitatea de ministrel (dialectal: me-
nestrel). Cum în adunări (doome) sînt atît de mulţi miniştri încît nu se poate lua
nici o hotărîre, Boss-ul, scîrbit, abdică şi îi urmează la tron altcineva. Aproape că
46
nu există zmeu care să nu fi ajuns, în cursul vieţii sale, suveran al neamului din
care face parte.
Zmeii cunosc şi instituţii de sănătate, care sînt de două feluri: spitale unde se
vindecă rănile si bolnite (am tradus astfel cuvîntul wah-liah, fără corespondent
precis în limbile umane), în care fiecare zmeu, contra unei mici sume, poate căpăta
o frumoasă boală de piele, un cucui, o cicatrice, un neg, o tumoare sau orice altă
malformaţie ornamentală. Personalul medical e format exclusiv din zmeii cu colţi.
Aceştia sînt vestiţi pentru rapiditatea cu care rezolvă definitiv fiecare caz pe care
nu-l pot vindeca.
Invăţămîntul este general, obligatoriu şi gratuit. Doar că, zmeii născîndu-se
cu toate cunoştinţele necesare, la şcoală se duc numai cei bătrîni, care-au uitat
aproape tot. îi vezi, cocîrjaţi, cu ghiozdanele-n spinare, îmbrîncindu-se şi ţipînd pe
străzi. Adesea sînt urecheaţi de propriii lor copii şi nepoţi sau puşi să spună cîte o
poezie, în cărţile de şcoală sînt povestite faptele eroice ale zmeilor care, de cîte ori
aveau ocazia, îi vîrau pe Feţii-Frumoşi pîn-la gît în pămînt şi le tăiau capul,
învăţămîntul începe cu universitatea, continuă cu colegiul şi şcoala medie,
încununarea studiilor o constituie grădiniţa, dar puţini sînt zmeii care se pot lăuda
că au ajuns atît de savanţi. Presedintele Academiei trebuie să facă dovada că a
absolvit şase luni de creşă. Cele mai importante grădiniţe sînt cele din Trikkta si
Săpata.
Religia.
Zmeii cred, în general, într-o fiinţă supremă, făuritoare a Ţurţurilor şi a
Glodului. Aceasta ar fi creat şi primii zmei, însufleţindu-i cu focul transparent scos
pe nări si dăruindu-le din ura inimii sale. Diversele lui nume:
Ananakaourakismakistekou, Shhh, Ollâyluâaeî, Manitou, Bobo,
Yoknapatawpha, Soolah, «ifcAliAJtijr,,*, xnop«vpemm e™^1/8-^%o£2/3oo+, sau
înseamnă toate acelaşi lucru: vidul din interiorul vidului din interiorul vidului.
Acest zeu nu are cult si altare, pentru că se crede că întreaga lume e altarul său. în
schimb, zei mai mici, locali, sînt foarte veneraţi, în primul rînd, fiecare zmeu îşi
divinizează buzduganul. Acesta e aşezat seara în cui, pe peretele de la Apus, iar
zmeul, cuprins de frenezie, îl contemplă, îi ascultă vibraţia (dîndu-i un uşor
bobîrnac), îl pipăie, îl miroase si-n cele din urmă îl linge pe toată suprafaţa,
venerîndu-l şi ungîndu-l contra ruginei în acelaşi timp. Ceilalţi zei sînt, se crede,
vechi conducători politici si religioşi, cu o existenţă legendară, ca Dragg-Onn,
Matrak, Kumnene sau Amm — Go-n'na — Dayya. Lor li s-au ridicat, în vremurile
47
istorice, temple, catedrale, bazilici, capele, domuri, campa-nele, capişte, sinagogi,
moschee, geamii, case de rugăciune si colibe ale bărbaţilor. Nici o statuie nu or-
nează aceste construcţii, azi ruinate, de vreme ce n-a putut fi prins nici un zeu care
să fie ucis şi transformat în propriul său basorelief. Există doar numeroase
inscripţii votive urrnînd, cu mici variaţiuni, următorul model: „Zeule! Dacă în
interval de ... zile nu-mi dăruieşti obiectul x, voi chema tot neamul meu să stea
de jur-împrejurul templului pe care ţi l-am ridicat, ca să sufle foc pe nări şi casa ta
sfîntă să ardă cu mari vîlvătăi. Şi dacă nici atunci nu-mi dăruieşti obiectul x, vom
face o scară pînă la Ţurţuri, vom ajunge sus, vom găuri bolta şi vom pune gheara
pe tine. Apoi te vom..." Urmau aici descrieri de torturi inimaginabile pentru mintea
umană, întinse nu de puţine ori pe un perete întreg, căci nu trebuia omis nici un
organ al veneratului zeu. Mai existau şi zeităţi micuţe, portabile, ca Nu, Ddda şi
Hmm, cu funcţia de purtătoare de noroc. Paradoxal, acestor zmei-colibri li se
aduceau cele mai sîngeroase jertfe. Cînd au ieşit la suprafaţă, zmeii au suferit
influenţa religiilor locale, astfel că în panteonul lor au fost primiţi, cu timpul,
Shiva, Behemoth, Ishtar şi Satan, reprezentaţi cu solzi în spinare şi cozi lungi,
reptiline.
LIMBĂ
Aparatul vocal al zmeilor (cu excepţia zombalului si, fireşte, a
Animicştiutorului, despre care se crede că nu posedă aşa ceva) e compus dintr-o
limbă groasă, musculoasă şi despicată, a cărei lungime poate varia de la 1,23 m la
femelele zmeului comun pînă la 0,006 m la masculul zmăului, un bot plin de colţi
fiorosi şi un laringe de o formă extrem de neregulată, în aceste condiţii, nimeni nu
trebuie să se aştepte la cine ştie ce limbaj.
Se crede că zmeii gîndesc destul de mult, dar că n-au cum dovedi acest lucru
din cauza dificultăţilor de exprimare. Cu cît o idee e mai abstractă, cu atît cuvintele
care-o exprimă sînt mai greu de pronunţat. Atunci intră în joc limbajul corpului.
Cînd vezi un zmeu agitîndu-se si smucindu-se ca lovit de streche, schimonosindu-
se ca un epileptic, smulgîndu-şi hainele şi părul din cap, vei şti că ai în faţa ta un
filozof vorbind despre bucuria de a avea o inimă netulburată.
Există două mari grupuri lingvistice zmeieşti, însoţite de o puzderie de
dialecte si graiuri. Primul, răspîndit în zona europeană — specific deci zmeului
zmeilor, zmeului mioritic, cîinelui de zmeu si zmăului —, e alcătuit din limbi
insinuante. Al doilea, întîlnit sub Asia (zmeul zmeelor, zmeul cu colţi, mumă
zmeilor, zmeul sur de văgăună si zmeul comun), reprezintă limbile aglutinante.
48
Limbi insinuante
Zmeii se tem de zei si n-ar spune un neadevăr în ruptul capului. Refuză să
spună, însă, şi adevărul gol-goluţ, căci experienţa speciei a arătat că cei care-au
făcut astfel n-au supravieţuit. Ieşirea din acest impas le-a oferit-o anatomia
specifică a aparatului lor vocal. Limba avînd vîrful despicat, s-a ivit posibilitatea ca
un vîrf să pronunţe răspicat o frază, pe cînd celălalt, în general mai scurt dar mai
flexibil, să articuleze repede altceva, de multe ori opusul primei fraze. Lingviştii au
analizat, astfel, structuri dialogale de tipul următor:
FĂT-FRUMOS: Bun-găsit, cîine de zmeu!
ZMEUL (cu primul vîrf): Hallom-Hallahham Googa! (Bine-ai sosit, voinice!)
(cu al doilea vîrf): Zvghrxtsutdlrmrrrrr! (Expresie intraductibilă făcînd aluzie la
posibilitatea ca voinicul să se-ntoarcă în locul de unde-a ieşit.)
FĂT-FRUMOS: Hai la luptă!
ZMEUL (primul vîrf): Bandagulaago Ini-kata Ini-ka-ta Suntamarenasumpati
Atarvavedaguantanamera Ghh-ghh! (Hai!)
(al doilea vîrf): Zvghrxtsutdlrmrrrrr!
FĂT-FRUMOS: în săbii să ne tăiem, sau în luptă să ne luptăm?
ZMEUL (primul vîrf): Hoola-hoop! (în luptă, că-i mai dreaptă!)
(al doilea vîrf): Dooten Zbengh'â... (Aş prefera buzduganul, dar, ce să-i faci, viaţa
nu aranjează întotdeauna lucrurile aşa cum vrem noi...)
Limbi aglutinante
Cleioase, însoţind articularea cu stropi mari de salivă, aceste limbi au o
deosebită expresivitate, creînd uneori frumuseţi si preţuri noi din materiale descon-
siderate pe nedrept ca bubele, putregaiul şi noroiul. Atît prinţesele răpite, cît şi
voinicii au dificultăţi în conversaţia cu zmeii asiatici, fiind nevoiţi să folosească
scuturi de cristal între ei şi interlocutor. Stropii de salivă sînt folosiţi în aceste limbi
ca semne diacritice şi de punctuaţie. Astfel, un cuvînt ca Jomaamoj, pronunţat ca
atare, înseamnă boboc de raţă, dar însoţit de doi stropi pe fruntea celui cu care
vorbeşti şi încă unul în ochiul stîng ajunge să semnifice un anumit fel de scut din
sorici de porc de cîine. Obligaţia ca, în relaţiile internaţionale, aceşti zmei să
folosească Zwi, limbaj telegrafic şi fără diacritice, a stîrnit numeroase revolte si
manifestări de protest. „Este un intolerabil atentat la valorile noastre cele mai
intime, spunea un oficial. Prin limba strămoşească noi nu înţelegem să exprimăm
abstracţiuni insipide, ci însăşi substanţa şi savoarea modului nostru de viaţă." Nici

49
pînă astăzi, însă, zmeii care folosesc limbile aglutinante nu au găsit înţelegere din
partea altor popoare.
Un caz special de competenţă lingvistică îl reprezintă cel al zmeilor asiatici
(zombalii). Caninii lor enormi, sfredeliţi si străbătuţi de inele cu mărgăritar,
rezonează puternic la clinchetele delicatelor bijuterii. Aceste clinchete, uneori
uşoare ca o adiere, alteori puternice ca nişte clopote de catedrală, armonioase
uneori ca un vis de iubire, distonante altă dată ca o găleată rostogolită pe trepte de
beton, formează limbajul, foarte convingător, al zombalilor. în trecut, ei erau
oratorii lumii subpămîntene. în ciuda faptului că nu-nţelegeau o boabă din graiul
lor, zmeii veneau din cele mai îndepărtate colţuri şi plăteau scalpuri grele ca să-i
asculte. Plecau întotdeauna pe deplin lămuriţi, mai curaţi si mai uscaţi ca oricînd.
Animicştiutorul nu pare să fi avut limbaj vorbit. Scrisul său, însă, are o structură
gramaticală cu totul specială. Nu există, aici, cunoscutele noastre părţi de vorbire:
substantivul, pronumele, verbul etc. Avem însă altele, care descriu lumea în culori
mai puternice si mai vii: zîmbirea, pălmuirea, holbarea, lăcri-marea, părul măciucă,
geamătul (de durere şi de plăcere), mîngîierea... Majoritatea traducătorilor ce s-au
aplecat asupra fragmentelor rămase pe coji de ou se plimbă azi, holbîndu-se şi
lăcrimînd, prin curtea caselor de sănătate.
ŞTIINŢE
Autoritatea supremă în domeniul ştiinţific este, pentru zmei,
Animicstiutorul, autor presupus al unui op numit „Sistema Lumii". Aici este
înfăţişat Universul ca un fel de farfurioară ce se roteşte rapid, ţinută în echilibru pe
vîrful degetului Fiinţei supreme. Cînd i se face foame, zeul mai ciuguleşte cîte ceva
din farfurie, si aceasta este moartea. Dacă-i rămîne ceva printre măsele, se scobeşte
si asază rămăşiţele pe marginea farfuriei, în felul acesta vin pe lume animalele şi
zmeii.
Fizica zmeiască ne învaţă că spaţiul are doar două dimensiuni. A treia, deşi o
văd prea bine, o neagă cu încăpătînare. în toată ştiinţa fizicii, de altfel desfăşurată
pe sute de pagini, nu întîlneşti decît o singură formulă: E = mc2. Ea e interpretată în
fel şi chip, cea mai acceptată soluţie fiind cea a lui Zoozoom, din sec. al IlI-lea:
Eficienţa este Magia Capetelor Pătrate. Zmeii cred şi în existenţa atomilor: brînza e
compusă din atomi de briază, buzduganul din atomi de buzdugan, zîmbetul din
atomi de zîmbet.
Chimia lor nu combină numai substanţe între ele, ci şi stări sufleteşti,
fenomene ale naturii, acţiuni sau pasiuni. Aurul modelat într-o stare de spirit tristă
50
e alt metal decît cel prelucrat la o petrecere. Cetăţile se construiesc pe ploaie, ca să
înnegureze sufletul inamicului.
Nu sînt cunoscute matematica şi statistica. Numerele sînt considerate
superstiţii. Nici un zmeu nu ştie cîte degete are. De ce ar şti? în schimb, biologia a
luat o mare dezvoltare, ştiut fiind că preparatele disecate, presărate apoi cu sare şi
piper, îi recompensau pe zmei după fiecare plicticoasă lecţie de anatomie. ARTE
SI LITERATURĂ
Artele plastice au rămas într-un stadiu oarecum primitiv în culturile zmeilor.
Există, desigur, în pieţele oraşelor statui de eroi, înălţate în vîr-ful unor măreţe
columne. Dacă urci însă pînă la ele, ai surpriza să afli nu o întruchipare în
marmură, ci pe erou însuşi, împăiat si cu ochi de sticlă. Basoreliefurile celebrînd
mari izbînzi cuprind sute de personaje ucise şi acoperite cu var: aceiaşi soldaţi care
au biruit în luptă. Tablourile de interior înfăţisînd, de pildă, doi tineri împletindu-şi
limbile despicate într-o poetică panglicuţă (forma lor de sărut) şi intitulate „Iubire"
sînt realizate după aceeaşi metodă. Atelierele pictorilor şi sculptorilor la modă sînt
numite metaforic „abatoare" şi sînt frecventate de lumea mondenă. Mulţi din cei ce
intră pe propriile picioare ies de acolo sub formă de portrete. Autoportretul e o
specie cu totul necunoscută.
Măreţele cetăţi din lanţul celor şapte bijuterii nu sînt rodul arhitecţilor, ci al
întîmplării. Steiuri gigantice de stîncă au fost înfipte din loc în loc şi, unde s-a
întîmplat să fie două alături, zmeii au fost tentaţi să mai adauge, ca să fie grămada
mai mare şi mai vizibilă. S-au format astfel cercuri de menhire, iar în interior şi-au
clădit zmeii case, mai întîi tot din rocă necioplită, apoi din pietre legate cu mortar.
Zidaria e o achiziţie recentă, împrumutată de la oameni. Astfel, sînt faimoase
curţile zmeilor mioritici, cu zidurile lor ornate cu cristale şi pirită, cu melancolicele
foişoare din care prinţesele lasă să atîrne în valuri părul lor de aur moale, cu cocoşi
de tablă şi flamuri de mătasă pe ţuguiele din vîrfuri. Interioarele acestor construcţii
sînt atît de labirintice, încît uneori poţi găsi pe culoar mătăhălosul schelet al vre-
unui zmeu care n-a mai ştiut să ajungă la bucătărie. La subsol, toate palatele aveau
temniţe sinistre, mer-gînd pe cel puţin cinci etaje în subteran. Altădată acolo se
petreceau orori, în epoca istorică, însă, celulele umede si întunecoase au servit
zmeilor ca dormitoare, partea de la suprafaţă fiind, de fapt, rezervată oaspeţilor.
„Să dormi ca pe masa de tortură" e, pentru zmei, echivalentul lui „Somn uşor, vise
plăcute".

51
Muzica şi coregrafia. Cînd zmeul cîntă, nu-i a bună. Cînd dansează, e
nenorocire. Fiecare cetate are un loc bine delimitat pentru astfel de activităţi, aşa-
numitul loc sacru Thisko — Tekk (în traducere liberă: casa plăcerii). Cîntarea o
încep de obicei zmeoaicele, agitînd un fel de tamburine din piele umană şi clopoţei
de aramă. Agită, de asemenea, aprig din fesele lor de tiranosaur, care cu această
ocazie se-nroşesc ca petalele de mac. Cuvintele tradiţionale sună aşa:
Fete bune sîntem, zmeoaice de zmeoaice, Sucim din buric ca nişte şerpoaice,
Vino să ne iei, vino imediat Dacă ai parai şi dacă eşti bazat Tine minte frate că ai
doar o viaţă Dă-l în gît pe fraier, ieşi la suprafaţă Şi-o să ai succes, bani babani si
BMW-eu Şi-o să vin lîngă tine, şi-o să fii zmeul
meeeeeeeeeeeeeu!
Vino dacă vreeeeeei, vino să ne ieeeeeeei etc. etc.
Pe această muzică suavă, numită în general stilul „casă", dar si
„ciocănitură", zmeii se pornesc să joace cu figuri, încît dîrdîie podelele sub ei.
Serile de dans se termină cu dărîmări masive ale clădirilor pe o rază de cîteva sute
de metri. Zmeul sur de văgăună mai dansează si tarantela cînd este ciupit din
greşeală de unul dintre păroşii săi locotenenţi. Zmeul mioritic are si el dansuri
specifice ca sîrba şi bătuta, dar se abţine să le joace ca să nu se bată prea des
munţii-n capete. Dansul încremenit al Animicştiutorului, se zice, este chiar lumea
în care trăim.
Dintre toate artele, zmeii adoră însă literatura, încă de mici ei îi adorm pe
părinţi şi bunici spunîn-du-le nenumărate basme, legende şi cîntece tinereşti
(echivalentul baladelor populare) cu care vin pe lume gata ştiute. Le uită însă pe
parcurs, astfel că adultul obişnuit e avid să le asculte mereu şi mereu. Nu toţi nou-
născuţii au această înzestrare în aceeaşi măsură. Faimoşi sînt pruncii zmeului
comun, care spun poveşti într-un fel de largi amfiteatre, unde se intră cu plată: de
obicei, zece centimetri pătraţi de scalp de persoană. Folclorul zmeiesc vorbeşte
despre o epocă nedeterminată în care super-eroi, ajutaţi de cel mai bun prieten al
zmeului, balaurul, merg să lupte contra unor monştri oribili numiţi Ros împărat,
Verde-îm-părat, Făt-Frumos sau Presley (în Carpaţi, Prîslea) cel Voinic, şi să
elibereze astfel femelele umane sechestrate şi neîmplinite.
Adevărata literatură este însă cea cultă, care cuprinde cîteva genuri înalt
formalizate. Ea nu este înnăscută, în schimb e produsă de zmei atipici, cu o
aplecare naturală spre poezie, numiţi, în toate limbile, puah (tradus de obicei prin
poeţi, cuvîntul înseamnă literal amărîţi care împung stelele cu bărbia). Niciodată nu
52
s-a ivit pe lume un puah din încrucişarea speciei zmeeşti cu cea umană. Doar cînd
un zmeu, vrăjind o zrneoaică, uită să pronunţe formula rituală de îndepărtare a
răului „Ni ni puah puah!" („Fie ca din dragostea noastră preacurată să nu se nască
un nenorocit de poet"), se poate petrece ceea ce în familie va fi o mare catastrofă.
Zmeoaicele si zmeii poeţi nu ştiu să lupte si, chiar dac-ar şti, n-ar putea
ridica grelele buzdugane, în schimb, de mici îşi umplu odăiţele cu murdării: perle,
cărticele, panglici şi globuri de Anul Nou. Organul cristalomandibular, atrofiat la
confraţii lor, le creste hidos la adolescenţă. Puah-ii se strîng în grupuleţe numite
Kellt-uri şi ies la suprafaţă în nopţile fără lună. Privind hipnotizaţi, într-o poiană
tăcută, spuza de stele scînteind ca o comoară a unor piraţi celeşti, cruciuliţele şi
lănţugele şi ghiulurile şi cerceii stelari, ei desfac floricica de pieliţe diafane din
vîrful bărbiei si-ncep să miroasă. Ei singuri cunosc mirosul stelelor. După spusele
lor, nu e nici una cu aceeaşi mireasmă ca vecina ei. Orion miroase vag a regina-
nopţii, Săgetătorul aduce cu apa de colonie, în schimb Cloşca ar avea buchetul
vinului tare de Madera. A hoit împuţit miroase Mar-te, spintecătorul. A subţioară de
curtezană, Venus. Poeţii detectează şi cristalele din alte galaxii, oricît de
îndepărtate, mai curat decît orice spectroscop. Stînd nopţi în şir cu feţele către
stele, ei cîntă. Poemele, epice si lirice, sînt creaţia lor, transmisă cu veneraţie din
neam în neam de puahi. Sînt cunoscute, pînă-n prezent, trei tipuri de cîntece epice:
Vissele, Zurbele şi Hrankahrankas. Primele au fost compuse, din timpuri străvechi,
de poeţii ieşiţi din neamul dinilor de zmeu, si se caracterizează printr-o înaltă ţinută
academică. Ele sînt, de fapt, un fel de cronici în versuri, lăudate mai ales pentru
veridicitatea lor istorică, mai puţin pentru realizarea artistică. Cîinii de zmeu, de
altfel, sînt cei mai mari amatori de literatură dintre zmei, dar şi cei mai
conservatori. Arta lor n-a evoluat de mai bine de cinci mii de ani. Critici literari
înnăscuţi, ei discută nopţi întregi, cu voluptate, despre splendoarea vreunui epitet
clasic, ca şi despre ridicolul „moderniştilor", autori de zurbe. Acestea din urmă sînt
foarte diferite de visse. Pe jumătate fantastice, ele nu dau doi bani pe realitate, în
care nu cred deloc. „Sîntem doar visul unui zmeu suprem" e formula lor cea mai
cunoscută. Zurbele (între care capodopere ca „Zurba Ulciorului de fildeş", „Zurba
Femeii care nu a fost vrăjită niciodată" sau „Zurba Platoşei de rinocer") sînt creaţia
colectivă a poeţilor din neamul zmeului cu colţi, şi au o exuberanţă barocă în
desfăşurarea acţiunilor şi în emfaza discursurilor. Aici sînt mult lăudate întorsă-
turile stilistice neaşteptate, uneori de-a dreptul paradoxale. Personaje mor şi învie
pe pagina următoare, o cetate e cucerită de dragul unui epitet, un sclav o violează
53
pe regină pentru ca poetul să-i poată descrie acesteia mărimea ugerelor. Totuşi,
printre multe ficţiuni, răzbat în zurbe şi date istorice neaşteptat de precise, în fine,
hrankahrankas sînt un fel de bîrfă rimată, răuvoitoare, îndreptată împotriva altei
rase zmeieşti. Toate rasele care compun literatură (căci, de pildă, zmeul sur de
văgăună n-o face niciodată) au hrankahrankas despre toţi ceilalţi zmei, în care-i
batjocoresc, ridicîndu-se pe ei înşişi în slăvi. Nimic nu e iertat: forma urechilor,
gusturile sexuale şi alimentare, vorbirea stîlcită, gafele politice. Există şi
hrankahrankas despre amărîţii de suprafaţă (oamenii), dar, în general, zmeii nu
consideră că e moral să-ţi baţi joc de nişte pocitanii.
Pe lîngă literatura epică si eroică, zmeii au cultivat din vremuri imemoriale
si o avîntată poezie lirică. Ea nu constă atît din cuvinte cît din atitudini corporale şi
acţiuni foarte formalizate, aşa încît n-a fost cu adevărat pusă pe hîrtie niciodată.
Dar au rămas treze în amintire performanţele unor faimoşi barzi ai Antichităţii
precum Mmm-Acho, Violon si femela Khuffa. Aceasta din urmă, de exemplu, pe
cînd se afla în regatul Noo-kook, s-a îndrăgostit, se pare, de un voinic din stirpea
umană, lucru nemaiîntîlnit pînă atunci. Performanţa sa lirică a constat din urmă-
toarele:
1.Khuffa a ieşit din cetatea natală şi, împodobită cu vîsc, a înaintat spre
coliba lui Kun Wasabanga, alesul inimii ei.
2.A dat ocol colibei de două sute şase ori, dan-sînd şi tînguindu-se languros.
3.Si-a îndreptat cele trei corniţe de pe craniu către cele trei puncte cardinale
(se ştie că zmeii nu recunosc sudul).
4.A căscat fălcile cu colţi înspăimîntători către norii de vară.
5.A slobozit un strigăt din rărunchi: „Kuuuuuu-uuuuuuuuunnnnnnnnnnnha!"
6.Si-a colorat, concentrîndu-se, fiecare solz din creastă în altă culoare.
7.A prăjit la focul nărilor ei pe cele opt neveste şi cei nouăsprezece copii ai
lui Kun Wasabanga.
8.A ordonat prin telepatie peştişorilor exotici din fiecare solz să aplaude.
9.A căscat iar fălcile îndurerate şi-a glăsuit: „Kala-kalahalakalakunnah!
Hrrrrrrrrrrrrrrrrr!" (aproximativ: „Iubitule, arată-te la fereastră pentru ca ochii mei
să se bucure!")
10.A aşteptat vreme de şapte ierni ieşirea iubitului.
11.A scîncit aproape inaudibil.
12.A intrat în colibă.

54
13.A ieşit din colibă cu oasele lui Kun Wasabanga la gît, ca o salbă
zuruitoare.
14.Le-a aruncat, visătoare, în cele trei zări.
Cum se vede, avem aici exemplul unui sonet perfect.
Ultima specie literară, cultivată în exclusivitate de Animicştiutor, este
aforismul. Dintre cele peste jumătate de milion de aforisme atribuite Animicstiu-
torului, aproximativ patru sute nouăzeci şi opt de mii s-au dovedit apocrife, alte o
mie opt sute treizeci şi două fiind dubioase. Ele au fost scrise pe coji de ouă
preistorice si formează patrimoniul de înţelepciune al speciei zmeieşti. Multe
aforisme au devenit proverbe si zicale populare, rostite în toate împrejurările vieţii.
Partea a Il-a
Poveştile
POVESTEA LUI LOBO ŞI A LUI FOFO,
FECIORII ZMEULUI ZMEELOR
Demult, tare demult, pe cînd păianjenii transparenţi lucrau în mină si
zuuuzele cerneau făină, trăiau, la o margine a ţinutului Hooshi, doi fraţi din stirpea
zmeilor zmeelor, pe nume Lobo şi Fofo. Erau săraci, dar cinstiţi. Tăicuţul lor
tocmai îşi dăduse ultima suflare, încă destul de învăpăiată ca să le pîrlească genele
fiilor, lăsîndu-le cu limbă de moarte mica lui avere: o frumoasă domniţă, capturată
încă de pe vremea tinereţii lui si ţinută într-o încăpere numită Camera Ascunsă.
Tinerii trecuseră adesea prin faţa acelei odăi, nebănuind ce se află înăuntru, învă-
ţaseră să citească buchisind textul prins în piuneze pe uşă şi care, în limbajul
laconic al acelor vremi, zicea:
Blestemat, da, de mii de ori blestemat,în carnea si-n spiritul lui,în limba si-n
creasta lui,în fiecare solz de pe spinaresi-n fiecare gheară de la picioare,în fiecare
braţ si-n fiecare maţ,în gingii, în nări si-n ţurloaie,în bojoci şi în coaste,în
suprarenală, în glanda pineală,în sistemul limfatic,în simpatic si-n parasimpatic;
blestemat cînd intră si dna iese,and f ace zmee, dna ţese,cînd doarme si cînd e
treaz,cînd mănîncă mandragore, fluturi si praz,cînd zboară peste fineţe,cînd face
feţe-feţe;si iar blestemat în lung si în lat, înfaţăşi-n spate,în genunchi si în
coate,blestemat de zei,jupuit de piei,blestemat de tot,colţii smulşi din bot si să-i
sară ochiicui va intra în această Cameră Ascunsă în care de altfel nu se află nici o
domniţă.

55
Tinerilor le păruse întotdeauna rău că acolo nu se afla nici o domniţă, si nu
se osteniseră să deschidă vreodată uşa, deşi li se năzărise uneori că aud de dincolo
de ea un glas dulce drăcuind părul prea încurcat la pieptănare.
E doar vîntul, frate, doar vîntul, spunea visător arunci Lobo, iar Fofo,
scobindu-se-n organul voini-coreceptor, repeta melancolic:
— Da, frate, din păcate e doar vîntul...
Şi iată că tăicutul lor, murind, le dezvăluise un mare mister: în acea cameră se afla
totuşi, din vremuri vechi, o domniţă! Le descoperise si numele ei: Grunhilda.
— Grunhilda! oftară fiii în acelaşi timp, provocînd bătrînului lor tată arsuri de
gradul IV pe obraz. Niciodată un nume nu li se păruse mai graţios.
— Mai am acum o singură dorinţă, feţii mei, şopti tatăl cu voce slabă. Aduceţi-mi
floarea de mină din cufărasul de sub pat.
Tinerii i-o aduseră, moşul o luă-n palme şi o privi: era o minune de hrisolit şi
beriliu, cu piramide din cel mai limpede cristal de rocă desfăcute ca nişte suave
petale.
— Lobo, tu, întîiul meu născut, lumina ochilor mei, să-ţi las ţie acest odor fără
preţ, pe care am plătit în tinereţe şaptezeci de scalpuri si trei scalpele? îţi place,
Lobo, fătul meu?
— Da, tată!
— Dar ţi-aduci aminte cum mi-ai şterpelit acum cîţiva ani ghemul de sfoară
purpurie din buzunarul de la platoşă? înapoi, scîrnăvie! Acum vino tu, Fofo, prîslea
al meu în care-mi găsesc bucuria! Vrei tu acest mineral ce te-ar putea face rege?
— Da, tată!
— Uşor de zis da, fiule. Dar cînd mi-ai tăiat o bucată din cel mai frumos zmeu ca
să-ţi faci solniţe de hîrtie nu-ţi mai aduci aminte, nu? Ce-ţi pasă că m-am prăbuşit
apoi din slava cerului? Lepădăturilor! Nu veţi avea floarea mea!
Şi bătrînul f ornai asupra ei un damf ce o veşteji. Apoi închise liniştit ochii. O mare
seninătate i se citea pe chip.
In clipa următoare, cei doi zmei se repeziră pe lungile culoare ale casei
părinteşti încercînd s-ajungă cît mai repede la Camera Ascunsă. O luară pe drumuri
diferite. Fofo greşi direcţia la o cotitură, ajunse într-o odaie necunoscută cu şapte
uşi, deschise una la întîmplare, nimeri pe un coridor, deschise încă o uşă, se trezi
într-o curte interioară, o străbătu, dădu în altă curte cu arteziană, apoi în alta cu
yucca, ieşi în cele din urmă într-un ţinut străin, merse pînă la prima cetate, intră
servitor la bucătăria regelui, după un an ajunse degustător al bucatelor acestuia,
56
apoi paharnic, pitar, serdar, chelar, vornic, logofăt, spătar si-n cele din urmă, dînd o
lovitură de palat, deveni rege si-si pregăti o oaste uriaşă, cu care invada cetăţile din
apropiere, le supuse sau le arse pe rînd, se proclamă împărat şi, la adînci bătrîneţi,
se-ndrep-tă cu toată oastea lui către casa părintească demult părăsită ca să o
strîngă, în fine, în braţele sale pe Grunhilda, după care tînjise în tot acest timp.
Lobo, în schimb, se trezi destul de repede în faţa uşii împodobite cu fiorosul
blestem. „Bătrîn mincinos!", spuse cu dispreţ si smulse foaia din piuneze. Bătu
sfios la uşă.
— Cine e? răspunse un glăscior dulce.
— Eu... îngînă Lobo cu voce tremurătoare.
— Care eu?
— Lobo, fiul tatălui meu din stirpea zmeilor zmeelor.
— Stai acolo, sînt dezbrăcată! Arată doar fîţa!
Lobo crăpă uşa şi strecură prin deschizătură micuţul lui buzdugan din lemn
parfumat, pe care-l împodobise cu pirogravuri măiestre.
— Bun, zise Grunhilda, ai grăit adevărul. Acum, dacă voieşti să fiu a ta, du-te tu,
viteazule Lobo, în împărăţia Bang-kook, în ţinutul zmeilor cu colţi, şi adu-mi
nestemata pe care împăratul o păstrează sub limba cosînzenei sale favorite. Am
poftă să-mi fac un cercel cu această piatră fără preţ. Pofta ta e lege pentru mine,
frumoasă prinţesă, răspunse înflăcărat zmeul, dar nu ştie domnia ta că ticăloşii de
zmei cu colţi poftesc la carnea noastră?
— Nu ştiu şi nici nu mă interesează, închide uşa mai repede, că se face curent.
Amărît, Lobo se pregăti de plecare, închis în atelier, munci şaizeci de zile şi
cincizeci si şapte de nopţi (în cele trei lipsă îşi ciuli din răsputeri organul prinţe-
soreceptor către Camera Ascunsă, fără să poată percepe mai mult decît o vagă
urrnă de parfum Paloma Picasso şi, slab ca o părere, cîteva cuvinte ce sunau în
genul „Proştilor, nu mă veţi avea!") ca să confecţioneze cele trei duzini de zmee
care să-l poarte prin văzduh — Lobo era bufleiul familiei. Peste stolul plin de
desene colorate şi panglicute al zmeelor avea să se-nalţe unul imens, în formă de
fluture tropical, cu ochi de azur si cozi de rîndunică.
Zbură săptămîni în şir pe sub ţurţurii de sare ai plafonului, oglindindu-se în
lacurile de mercur ce ardeau cu un foc rece si ocolind răsuflarea clocotită a mărilor
de lavă. Vînă din zbor micii lilieci străvezii şi meduzele de văzduh care, umplute
cu un gaz mai uşor decît aerul, pulsau ritmic din membranele lor vezicante. Se roti
în jurul uriaşilor monoliţi de jasp. Văzu sub el forfota marilor imperii zmeieşti,
57
mişcarea oştilor în platoşe de oţel aurit, fluturarea flamurilor de mătase. Un
buzdugan azvîrlit pînă-n tavanul grotei urieseşti îi sfîşie şase zmee şi aproape că-l
doborî la pămînt. Se lăsă lin, mînuind abil sforile, pe o pajişte de lacrima
voinicului, lîngă căsuţa unui pustnic. Acesta locuia acolo singur-singurel, împreună
cu cele patru neveste, cele două prinţese legiuite şi o liotă de copii. Bucuros de
oaspeţi, îl pofti pe Lobo în odaie, dar acesta, prudent, preferă să rămînă afară, la o
bătaie de buzdugan distanţă, în-tr-adevăr, carnea dulce a zmeului zmeelor e un dar
dumnezeiesc pentru ceilalţi zmei. Anahoretul se-n-tîmpla să fie din stirpea zmeilor
cu colţi, un oarecare Domisolfamilarîpa (Domi pentru prieteni, iar pentru duşmani
Domisolfamilaripanimirakinitinili-yamagualpas), zmeu de treabă şi foarte săritor.
— Ce cauţi tu, fiule, zise el după ce-l ascultă distrat pe Lobo (căci în acelaşi timp o
săruta între corniţe pe zmeoaica sa favorită, o trimitea să spele blidele pe cea în
dizgraţie, juca ţări-oraşe-ape-munti cu unul dintre ţînci şi-i altoia un dos de palmă
altuia care-i deşurubase platoşa), ce cauţi tu e lucru greu si cu primejdie de cap.
împărăţia Bang-kook e păzită, la fiecare dintre cele trei puncte cardinale, de cîte un
zgripţor cu aripi din pene de diamant si cu o sabie-n cioc. Chiar şi dacă treci de ei,
nu faci nici o sută de paşi şi dai de un zid de plumb transparent, pe care se plimbă
genii de foc. Dacă treci si de ei, cazi în gropi înspăimîntătoare, unde te mănîncă
păianjeni mai mari decît casele. Dacă treci si de păianjeni, a-jungi la Centura de
Duhori, invizibilă, dar cu miasme care-ţi putrezesc carnea de pe tine. Dacă treci
şi...
— Nu te supăra, Domisolfamilaripaniminikini-tiniliyamagualpae, dar nu prea am
vreme de pierdut. Care-i soluţia?
— Habar n-am, răspunse distrat sihastrul, în timp ce cu o mînă repara acoperişul, la
alta îşi rodea ghearele şi în acelaşi timp... (dar nici noi n-avem vreme de pierdut).
Lămurit, Lobo îşi înălţă iarăşi zmeele şi mai străbătu o bucată de loc. Dădu de
zgripţorul care păzea împărăţia dinspre miazănoapte. Din fericire, acesta tocmai
dormea în post, după o noapte de vis cu o zgripţuroaică aprigă Trecu de el fără nici
o problemă. Merse ce merse si ajunse la zidul de plumb transparent. Geniile de foc
se dovediră coruptibile: Lobo le dărui cu mărinimie boabe de rouă culese de pe
frunzele de lacrima-voinicului. Mult mai greu îi fu cu păianjenii din gropi, pentru
că aceştia nu-nţe-legeau prea bine graiul provincial al lui Lobo. II chemară pe
Keke, tălmaciul lor. Keke era un păianjen bătrîn, cu două picioare lipsă. Toţi îi
respectau perii albi de pe cefalotorace. Dar, ca orice bătrînel, avea şi el maniile lui,

58
între care cea mai sîcîitoare era că se credea grozav de priceput în a le vorbi pe
limba lor celor de la ţară (adică tuturor celor care nu erau din Bang-kook).
— No, bădie, care-i tărăşenia? îl întrebă binevoitor pe Lobo, care tremura ţinut
bine între fălcile unei tarantule tinere.
— Păi... uite, trebuie să aduc nestemata pe care împăratul Bang-kook-ului o ţine...
— ...sub limba cosînzenei lui favorite! urlară toţi păianjenii-n cor, tinîndu-se cu
labele de abdomen de atîta rîs.
— Ehehe, bade, or vinit mulţi ca alde mătăluţă să caute scula aiasta de preţ, şi şi-or
lăsat ciolanele în gropile noastre. Numa', bată-te norocul să te bată, se vede treaba
că tu ai făcut în scăldătoare, că iacă, împăratul taman amu s-a găsit să ne facă o
porcărie nemaipomenită...
— Nu ne-a plătit soldele de mai bine de patru luni! completară obidiţi ceilalţi
păianjeni, cu ochişorii sclipind ca perlele în întunericul văgăunii.
— .. .aşa că, fiule, ai baftă chioară: merem cu tine, au la izbîndă, au la moarte!
— Merem, merem! întăriră şi ceilalţi păianjeni. Si toată ceata se urni către
interiorul împărăţiei.
Prin Centura de Duhori trecură strîngîndu-se toţi
81păianjenii ghem, cu Lobo în mijloc, şi rostogolindu-se cu viteză, aşa că putrezi
carnea numai pe păianjenii de rang inferior (aşa~nurniţii/rayt/en) care stătuseră la
exteriorul sferei. Mai trecură, prin diverse şiretlicuri, de diavolii roşii, de
portocalele mecanice, de escadrele azurii, de beretele verzi, de sumanele negre si
de gulerele albastre, urmate de un număr nesfîrsit de harpii, ştime, iazme, gorgone,
gheonoaie şi scorpii de diverse dimensiuni. Călătoria dură mai bine de optzeci de
ani. Cînd ajunseră, în fine, în miezul împărăţiei, aflară că împăratul murise de mult,
că în localnici dăduse ciuma, că pînă si Cosînzeana favorită era acum oale si
ulcele. Dădură de pămînt toate aceste oale şi ulcele pînă găsiră, înfiptă-ntr-un ciob
de argilă, nestemata cu pricina. Păianjenii îl declarară pe Lobo împărat si-l însoţiră
cu credinţă pe drumul de întoarcere după ce li se plătiră soldele cu şase luni avans.
Şaptesprezece ani dură drumul înapoi, prin coclauri neumblate şi codri întunecaţi.
Aşa se face că împăraţii Fofo şi Lobo se regăsiră în aceeaşi zi pe cîmpul de bătălie
din faţa casei părinteşti, acum ruinată de vreme si intemperii. Războiul dură şase
săptămîni, talgerele victoriei înclinînd cînd înspre zmeii lui Fofo, cînd spre
păianjenii lui Lobo. în cele din urmă din toate nenumăratele gloate mai rămaseră
vii doar cei doi fraţi, care abia acum se recunoscură şi, vărsînd şiroaie de lacrimi,
se strîn-seră cu dor în braţe. Erau acum doi vîji, bătrîni ca lumea, bîţîind pe
59
picioare descărnate. Suflară flăcări pe nări unul spre altul ca să-şi mai încălzească
inimile de mult împietrite. Si, minune! Cei doi se însufleţiră, şi acelaşi nume le
izbucni pe buze din fundul rărunchilor:
— Grunhilda!
Pătrunseră în casa-n ruine. Străbătură culoare dărăpănate, îşi arătară, plini de
emoţie, locuri în care se jucaseră cînd erau mici. îşi pipăiră unul altuia cucuiele
făcute cu aceleaşi ocazii, în fine, ajunseră în faţa uşii fatale. Se codiră multă vreme,
dar pînă la urmă îşi luară inima-n dinţi. Ciocăniră sfios.
— Cine e? se auzi vocea de neuitat, la fel de tînără şi de dulce (căci în Camera
Ascunsă vremea nu vremuieşte).
— Noi...
— Care noi?
— Noi, zmeii din stirpea zmeilor zmeelor, fiii tatălui nostru.
— Arătaţi fîţele!
Vai! Lobo si-o pierduse pe-a lui în viitoarea atî-tor lupte, în schimb avea nestemata.
Fraţii se priviră cu ochi umezi: ce bine le aranjase lllldd££0+> pe toate! Crăpară
uşa si arătară fîţa si nestemata.
— E-n regulă, zise Grunhilda şi se ivi, în fine, în prag, goală şi radioasă,
înnebuniţi, cei doi bătrîni trecură la fapte: scoaseră repede cîte un metru de tîm-
plărie din buzunar, îl desfăcură şi-o măsurară pe prinţesă din creştet pînă la călcîie.
Deziluzia le fu cruntă: Grunhilda nu avea decît 1,74 metri înălţime! Fură siliţi să-i
dea drumul să plece la părinţii ei, iar fraţii se încuiară pentru totdeauna în Camera
Ascunsă unde, dacă n-or fi murit, mai trăiesc încă. POVESTEA MICUŢEI POETE
VASILISKA
Pe cînd Lobo, atîrnat de zmeele lui multicolore, asculta spusele pustnicului
din pajiştea de lacrima-voinicului, străduindu-se, politicos, să nu caste, cineva îl
privea cu mirare din coliba acoperită cu oase. Era foarte tînăra zmeoaică Vasiliska.
Ea sorbea vorbele străinului, străduindu-se să nu uite nimic, cu aceeaşi pasiune cu
care învăţa pe de rost vechile Zurbe şi cu care privea insectele delicate ale cîmpiei.
Nu se mai sătura să tot adune, în sufletul ei încăpător ca o visterie regală, forme şi
culori, sunete şi adieri, veşti din lumea largă şi minuni ale închipuirii. Totuşi, oricît
s-ar fi bucurat de comorile ei, pe Vasiliska o învăluia tristeţea.
Din cea mai fragedă pruncie ea se simţise diferită şi de părinţii ei, şi de liota de
fraţi şi surori. Pe nări scotea doar o flăcăruie prizărită, de culoare roz-bon-bon, şi
niciodată inimile n-o îndemnau către fapte sîngeroase. De cînd se născuse în
60
familia pustnicului, rubedeniile acestuia îl ocoleau, iar localnicii nu-l mai venerau
ca înainte. Ba chiar şi familia ei o privea cu neîncredere. Pesemne, cugeta juna cu
întristare, tatăl ei, distrat ca de obicei, uitase să pronunţe, pe cînd o vrăjea pe
mămuca, fraza magică „Ni ni puah puah". Doar aşa se explica înfiorarea care o
cuprindea de cîte ori ieşea din colibă pe pajiştea de lacrima-voinicului, dorul
nelămurit cu care contempla florile al-bastru-cleioase, pe care fraţii ei se mărgineau
să le înfulece cu poftă. Cînd, la vîrsta de şapte ani, simţi pentru prima dată un
mugur translucid pe bărbie, nici măcar nu se miră prea tare, căci nu era decît
mărturia a ceea ce ştiuse în sinea ei de la început: fără-n-doială era o poetă, o
amărîtă cu bărbia îndreptată spre stele, o urîciune în casa oricărui zmeu cu colţi
cinstit. Era o puah, şi o puah avea să rămînă pentru totdeauna.
Numai iubirea pentru tatăl ei, blîndul sihastru, îi dădea puterea să îndure
batjocurile tuturor celor din jur. Acesta era un bătrînel neîngrijit, cu solzii strîm-
baţi în toate părţile şi cu şase canini lipsă. Prin locul gol rămas în urma căderii
caninilor scotea o limbă albăstruie cu care-o lingea adesea, duios, pe fiică-sa,
oftînd amarnic:
— Vasiliska, fata tatii, cu o grea povară te-au dăruit zeii. Totuşi, curaj! Putea fi şi
mai rău. Uite, ăsta micu e cocoşat, iar surorii tale mai mari i-au crescut sînii în
ceafă. Vei mînca şi tu molii palide la un loc cu toţi ceilalţi, că n-o să sărăcesc din
pricina asta.
Dar zmeoaicele si mai ales cele două domnite îi făcură curînd viaţa imposibilă,
poreclind-o Khuffa (poetă legendară, al cărei nume e infamant — N.A.) si
„bărbuţă", aşa încît Vasiliska se sculă într-o dimineaţă hotărîtă de plecare, îşi puse-
ntr-o bocceluţă trei molii conservate, şase perechi de dresuri, douăsprezece xexes
(robe tradiţionale cu loc pentru scos coada reptilină), nouă mantii de toate zilele,
patru mantii de gală, zece inele pentru nas, douăzeci şi şase de inele pentru
degetele de la lăbuţele de sus şi aproape şaizeci pentru cele de jos, precum şi două
rujuri negative (baghete din lemn de llomba care, la atingerea
85cu pielea, provoacă negi). Pe umăr purta animăluţul ei favorit, o strigoaică ce
torcea fericită, fremătînd în somn din tentacule.
— Ce ştii tu, Pisina, îi grăi tînăra pe cînd lăsa în urmă casa părintească şi se afunda
în pădure. Ce ştii tu ce e-n sufletul meu? Cît mă apasă pînă si vasta boltă
înţurţurată de deasupra noastră, cît mă strîng pereţii de stîncă ai acestei lumi! Mi-e
frică de semeni, de toţi aceşti barbari cu buzduganul pe umeri, mi-e silă de toată
lăudăroşenia lor, de veşnicele lor povesti cu Feţi-Frumoşi siniştri şi împăraţi
61
monstruoşi. Voi merge, Pisina, încotro mi-or vedea ochii pîn-am să găsesc alte
fiinţe care să-mi semene sau pînă am să cad şi-o să mi se sfîrşească viaţa la o
margine de drum.
Pisina clănţăni melancolică dintr-un cleştişor. Suplele ei codiţe cu ghimpi
înveninaţi zgîriară tandru ceafa stăpînei. Merseră mult şi bine, vînînd din cînd în
cînd cîte-o tiuuuuuuuuuuuuură zemoasă cu care-si mai ţineau zilele si dormind pe
apucate. Trecură de vulcani ce-si împroscau flăcările pîn-la tavan, traversară lacuri
de mercur pe spinarea helvalelor binevoitoare, dădură de ruinele unor cetăţi odată
vestite. Printre fărîme de steiuri şi mormane de grinzi ciclopice, Vasiliska recită
Vissele eroice care-i erau atît de dragi. Si, cu cît recita mai avîntat, cu atît simţea
descleierea dureroasă, dar de o dulceaţă nespusă, a mugurelui din bărbie, care
curînd desfăcu pentru prima dată gingaşa sa inflorescenţă de membrane si
filamente de culoarea cafelei cu lapte, în zadar însă îşi aţintea copila bărbia spre
boltă. Cu toate stalactitele şi florile ei de mină, bolta nu mirosea a nimic.
Pierduseră speranţa să mai găsească ţinuturi locuite cînd, după o traversare
epuizantă a unei cataracte de sulf lichid, zăriră în depărtare o strălucire ca de
aramă.
— Este o mină de cupru, rosti strigoaică în rapidul limbaj al tentaculelor care
atingeau fruntea tinerei stăpîne. Şi unde sînt mine, sînt şi zmei. Nu uita formula
„Hallom-Hallahham'', cu care trebuie să-i întîmpini.
Vasiliska nu o uită, aşa că familia de zmei ai zmeilor care stăpînea mina renunţă, cu
destulă părere de rău, s-o mănînce pe tînăra pe care-o zăriseră de departe. De altfel,
oricum nu mîncau, din principiu, puahi. Erau trei zmei mătăhălosi, cu mutre de tro-
glodiţi, ce se certau veşnic pe cele doar două buzdugane pe care le-aveau şi pe
singura cosînzeană din beci. Lîngă aceasta din urmă o lăsară pe Vasiliska să mîie
peste noapte. Cosînzeană se sperie la-nceput de strigoaică, dar pînă la urmă se
convinse că e blîndă si îndrăzni chiar să-ntindă mîna cu degete gingaşe, încărcate
de inele, ca s-o mîngîie puţin pe spinare. Cum stăteau ghemuite pe paiele celulei,
între cele două tinere se înfiripă curînd o caldă prietenie. Vasiliska află că frumoasa
cosînzeană — căci trebuia să fie frumoasă după criteriile amărîţilor de deasupra —
se numea Ileana, ca toate celelalte de altfel.
— Cîinii ăştia de zmei mă ţin aici prizonieră de...
— Pardon, nu sînt cîini de zmei, îndrăzni Vasiliska s-o întrerupă.
— Ah, iartă-mă, fac mereu gafe. Ştiu, şi tu eşti...
— Nu-i vorba de asta. Dar nu sînt cîini de zmeu, ci zmei ai zmeilor. E cu totul...
62
— Mă rog... tot nişte porci de cîine cu toţii.
— Pardon, începu din nou Vasiliska, dar nu mai continuă, ca să nu întrerupă
nepoliticos povestea cosînzenei. Cum spuneai?
— Brutele astea mă tin aici de mai bine de trei ani. Mă hrănesc cu molii si cu apă
mirosind a cocleală.
Mă apucă groaza cînd mă gîndesc că voi ţine în pîn-tec rodul spurcatei lor
dragoste. Mă gîndeam să mă spînzur cu nojiţele de la opinci, dar cînd m-au furat de
la tata eram în picioarele goale. Pe toate ne fură direct din cadă.
Micii zmeoaice îi veni deodată o idee, pe care-o comunică telepatic Pisinei.
Aceasta aprobă plimbîn-du-şi rapid tentaculele peste fruntea Vasiliskăi.
— Ileana, spune-mi, chiar dacă ţi-e greu: zmeii te-au vrăjit pîn-acum vreodată?
— Slavă Domnului, încă mă dispută-ntre ei. Cum se-apropie unul de celula mea, îl
trag ceilalţi înapoi. Acum merg la un muma-zmeilor să se judece pentru mine. Mi-e
că foarte curînd soarta-mi va fi pecetluită.
— Si dac-o să te-nvăt formula dezvrăjirii?
— Vasiliska, draga mea, sări cosînzeana, dacă faci tu asta pentru mine am să-ţi
spun si eu o mare taină.
Se legară cu jurămînt. Zmeoaica-i şopti la ureche formula magică. Apoi adormiră
îmbrăţişate, în sfîrîi-tul ca de motor Diesel al strigoaicei ce se ghemuise la
picioarele lor.
A doua zi, cei trei zmei plecară la judecată. După trei zile se-ntoarse unul singur,
fericit si pus pe fapte mari. Justiţia-si spusese cuvîntul. Cîntări mai întîi în mîini
cele două Nume ale Tatălui rămase doar pentru el, le aruncă pînă-n boltă si le
prinse pe degetele mici, după care le azvîrli în cui. Netezindu-şi un solz rebel din
creştet, se-ndreptă apoi, hotărît, spre cuşca cu gratii a cosînzenei.
N-am avut pînă acum prilejul să vorbim mai în detaliu despre vrăjire, care, ca si
blestemul, este o funcţie foarte importantă a minţii zmeiesti. Zmeii nu se-
mperechează cu femelele lor sau cu cele din specia umană ca toate animalele. Ei
posedă în creştetul
capului, sub ţeastă, o zonă a creierului de culoare aurie, cam de forma si mărimea
unei prune, pe care-o folosesc la vrăjire. Cu ajutorul ei proiectează în mintea
femelei pe care o doresc orice imagine vor, ispitind-o cu toate panglicile, volanele
si modele de pe pămînt. Cînd zmeoaica, prinţesa sau cosînzeana acceptă obiectul
imaginar, deodată simte în pîntece un vîrtej cumplit de dureros, şi din clipa aceea
rămîne grea. Căci e atît de greu, atît de greu să te opui vrăjirii!
63
Rînjind din botul încărcat de colţi şi făcîndu-i cu ochiul, zmeul (care răspundea la
simpaticul nume de Wrath) se apropie de Ileana şi-i şuieră în ureche:
— Scumpa mea, ghici ce ţi-am adus din tîrg!
— Te să fie, te să fie? se prosti Ileana.
— Ei, nu cine ştie ce, doar un Ferrari roşu de vis.
— Zooou? Şi-l ţii, pasă-mi-te, în buzunar?
— Nu chiar. E doar în spatele tău, prinţesă! Ileana privi în spate şi i se tăie
respiraţia. Căci era
chiar un fabulos cupeu roşu decapotabil, cu tapiserie de piele cenuşie şi cu volanul
de corn străveziu, cu capacele roţilor mai strălucitoare decît oglinzile. Ileana
deschise portiera şi se aşeză, sau mai bine zis se adînci în pernele moi ale
fotoliului. Cheia clin-chetitoare era în contact. Radiocasetofonul digital mergea şi
din boxe se revărsa o muzică de big-band. N-avea decît să trîntească după ea
portiera, să am-breieze şi...
— Proasto, formula! auzi o şoaptă şuierată, mai înaltă decît pragul sonor al
zmeului.
— Vasiliska, dar aşa ceva nu se refuză, e tot ce mi-am...
— Formula! Imediat! Vraja se apropie! Ileana, fii atentă: 5... 4... 3... 2...
Şi-ntr-adevăr, cosînzeana văzu cum din craniul strîmb al zmeului se degajă un
vîrtej aerian porto-
89caliu, care avansează ca o cometă rapidă, lăsînd în urmă o codită şuierătoare.
Animalicului se repezi direct spre pîntecul Ilenei, care abia mai avu timp să strîngă
ochii şi să strige din răsputeri:
IJfyou Tinkdaffo0k I Sffuny Fokk I0oselv Ensewiomm Anyy!
adică:
Va să zică-asa, îţi place să vrăjeşti? Vrăjeste-te-atund singur, si economiseşti!
într-o clipă splendidul automobil, lucios ca o bomboană de plastic, dispăru, iar
cosînzeana căzu în fund pe solul tare. Zmeul rămase o clipă încremenit, se-n-rosi,
se albaştri, se-nvineţi şi crăpă în cele din urmă de necaz, căci ruşinea asta n-o mai
păţise. Fetele se-m-brăţisară.
— Da' să ştii că dacă era Porsche nu mi-ar fi păsat de-un zmeuşor, acolo, în burtă,
în definitiv, au mai păţit-o şi altele!
— Bine că n-a fost. Acum, promisiunea! Cosînzeana sfîrşi cu gluma, şi fata ei
deveni gravă
si misterioasă. O trase deoparte pe zmeoaică si-i şopti:
64
— Ştiai că lumea nu se opreşte la grota asta mizerabilă? Ştiai că undeva, deasupra,
există un cer albastru, şi soarele, şi iarba smălţată de flori? Si pomi încărcaţi de
rodii şi de smochine? Ştiai că există dealuri şi munţi împăduriţi, cu izvoare ca de
sticlă din care sorb animale nespus de graţioase? Ştiai că acolo, prin văzduh, nu
zboară scîrbele astea palide, ci fluturi multicolori şi papagali limbuţi, gata să ti se
lase pe umeri? Oh, Vasiliska, degeaba ai trăit dacă nu ai văzut lumea mea, lumea de
deasupra, minunea dumnezeiască de la suprafaţă!
— Vechile Visse povestesc... începu Vasiliska, dar Ileana reluă ca în transă:
— Nu se poate povesti. Trebuie să vezi cu ochii tăi binecuvântarea norilor de vară
si-a oceanelor pline de insule verzi si corăbii. Farmecul zilelor şi, mai ales,
farmecul nopţilor, Vasiliska, al nopţilor de odihnă si de iubire! Cînd iese soldul plin
al lunii deasupra holdelor şi cetăţilor. Cînd începe să miroasă regina-noptii, şi
stelele năvălesc pe boltă ca o armată ferecată în diamante. Ca un milion de
dansatoare cu inele de foc pe fiecare deget... Iată răsplata mea, darul pe care ţi-l
dăruiesc: află că la scurtă distanţă de-aici se află un Kellt, numit al lui Meer, căci
acest poet ilustru-l conduce. Spune-i lui Meer că eu, Ileana, îţi dăruiesc Suprafaţa.
In acele momente de transfigurare, Ileana nu i se mai păru atît de oribilă Vasiliskăi.
Chiar devenise aproape frumoasă, în ciuda pilozităţii blonde şi a groteştilor ei ochi
albaştri. Dar aproape că n-o mai asculta. Nu-şi mai dorea acum nimic pe lume mai
mult decît să vadă Suprafaţa despre care-i vorbise cosînzeana şi despre care
vorbeau vechile legende, pe care le crezuse mereu nişte frumoase minciuni. Chiar
de a doua zi îşi luă rămas-bun de la fata care porni în direcţia opusă, spre altă
ieşire, mai îndepărtată, ce ducea spre castelul ei părintesc. O porni, cu strigoaica pe
umăr, pe un drum care urca şerpuind printre tufe de licheni fosforescenţi. Merseră
multe zile şi nopţi, pînă văzură în depărtare sclipiri de pirită. La capătul drumului
se deschidea o peşteră rotundă unde, în jurul grămezilor de minereu strălucitor,
şedeau vreo douăzeci de zmei şi zmeoaice, mai ales zmei cu colţi, dar şi din alte
rase, toţi puahi cu lungi ţurţuri crescuţi în bărbii, împungînd către boltă. Meer
însuşi o întîmpină şi, după o lungă discutie în care nu mai încăpu îndoială asupra
talentului si cunoştinţelor tinerei Vasiliska, toţi o primiră cu drag în mijlocul lor. îi
cunoscu astfel pe Zurr, pe Hildegarda, pe Bombas şi pe............(zmeu care
făcuse jurămîntul tăcerii şi care-şi făcuse din tăcere un nume). Le ascultă cîntecele
si hrankahrankas-urile răutăcioase, le împărtăşi gusturile şi valorile. După cîteva
săptămîni scurtele ei poeme începură să circule printre puahi, primite cu admiraţie
sau invidie. I se păru ciudată o tentativă de vrăjire din partea lui Bombas, al cărui
65
organ cristalomandibular i se păruse de la-nceput extrem de caraghios. Nu dădu
mare atenţie acestui fapt, căci era prea fericită să se afle între fiinţe asemănătoare,
pentru prima dată în viata ei.
Intr-o noapte, parcă la un semn nevăzut, poeţii se ridicară şi, într-un şir lung
şi tăcut, se-ndreptară către Ieşire. Abia acum observă Vasiliska uriaşul bolovan
proptit în peretele de la răsărit, atît de aproape de ei. înconjurară stînca, rostiră o
incantaţie şi, cu pari necojiţi, deschiseră fereastra spre lume.
Şi fereastra era plină de stele. Ieşiră pe un prag stîncos, poate la o uriaşă înălţime,
căci erau din toate părţile înconjuraţi de stele. Aerul era gros si dulce, noaptea era
adîncă şi parfumată. Vasiliska, înnebunită de frumuseţe, îşi înălţă si ea, cu toţi
ceilalţi, bărbia spre adevărata boltă infinită. De ce trăise toată viaţa în neştiinţă? De
ce anii vieţii ei se perindaseră sub pămînt? Cu faţa luminată de stele, cu toţi nervii
primind damful rece stelar, copila începu să cînte.
Iar a doua zi, o dată cu revărsatul dumnezeieştilor zori, Vasiliska văzu, pentru
prima dată în viaţă, ceea ce căutase întotdeauna, ceea ce noi toţi, zmei şi oameni,
căutăm şi vom căuta întotdeauna: limpedea, gingaşa, transparenta si nesfîrşita
Lumină.

POVESTEA SPIONULUI BOMBAS


Ovoi ţurţuri măreţi scînteind pe bolta eternă si voi mări de mercur oglindind
ale zmeilor plaiuri, ascultaţi cîntul meu, vechi ca lumea, cîntarea despre cumplitul
Klonkan, viforul mioritic ce în curbura Carpaţilor cîndva locuit-a. Cine-a putut să-i
stea vreodată-mpotrivă fără să-i zboare măselele măreţ buzdugan? Cine-n bîrlog
burduşit de prinţese intrat-a si-a mai ieşit cu viaţă în el, să privească amurgul?
Klonkan spintecă draci de voinici cum îşi taie friptura, li pîrjoleşte la flacăra
nărilor sale! Făt-Frumos ajunge jumări la el în tigaie, în tigaia de-aramă ce
cîntăreşte trei tone...
— „Burduşit de prinţese...", repetă visător Bombas, savurînd îndrăzneaţă imagine,
îţi şi venea în minte o încăpere plină, ca o cutie de sardele, cu vrafuri de prinţese
pînă la tavan. Dar ce să zici de monstrul care „ajunge jumări"? Ţi se zbîrlesc solzii
pe braţe. Cum să nu-ţi trezească astfel de versuri un fior eroic? Bombas i-ar fi făcut
şi el jumări, caltaboşi, trandafiri, patricieni, ghiudem şi mititei pe toţi ticăloşii
lumii. Pe cînd recita vechea vissă, singur în locul în care si împăratul merge fără
însoţitor, Bombas umflă pieptul şi pîrjoli cu-o suflare întregul stoc de hîrtie
igienică.
66
Din păcate, trebui să se-ntoarcă repede la realitate, căci îl chema datoria. Luă
de lîngă el, privin-du-l cu ură, turturele de carton cu floricică de cîrpă în vîrf si şi-l
lipi la loc pe bărbie. Chinul vieţii lui. Se întrebase de multe ori cum puteau puahii
să fie atît de orbi. Reuşise să pătrundă printre ei caraghios de uşor. Cînd îl chemase
marele Boss la el ca să-i dea misiunea, crezuse că n-o să reuşească niciodată.
-Unde e idiotul ăla care tîrăşte buzduganul pe coridor? întrebase stăpînul.
-Vreţi să spuneţi, ofiţerul de siguranţă, mărite? întrebă un slujitor.
-Vreau să spun: idiotul ăla care tîrăşte buzduganul pe coridor, de mă trezeşte cu
huruitul lui în fiecare dimineaţă.
— Acela e Bombas, spionul, alteţă.
— Să mi-l aduceţi imediat.
Bombas, care, din deformaţie profesională, trăgea şi acum cu urechea, se simţi
nedreptăţit. E adevărat că tîra buzduganul, dar nu era vina lui: de la magaziile
împărăteşti i se dăduse unul cu trei numere mai mare.
— Aici sînt, slăvite Krrrrn!
— Pleci în misiune imediat. Avem informaţii că un anume grup de nenorociţi din
ăia cu ţepi pe bărbie cutează să... Ia zi, ia zi, vornice, ce-a scris coate-goale ăla de
Meer despre augusta mea persoană?
— Să avem iertare, a zis că dumneavoastră... Da' nu-i adevărat!
— Nu-i adevărat, mărite, repetă indignată toată curtea.
— Adevărat, neadevărat, repetă vorbele alea!
— Păi, n-a zis mare lucru, doar că slăvită voastră persoană
la toaletă, ore-n şir se vrăjeşte în delir...
— Absurd, zise boss-ul. Nici pomeneală. Dar nu despre asta e vorba. Ascultă bine
ce-ţi spun, Bombas: se zice că aceşti nefericiţi de poeţi...
— Puah! făcu întreaga curte scuipînd cu dispreţ.
— Ies noaptea şi boscorodesc ceva sub stele, de încep tot felul de ploi de stele
căzătoare şi ni se stîr-pesc toate vacile din împărăţie, îţi dai tu seama? Du-te,
strecoară-te printre ei si află dacă e adevărat.
— Dar, slăvite, ce ştiu eu de poeziile lor? Or să-şi dea seama imediat că...
— Prostii! Uite, poetul nostru laureat — că doar sîntem şi noi împărăţie în toată
regula, şi încă de zmei nobili, mioritici, născuţi poeţi (în afară de cîte-va lighioane
de puahi, că nu există codru fără uscături) — o să te-nveţe cîteva trucuri.
— Si cu mirosul stelelor?

67
— Ei, zici si tu că una miroase a... caşcaval, alta a mort, alta nu miroase-a bine, dai
şi tu din clanţă, că doar nu eşti băiat prost. Eşti de-al nostru, mă, ca bradul! Ce mai
stai? Nu te-ai întors cu prima băgare de seamă?
Urmase o cumplită perioadă de instrucţie. Bietul Bombas trebui să-nveţe pe
dinafară două sute de zurbe, trei mii de visse şi aproape o sută de mii de proverbe
şi zicători de-ale Animicştiutorului. îl trezeau şi noaptea ca să-l întrebe anul naşterii
poetului naţional, Hilozois, şi mînca matrace peste urechi dacă nu ştia regulile
versificaţiei. Apoi, patru zmei ai zmeelor, sclavii împărăţiei, îl luaseră pe sus si-l
paraşutaseră drept în mijlocul taberei lui Meer.
După trei luni petrecute acolo, Bombas crezu că înnebuneşte. După încă trei
luni înnebuni de-a bine-lea. Vechile epopei începură să-i placă. Scrierile lirice îl
muiau pînă la lacrimi. Nimeni nu aprecia ca el o imagine, un epitet, o întorsătură
măiastră de condei. Pînă şi băgările de seamă începu să le facă în versuri, de se
cruceau superiorii lui:
Prea mărite împărat, multe s-au mai întîmplat între doi si cinşpe morte, deci,
citeşte mai departe: însuşi Meer,fire haină a-nceput să-ţi bage vină că trecînd măreţ
prin tîrg te scobeşti în nări cu sîrg.
Iară.........., pe foi veline,a mai scris că nu e bine, că prinţesele slăbesc în
haremu-mpărătesc fiindcă te zgîrceşti la pîine. Urogall a zis că mîine o să fie şi mai
rău, că eşti mare nătărău, că în loc de furculiţă te ajuţi doar de gherilă...
şi aşa mai departe, din ce în ce mai dezlînate si mai fără chef. Curînd, Bombas uită
de ce se află în Killt-ul lui Meer, uită că organul lui cristaloman-dibular e doar un
ţurţure de carton si se crezu poet, poet în toată puterea cuvîntului. Se apucă si ticlui
ode, epistole, satire, epitalamuri si fabule care, spre disperarea lui, nu avură nici un
succes, de bună seamă din pricina invidiei confraţilor. Atunci începu să-i
dispreţuiască aventurile de vorbe si hîrtie şi-şi dori destinul măreţ al eroilor
trecutului, al celor pe care-i zărea, mumificaţi, în vîrful obeliscurilor si care-i zîm-
beau strîmb din fresce. Stînd pe tron la baie şi recitind din saga lui Klonkan, în
dimineaţa în care începe povestea noastră, Bombas auzi deodată un glas din
adîncul sufletului:
— Viteazule, nu mai lîncezi! N-auzi chemarea depărtărilor? Nu te-nfioară
presimţirea aventurii? Doar să tîrăsti buzduganul şi să faci pe iscoada eşti bun? Sus
inimile şi la drum! Urmează-ţi soarta chiar cu preţul vieţii!
Uşa privatei zbură în ţăndări şi, de unde intrase acolo un amărît cu barbă de carton,
ieşi un erou legendar cu privire de acvilă, pîrjolind totul în cale. Nici nu-şi luă
68
rămas-bun de la cei din killt. Dezgropa fiorosul buzdugan cu trei peceţi din locul
tainic unde-l pusese şi-l sui pe umăr. Greutatea lui îl cocîrjă. Dădu bolovanul la o
parte si ieşi la lumină.
Soarele plutea în slava cerului. Lanuri întinse de grîu se coceau în arşiţă cît
vedeai cu ochii. Orbit de lumină, zmeul o luă la vale, îndreptîndu-se către îm-
părăţie. Trecură cinci ceasuri şi aceleaşi lanuri presărate cu maci, pline de lăcuste şi
ciocîrlii se-ntin-deau pînă la orizont. O geană de pădure se ivi spre miazănoapte.
Schiopătînd, căci îi intrase o pietrici-că-n opincă, zmeul ajunse într-un tîrziu la
poala codrului. O mare scobitură-n pămînt, acoperită cu crengi de fag, îl vesti că a
dat de locuinţa unui zmeu sur de văgăună. „O, nu!", gemu Bombas si vru s-o
şteargă cît mai repede, dar deodată-i fugi pămîntul de sub picioare si nimeri,
prăbuşit prin tavan, tocmai în sufrageria unde, faţă-n faţă la o măsuţă, soţul si soţia,
cu chipuri arătînd o neţărmurită si reciprocă ură, jucau tabinet. Tarantulele de pe
umerii celor doi încercau să tragă cu ochiul în cărţile adversarului. îşi îndreptară
însă repede privirile către noul venit.
— Un zmeu mioritic, un zmeu mioritic, şuieră femeia, ascunzîndu-se după soţul ei.
— Văd si eu ce e, muiere, că doar are cămeşă cusută cu amici si cioareci, răspunse
cu dispreţ bărbatul şi sări la bătaie ca ars.
Se luptară zi de vară pînă-n seară. Pînă ce Bombas ridică buzduganul deasupra
capului, cei doi zmei de văgăună avură timp să-l lege de sus pînă jos cu funii
groase ca mîna. Apoi însă zmeul prăbuşi peste ei enormul instrument, de-i băgă în
pămînt pînă la gît. Aici ajunseră într-un impas, căci zmeul singur nu se putea
dezlega, iar cei doi văgăunisti nu puteau ieşi singuri din ţărînă. Făcură deci un tîrg:
apucîn-du-i uşurel de gulere cu colţii, zmeul îi trase afară, iar familia reunită îl
dezlegă şi apoi, deja buni prieteni, se aşezară împreună să servească cina. Fu adus,
pe o barocă ta viţă de inox, un zmeu al zmeelor grăsuţ, prosper, rumen în obraji, cu
o mandragoră în gură şi cu mult busuioc presărat pe spinare, împrejurul lui sticleau
feliute de lămîie. Cei trei îşi legară la gît şervetele şi apucară furculiţele. Se ivi de
sub masă si unicul fiu al zmeilor suri de văgăună, Astor, care, ignorînd încă bunele
maniere, se repezi la tăviţă, încercînd să-i smulgă zmeului zmeelor o ureche.
— Staţi, staţi, prea vitejilor! Făceţi-vă pomană! Cu ce vă alegeţi dacă mă mîncati?
Lăsaţi-mă să merg acasă, să vi-i aduc şi pe mama, si pe tata...
— Lasă-te de iordane de-astea, că am fumat noi ca tine destui, îi răspunse fără chef
zmeul mioritic ridicînd furculiţa, pe care o ţinea ca pe un pumnal.
-Numai dacă... Zmeul de văgăună avu o sclipire avidă în ochii tarantulelor.
69
— Dacă ştii vreo poveste, adăugă repede zmeoai-ca, lingîndu-se pe buze. Că ăsta
micu al meu le-a uitat de pe-acuma pe toate.
— Da, o poveste eroică, mai zise şi Bombas, o poveste despre Klonkan dacă ştii,
eşti salvat!
— Parol? făcu zmeul zmeelor neîncrezător.
— Pe onoarea noastră!
— Aflaţi atunci, preaslăviţi zmei, rosti cu vioiciune zmeul zmeelor, ridicîndu-se-n
capul oaselor si ştergîndu-se la ochi de maioneză, aflaţi că pe vremuri, demult, trăia
în Munţii Apuseni o cinstită şi modestă familie de zmei mioritici, compusă dintr-o
zmeoaică bătrînă, cei trei fii şi cele trei nurori ale ei. Ei locuiau fericiţi în nişte case
mari, ce se vedeau de departe, înconjurate de un simplu codru de aramă. Nu
avuseseră bani şi pentru cei de argint şi de aur. Primii doi zmei erau puternici ca
stîncile, al treilea însă, Klonkan, era numai piele şi os. Primii doi aveau buzdugane
în întregime de bronz, cu ţepi lungi cît braţul. Klonkan avea un buzdugan numai
din per-nuţă. O pernă cu mîner. Toţi rîdeau de el: ce-o să faci tu, nefericitule, la
război cu asemenea buzdugan de puf? Dar Klonkan zîmbea si el în sinea lui. Căci
cei doi fraţi în zadar au încercat, pe rînd sau împreună, s-o ucidă pe bătrînă cu
buzduganele lor. O izbeau în numele tatălui pe cînd dormea, iar ea, dimineaţa, cică:
„Am visat că mi-a trecut un şoarece peste frunte." Pe cînd, cu perna lui, minunatul
Klonkan nu numai că o sufocă pe bătrînă, dar îi rezolvă si pe ceilalţi în cel mai
scurt timp, rămînînd singur stăpîn pe averea părintească.
— Brava, Klonkan! se trezi Bombas, entuziasmat.
— Aferim voinic! exclamară şi zmeii de văgăună.
— Staţi să vedeţi. Rămas singur stăpîn pe moşia zmeilor, în inimile viteazului se
trezi dorinţa legitimă de a-şi lua o adevărată soţie. Prima nu fusese bună de nimic.
„O cosînzeană, o cosînzeană de-aş avea...", murmura tot timpul zmeul cel mioritic,
exersîndu-şi vraja cea mai seducătoare, cea care făcea să apară o rochie de la Coco
Chanel. Numeroase exerciţii fizice îl făcură curînd să arate încă mai voinic decît
răposaţii săi fraţi. Horind şi doinind, plecă într-o dimineaţă de vară să-şi caute
norocul. Ajunse într-o poiană, întîlni acolo un balaur pe nume Yokan, care i se ală-
tură. Dădură şi peste Stătu Palmă Barbă Cot, cu barba prinsă în despicătura unui
copac, îl luară cu totul, căci aveau nevoie de lemne de foc. împreună mer-seră ce
merseră, pînă ajunseră la curţile împăratului Roşu. Blestematul, nu vru să dea fata
de bunăvoie. Niciodată prăpădiţii nu înţeleg onoarea ce li se face. Aşa că îl
spînzurară într-un cui de turul pantalonilor şi-o răpiră pe Ileana.
70
— Hă, hă, hă! izbucniră zmeii, dînd cu cănile de bere în masă.
— Staţi să vă spui. Şi-o duseră pe cosînzeană la curţile lui Klonkan, unde fata se
îndrăgosti nebuneşte de el. îi lustruia colţii cu piele de căprioară, se bronza toată
ziua la răsuflarea lui de foc... Yokan făcea giumbuşlucuri, Stătu Palmă îi dădea
roată pe jumătatea sa de iepure şchiop... Trăiau cu toţii fericiţi, pînă ce un ticălos de
voinic, fără să fie provocat, tăbărî mişeleşte în faţa castelului şi una-două, să le ia
fata, că cică o sechestraseră.
— O ce? întrebă Bombas, avid de detalii.
— O... răpiseră, na! Şi-atunci, dînd brusc deoparte porţile cetăţii, se ivi în prag,
măreţ ca Dragg-Onn, puternic ca munţii, strălucitor ca aurul, bogat ca Pluto,
chinuit ca Nessus — înfricoşătorul Klonkan, spaima amărîţilor, ciuma voinicilor,
moartea pasiunilor, mozaicul tutunului, tăciunele porumbului, filoxera vi-ţei-de-
vie! La soare te puteai uita, dar la lună, ba! Se-ndreptă ţanţoş către voinic, care-o
băgase pe mî-necă.
— Ce? întrebă zmeoaica sură.
— Spada, ca să n-o vadă Klonkan. Se bătură-n spade. Spadele s-au frînt. Se
zdreliră-n buzdugane. Cum si al voinicului era tot de puf, totul părea o bătaie cu
perne într-un dormitor de tabără. Atunci Klonkan l-a apucat pe monstru de plete, l-
a ridicat pîn-la cer şi l-a vîrît în pămînt pînă-n Australia. Voinicul a ieşit de acolo,
s-a îmbarcat pe-un vapor şi a revenit la luptă. L-a apucat pe Klonkan de coadă,
zburîndu-i cîţiva solzi, şi l-a rotit atît de rapid, că i s-au separat pe straturi oasele,
carnea si sîngele, ca la centrifugă. Zmeul şi-a revenit însă şi l-a apucat pe voinic de
datorie (îi împrumutase odată patru co-sînzene), la care acesta a fugit mîncînd
pămîntul. Klonkan a aruncat după el cu un pietroi, de l-a făcut mici-fărîmici. Aşa
era măreţul Klonkan. Şi-am încălecat pe-o gheonoaie şi v-am spus o mare şi
gogonată trăsnaie!
— Bravo! strigară toţi zmeii fericiţi, după care îl tranşară frumos pe zmeul
zmeelor, îl stropiră cu lămîie şi-l mîncară cu voie-bună, pînă ce pe tavă rămaseră
doar oasele. Mulţumiţi, împăcaţi cu lumea, cei trei se priveau acum ca nişte vechi
prieteni.
— Fraţilor, veniţi mai aproape, să vă spun o mare taină, rosti Bombas cu o lucire
stranie în ochi. Zmeii de văgăună se apropiară pînă ce labele negre şi păroase ale
păianjenilor se atinseră. Pînă si Astor vîrîse urechile lui mari în botul zmeului
mioritic.
-Aflaţi, fraţilor, că eu... eu sînt...
71
— Cine? întrebară într-un glas cei trei, cuprinşi de sumbre presimţiri.
— Eu sînt însuşi Klonkan!
Cum n-aveau motive să nu-l creadă, zmeii hotă-rîră să-l urmeze în aventurile lui
eroice. Doar Astor avea să rămînă acasă, ca să păzească bordeiul.
A doua zi se-ndreptară cu toţii spre împărăţia lui Galben-împărat. Ajunşi în faţa
porţilor, măreţul Bombas-Klonkan umflă pieptul si răcni pîrjolind iarba în fata lui:
„Vreau o domniţă! Dar să aibă sub douăzeci de primăveri!"
Nici o domniţă nu se arătă. Ieşi în schimb un Făt-Frumos care-i făcu varză pe toţi
trei.
POVESTEA LUI ASTOR, PUIUL ZMEULUI DE VĂGĂUNĂ
Trecu o zi, trecură două, trecură nouă şi părinţii micului Astor nu se mai
întoarseră. Fără să-şi facă prea multe griji — căci, oricum, mămuca şi tătuţu îl
băteau de-l zvîntau de cîte ori se plictiseau prea tare —, puiul ieşea în fiecare
dimineaţă cu grebla pe spinare şi peria crîngurile şi pajiştile. De fiecare dată
rămîneau prinse în dinţii de fier cele mai delicioase insecte. Cum nu-i slăbise încă
vederea (asta se-ntîmpla abia la adolescenţă), Astor se bucura de tot ce era-n
preajmă. Se căţăra pe cîte-o creangă şi stătea atîrnat cu capul în jos, ţopăia-ntr-un
picior pe cărare, decapita ciulinii cu lovituri ale unui închipuit Toroy-Pan, alerga
pînă la lacul din preajmă si se scălda în el zvîrlind stropi mari în toate părţile. Intr-o
bună zi, întorcîndu-se-n văgăuna maternă, Astor găsi castelul de nisip pe care-l
clădise cu o seară-n urmă călcat de picioare duşmănoase. Din bezna bordeiului
pîndeau ochi de tarantule străine. Cineva îi ocupase căsuţa părintească. Obidit,
puiul porni la drum ducînd cu el numai grebla şi trei cămăşuţe de sîrmă ghimpată
pe care tocmai le dusese la rîu să Ie spele.
Intîlni pe drum zmei de toate felurile, mai buni sau mai răi. Cum Astor era
tare jucăuş şi, mai ales, cum ştia să-i scarpine cu grebla tocmai pe unde-i
103mînca mai tare, zmeii se purtară frumos cu el. Un zmeu al zmeilor, cărunt şi
hîtru, îl primi în mina iui de musaca de vinete, săpată adînc sub pămînt, şi-i arătă
cum se foloseşte tirbuşonul. Puiul dădu şi el un cep în stîncă, scoţînd limba de-un
cot, şi se pomeni acoperit de musaca din cap pînă-n picioare. Zîmbind îngăduitor,
zmeul bătrîn îl linse bine, dîn-du-i în acelaşi timp sfaturi demne de ţinut minte: —
Află, fiule, că multe si rele lighioane trăiesc pe lumea asta. Se vede treaba că aşa
le-a aşezat pentru păcatele noastre. Că doar nu zice de pomană ce zice
Animicştiutorul, în marea lui înţelepciune:
neplăcute decîf lucrurile bune Sînt întotdeauna cele releî
72
Am văzut la viaţa mea hidre cu douăsprezece capete, ce pot mătura trei zmei doar
cu o lovitură de coadă. Am văzut scorpioni cît muntele şi gheonoaie cît casele. M-
am bătut eu însumi cu... hm!... cu optzeci si patru de zmei cu colţi deodată şi i-am
făcut harcea-parcea pe toţi! Am făcut din colţii lor ditamai castelul.
— Si unde e castelu-ăsta de colţi, nene zmeule? întrebă somnoros Astor.
— Ăăă... a plouat pe el şi s-a dizolvat... dinţii lor nu prea ţin la ploaie... Dar ce
voiarn să zic... Fiule! Ia aminte: dintre toate lighioanele: viermi veninoşi, flori
carnivore, caracatiţe cu harpon, viespi cu acul cît lăncile, păianjeni cu plase între
doi munţi — nici una nu-i mai rea decît prăpădiţii de suprafaţă (oamenii, cum îşi
spun ei). Să nu cumva să cazi în mîna lor că e jale: în gheară de fiară şi-n gură de
tun mai dulce-i pieirea! Dacă vezi vreunul, să fugi mîncînd pămîntul!
— Şi cum arată perpeliţii ăştia?
— Prăpădiţii. Sînt urîţi, mă! Brrrr! îi visezi noaptea. Au... aşa... ai văzut peştii
curăţaţi de solzi? Ei, aşa e pielea lor. Şi sînt netezi peste tot, ca nişte viermisori. Da'
muşcă rău, mă nepoate, ia uite-aici.
Si zmeul îşi deşurubă platoşa într-o parte ca să-i arate pustiului o gaură cît ai băga
pumnul.
— Asta-i opera unui Făt-Frumos.
Zmeul rămase o vreme pe gînduri şi apoi continuă visător:
— Numai că, bată-le să le bată, muierile lor, domniţele, mă, cu sîngele albastru,
sînt frumoase, nepoate! Şi noi, de, zmei sîntem... avem şi noi nevoie... Dar asta nu
trebuie să ştie un mucos ca tine.
Astor îl ajută să ducă în magazie marea căldare de aramă plină cu musaca. Acolo
aşteptau nişte fiinţe atît de curioase, că micul zmeu holbă ochii cît cepele: cele
două arătări în veşminte albe şi cu un soi de coif alb pe cap aveau pielea ca a
peştelui curăţat de solzi şi erau netezi peste tot şi aveau... vai, erau prăpădiţii
prăpădiţi de suprafaţă! Astor se apucă strîns de piciorul zmeului şi începu să urle
cît îl ţineau bojocii. La rîndul lor, amărîţii scăpară din mîini lada de răchită în care
se zbătea cineva, se făcură şi mai palizi decît- erau şi, căţărîndu-se unul pe altul,
încercară cu disperare să iasă din magazie.
— Staţi, mă! Stai, mă, nepoţele, că-mi rupi piciorul! Ce, ai înnebunit? Ăştia sînt
blînzi, mă, nu muscă. Sînt bucătarii lui Vînăt împărat. Iar ăsta e un pui, mă
bucătarilor, ruşine să vă fie că vă speriaţi de un prunc cu caş la gură! Bine zice
Animicştiutorul, mă:
Lucrurile care par înspăimînfătoare De multe ori sînt chiar aşa.
73
Bucătarii se potoliră si ei, dar nu se apropiau de micuţ în ruptul capului.
— Ce să facem şi noi, ia, acolo, puţintică contrabandă. Da' şefii noştri închid si ei
ochii. Prăpădiţilor le trebuie musacaua noastră, nouă ne trebuie... ne trebuie şi nouă
ceva de la ei...
— Ce, nene? întrebă Astor, nescăpîndu-i din ochi pe cei doi monştri.
— Ei, ceva cu halva care nu-i de mutra ta. Ia mai cară-te la joacă.
Pe cînd ieşea din magazie, Astor mai apucă să-l audă pe zmeu bodogănind:
— Vai de zilişoarele noastre... am ajuns să colaborăm cu" duşmanul... Da'altfel, de
unde muieri? Că doar nu zicea degeaba Animicştiutorul, în înţelepciunea lui:
Baca dragoste nu c, Rimic nu e....
Astor urcă la suprafaţă şi o luă în jos pe cărare, molfăind o mandragoră care ţipa ca
din gură de şarpe. „Ei, taci, proasto, ce, dacă ţipi nu te mănînc?", îşi zise-n sine, şi-i
vîrî suzeta în gură. Nimeri într-o livadă cu mere ce se coceau sub soarele
strălucitor. Fiecare măr strălucea şi el ca şi soarele. Puiul îşi înfipse colţii în-tr-un
fruct şi se pomeni, uimit, că-i sar în toate părţile în ţărînă, căci merele erau de aur.
Degeaba îi adună de pe jos şi încercă, urlînd de durere, să şi-i pună la loc. Tinîndu-
se de fălci, mîrîind si scîncind, umblă prin livada nesfîrşită pînă ce dădu de un
prăpădit care moţăia sub un măr. îşi pusese o ţepuşă la ceafă şi una sub bărbie, ca
să poată sta treaz. Degeaba: cea de sub bărbie îi sfredelise guşa, apoi limba si ieşise
de-o palmă prin buza de sus, iar voinicul continua să sforăie haiduceşte.
— Hei, nene, îl scutură Astor. Nene, scoală-te! Prăpăditul sări în sus de trei coţi, îşi
smulse furios
ţepuşa din falcă şi se răsti la zmeusor:
— Sine mama naibii eşti tu? Tu eşti hosu! De se furi mere, netrebnicule?
Şi-l înşfacă de urechi, scuturîndu-l pînă ce Astor începu iar să urle.
— Io n-am furat, nene, io nu ştiu nimic...
— Da, tu eşti mic, nu ştii nimic, tata-n pod beleşte oaia, nu? Ia arată se-ai în sîn.
Dar voinicul se dezmetici si văzu că n-are-n faţă decît un pui de zmeu speriat.
— Măi... pusică, ştii tu sine sînt eu? Eu sînt Prîslea sel Voinic si merele de aur, mă.
Ai auzi tu de mine?
— Nu, nene, eu caut doar un, hîîîîîîîîîîîîîîîîî, dentist. Nu ştii un dentist pe aici? Că
mi-am spart dinţii în mere. Huuuuuuuu! Huhuuuuuuuuuu!
Prîslea-l privi cu milă.
— Te cred, mă nepoate, că si eu... cu blestematele astea de măsele... Se mai tura-
vura, aide la-mpărat si cum o zise el, aşa om f ase.
74
Prîslea (ce-şi spunea în taină Presley, părîndu-i-se că sună mai nobil) culese cîteva
mere, le puse pe o tipsie de aur şi, triumfător, se-ndreptă spre palat cu zmeuşorul
ţopăind după el. împăratul nu mai putu de fericire. Era pentru prima dată cînd avea
parte de merele cele minunate. Luară cu toţii cîte unul: împăratul, împărăteasa, cele
trei prinţese şi şambelanul în ciorapi de mătase. O cascadă de dinţi şi dinţisori
zburară în toate părţile, ţopăind pe dalele de marmură ale pardoselii. Un cor de
urlete si gemete se dezlăntui. Ghemuit într-un colt, urla şi Astor, mai tare decît ei
toţi. îngrozit, Prîslea o luă la fugă pe culoarele castelului, citind inscripţiile de pe
sute de uşi, dar pe nici una nu scria „Cabinet stomatologic". Ieşi din castel si
străbătu în goana cailor toată împărăţia. Nici un dentist nicăieri: pentru că aveau
din belşug pastă de dinţi (extrasă din zăcăminte de zmei şi vîndută prin
contrabandă), nici un locuitor nu avea carii. Disperat, Prîslea merse la Mamma Ca-
terpillar, o babă uitată de moarte, care ştia cîte-n lună şi-n stele. O omeni cu un şip
de rachiu şi baba deschise clonţul:
— Maică, o iei mata pîn pădurea de colo, mergi ce mergi, dai de o gaură în pămînt,
cobori acolo, faci de trei ori dreapta, de patru ori stînga şi mergi, aşa, cale de vreo
patru luni. Dai de o baltă de argint-viu si dup-aia de o cetate mare. Acolo-i ţara
zmeilor cu colţi. Ăia e dentişti dîn tată-n fiu.
Nu trecu anul, că Prîslea se şi întoarse cu un zmeu legat fedeleş, cărînd în spinare
un coşcogea scaun dentar, alb, cu pedale, pahar de plastic, bormaşină si farfurie cu
becuri deasupra. Micul convoi fu primit triumfal, cu urale şi confetti. Tronul din
sala imperială fu demontat si în locul lui fu instalat scaunul dentar. Se formă o
lungă coadă, şerpuind pe culoare şi prin grădinile castelului. Primul era împăratul
însuşi, urmau împărăteasa, cele trei fiice şi şambelanul. Veneau apoi toţi locuitorii
împărăţiei, de la vlădică la opincă, pentru că toţi fuseseră ispitiţi de merele
strălucitoare. Mînuind cu măiestrie leuca, zmeul cu colţi lucră de dimineaţă pînă-n
seară. După ce-l certă bine cu buzduganul pe sub fălci, îi plantă împăratului în
gingii pietre nestemate după cum urmează: un sardonix, un opal, o agată, un
crisolit şi un onix în şirul de sus, şi un topaz, un smarald, un ametist, un diamant şi
un jasp în cel de jos. Cînd îşi arătă prima dată, într-un zîmbet larg, noii dinţi,
multor curteni li se muiară genunchii, iar pe o cameristă borţoasă o apucară
durerile facerii. Pentru prostime zmeul folosi pietricele de rîu, frumos lustruite.
Cînd tot poporul din împărăţia lui Vînăt-Impărat avu frumoşi dinţi nou-
nouţi, împăratul, recunoscător, îl încarcă de daruri pe felcer: un fier de călcat cu
cărbuni, o roată de bicicletă şi doi metri de cablu coaxial, şi-l trimise înapoi de
75
unde venise. Opri în schimb scaunul dentar care, fiind foarte confortabil, deveni
tronul oficial al împărăţiei.
Venise-ntre timp şi rîndul lui Astor, care stătuse cuminte la coadă în spatele
şambelanului în ciorapi de mătase. Cînd s-a văzut cu noii coltisori din caiele de
potcoavă, micul zmeu fu cît se poate de mulţumit. Şi-i înfipse, ca să-i încerce, în
spinarea unui motan cenuşiu, care-o luă la fugă zbierînd. Zmeusorul ieşi din castel
fluierînd şi ţopăind într-un picior. Culese din întinsele grădini un buchet mare de
mio-sotis şi le ronţăi cu poftă. Prăpădiţii ăştia nu erau chiar aşa de răi, se gîndi el.
Pînă-atunci nu-l muşcase nici unul. Totuşi, se ţinea departe de satele pe care le
zărea risipite ici-colo în faţa lui, cu acoperişurile lor de paie, căci cîinii îl miroseau
de la distanţă şi-l lătrau ca turbaţii.
Cînd se lăsă amurgul, cu dîre sîngerii la orizont, Astor rătăci drumul. O luă printr-
un lan de floarea-soarelui, se-mpiedică de muşuroaie de cîrtită şi se prăvăli în
ţarină de se făcu ca altă arătare, începu să plîngă de foame si de frică. Dar îşi aduse
aminte de părinţi si se îmbărbăta: mai rău fusese înainte... Aşa că avu puterea să
ajungă la marginea unui sat, lîngă un gard pe care încercă să se caţere cu ghearele
şi cu colţii, îl încalecă şi se trezi deodată bufnind greoi în partea cealaltă.
In curtea casei se aflau cîteva şiruri de viţă-de-vie cu struguri mari şi copţi,
încălziţi de soarele portocaliu al asfinţitului. Două fetiţe cu cozi lungi, împletite cu
floricele de nu-mă-uita, băteau de perete o minge vărgată. Jucau Reginele şi, din
cînd în cînd, una înainta cu paşi mici şi se oprea brusc, ca o statuie vie, ţinîndu-şi
parcă şi respiraţia. Umbra ei neagră şi lungă ca un ac de ceasornic se-ntindea atunci
pînă la gard. Văzîndu-l pe Astor, ce nimerise într-o albie cu clăbuc si, cu lăbuţele-n
sus, se zbătea să iasă, fetele fugiră ţipînd pe prispă iar mingea, sărind în arcuri tot
mai mici, se opri în nişte tufe de zmeură.
— O şopîrlă! O sopîrlă! strigau, ascunzîndu-se după stîlpii prispei. Si tocmai în
acea seară tăicuţul plecase în sat ca să cumpere nişte hamuri şi, după obicei, mai
întîrzia pe la crîşmă. Cît despre mămuca, ea le apărea numai nopţile, luminîndu-le
visul. Vă-zînd că Astor izbutise în fine să iasă din albie şi se-n-drepta ţinîndu-se de
fund către ele, cele două se refu-giară în tindă si, cu ochişorii măriţi de groază,
traseră zăvorul. Privind pe ferestruica din băşică de porc, zăriră ciudata arătare —
ce nu era mai înaltă decît ele — oprindu-se-n prag şi arătînd cu gheruţa către gură.
— Ia uite-o, merge-n două labe, îi şopti la ureche cea cu părul ca spicul copt
celeilalte, cu viţele castanii.

76
— Si ce ochi blînzi are! răspunse cealaltă. Statură aşa, cu sufletul la gură, mai
multe minute.
Şopîrlă scotea nişte sunete caraghioase, dar nu încerca să deschidă uşa.
— îi ghiorăie maţele, trebuie să-i fie tare foame, îşi ziseră fetiţele, întrebîndu-se
apoi ce-or mînca oare sopîrlele.
— Păi, gîze, şoricei, molii...
— Rîme... Hai să-i dăm nişte rîme!
Toată ziua fetiţele scoseseră rîme din pămînt, şi le puseseră claie peste grămadă
într-o strachină, sub nişte iarbă ofilită. Traseră zăvorul cu grijă şi strecu-rară pe
prispă strachina în care rîmele, roşii şi inelate, mişunau în toate părţile, strîngîndu-
se şi subţiindu-se. Astor luă farfuria în labe şi se înfruptă pe săturate. Apoi se şterse
la bot cu mîneca si spuse politicos:
— Săru'mîna pentru masă.
— Să trăieşti, burtică grasă, îi răspunseră fetiţele-n cor, după care li se muiară
genunchii de frică:
— Vorbeşte! Vorbeşte! ţipară, nemaiştiind unde să se ascundă. Dar zmeuşorul
deschise încetişor uşa şi se aşeză pe o laviţă, ca un copil cuminte, făcîndu-şi de
lucru cu o lingură de lemn.
Văzînd cît e de blînd, fetiţele s-au liniştit, l-au întrebat cum îl cheamă si ce jocuri
ştie şi, pînă a venit tăicuţul, s-au jucat, pe rînd, de-a matrakul, de-a patru tuute
rebegite, de-a mijoarca si de-a cei trei prinţi călare.
— Putem să-l ţinem, taţi? Te rugăm frumos! se pisiciră surorile pe lîngă gospodar.
— Şi dacă face murdărie în casă?
— Nu face, taţi! Curăţăm noi! Hai, taţi, lasă-ne să-l creştem noi!
Atît îl bătură la cap pe bietul creştin, care-si iubea fetele ca pe lumina ochilor, că
pînă la urmă acesta încuviinţă.
Aşa şi-a-nceput Astor viaţa în mijlocul oamenilor. Curînd, toţi l-au îndrăgit pe
Gheorghită, cum l-au botezat la biserică, ba încă veneau oameni din toate satele din
preajmă să-l vadă. Harnic şi destoinic, el a trăit în sat pînă cînd, bătrîn şi sătul de
zile, a adormit somnul drepţilor. Pînă în ziua de azi oamenii vorbesc cu drag despre
el.
POVESTEA DOFTORULUI CHUNG
Gmera la gura cătrănitului Chung traducere liberă Maimuţa-care-priveşte-
cu-suspici-une-spre-ocean — pe cînd se-ntorcea spre casă nu îndrăznim să
aşternem pe hîrtie, dar e lesne de închipuit. Răpit si adus cu forţa de pe Tărîmul
77
Celălalt, înşelat la plată de împărat după ce pusese dinţi întregului popor, jefuit de
scaunul său dentar, dăruit în batjocură cu trei hîrburi cu care n-avea ce face, zmeul
clănţănea fioros din colţii săi multicolori şi izbea cu picioarele în toţi bolovanii din
cale.
— Presley! Presley! Te fac arşice! răcnea el înăbuşit, răşchirîndu-şi în van
ghearele. Acest nume devenise pentru el un coşmar şi o batjocură. Ce prost fusese!
Ce uşor se lăsase păcălit... Nemernicul acela bătuse la uşa paşnicului său cabinet,
pe care scria
Dr. Chung medic primar Stomatologie: luni 14 -l6
miercuri 10 -l2
Schingiuiri: joi 16 -l8
vineri 6 -l0
Execuţii: sîmbătă 8 -l6
DUMINICA ÎNCHIS
Se aşezase in scaun şi ceruse:
— O execusie, vă rog. Dar fără spălat pe cap, că sînt pusin răcit.
Şi nici măcar nu era într-o sîmbătă... Pînă ieşise să aducă butucul şi securea,
prăpăditul îşi şi pregătise laţul. Şi, o dată legat, ce era să mai facă bietul doftor?
Du-te, nene, şi scoate dinţi la un popor întreg pe degeaba!
Ajuns aici cu amintirile, sîngele îi năvăli din nou în cap zmeului, care se albaştri tot
la faţă. Turbat de furie, apucă străvechiul fier de călcat şi-l azvîrli cît colo. Si, ce să
vezi? Unde căzu fierul, se făcu un lac rotund, cu apa limpede şi scînteietoare, avînd
în mijloc o mîndreţe de insulă. Pe insulă, printre palmieri, eucalipţi, rododendroni,
yucca, sequoia şi codiţa-şo-ricelului, se ridica o măreaţă cetate în formă de fier de
călcat de pe vremea bunicii. Dinspre ferestrele ei zimţate de la etaj se auzea un cor
femeiesc suav, dulce şi atrăgător. Şuviţe de păr auriu fluturînd în vînt de la geamuri
nu mai lăsau nici o îndoială că în cetatea aceea trăiau cosînzene! Chiar ele cîntau,
chiar ele-l chemau, lasciv şi tînjitor, pe doftorul de pe celălalt mal. Zmeul dădu
roată lacului în căutare de vreo barcă, dar nu găsi nimic. Trase atunci văzduh în
piept si, din tot focul inimilor sale, suflă cascade de văpăi asupra valurilor, pînă ce
acestea secară pe o porţiune destul de lată ca el să poată trece, ţopăind (căci pe
fund erau scoici ascuţite si cioburi de sticle de bere), cu apele oprite grămadă la
stingă şi la dreapta lui. Doi ani de zile îşi croi drum prin jungla luxuriantă de
codiţa-soricelului pînă ce, într-o după-amia-ză cu soare blînd, ajunse la poarta
cetăţii.
78
Cetatea frigea. Felcerul blestemă de cîteva ori su-flîndu-si în gheara vătămată, iar
apoi înainta cu grijă pe coridoare, atent să nu se mai atingă de pereţi. De-o parte si
de alta a coridoarelor se aflau încăperi numerotate, cu uşile deschise larg. Fiecare
încăpere era de altă culoare, cu tapeturi înflorate pe pereţi, dar cu aceeaşi carpetă
(cîteva nimfe grăsuţe, cu sînii sidefii, stînd în tot felul de atitudini graţioase pe
malul unei ape albastre ca peruzeaua) pe zidul din spate, în fiecare cameră erau cîte
zece călcătorese ce mînu-iau vesele fiarele bătrîneşti, făcîndu-le să alunece peste
plătcuţe şi mînecuţe, fustiţe şi bluziţe, cearşafuri şi feţe de pernă, ocolind nasturii
cu grijă şi menajînd broderiile. Zmeul trase pe nări mireasma paradisi-acă si
înţelese că în fiare nu sfîrîiau tăciuni aprinşi, ci smirnă şi tămîie, ca în cădelniţe.
Nouă călcătorese blonde şi una roşcată se aflau în fiecare odaie. Cînd zmeul vîra
capul pe uşă, toate-i făceau prietenoase cu mîna, zîmbindu-i dulce, cu gropiţe-n
obraji.
— Probleme cu dantura pe-aici? întreba el, năucit şi fără noimă, căci fiecare
cosînzeană avea dinţişorii ca perlele. Iar fetele rîdeau, îl înconjurau si dansau în
jurul lui, înfăşurîndu-l în cearşafurile lor roze, parfumate şi cu volănase fantezi de-
a lungul tivurilor. Nouă sute patruzeci de cosînzene numără felcerul după ce urcă,
pe o scară în spirală, şi la etajul întîi şi doi ale cetăţii. Fireşte, cele nouăzeci şi patru
de roşcate erau inutilizabile, şi de altfel erau cele mai rele călcătorese, lăsînd pe
capotele şi camisole semilune cafenii de arsură. De aceea, doftorul Chung le izgoni
nemilos din cetate. Plînse, despletite, strîngînd la piept fierul de călcat, roşcatele se
refugiară la o margine a insulei, făcîndu-si o colibă din bîrne de codiţa-so-ricelului.
Şapte ani petrecu felcerul nostru în braţele cu firişoare de păr auriu ale
cosînzenelor. Răsfăţat ca un prunc, înfăşat în scutece florale, în satinuri şi
brocarturi împărăteşti, pudrat la încheieturi cu talcul cel mai fin, el domni fericit
peste labirintul de plete de aur în care, înmormîntat, ar fi vrut să-si sfîrsească zilele.
Cîntecele dulci, destrămate ca adierile, miresmele grele şi uleioase, atingerea
prelungilor degeţele roze ca aurorele făcură ca sufletul zmeului cu colţi să se
cufunde într-un abis de somnoroasă voluptate. Dar, vai! fericirea durează puţin,
după nepreţuita învăţătură a Animicştiutorului, care scria cu condeiul său de aur:
Renorocirea vine întotdeauna Exact în clipa cînd te loveşte.
Ducînd o viaţă aspră, înfruntînd zilnic balauri şi gărgăuni uriaşi, roşcatele deveniră,
cu trecerea anilor, adevărate amazoane, ce ştiau a mînui la fel de bine fussul şi
vatalla, arme nimicitoare, de vuia jungla de zgomotul lor. La sfîrşitul celui de-al
şaptelea an, cuprinse de beţia răzbunării, ele năvăliră în paşnicul castel al
79
plăcerilor. Talpa de fontă a fiarelor de călcat fu o pavăză mult prea slabă pentru
bietele cosînzene, care căzură într-o robie cumplită. Dezbrăcate de veşmintele lor
vaporoase, legate una de cozile celeilalte, fură îmbarcate în cinci corăbii şi
exportate, cu o stampilă CTC între omoplaţi, în cele mai îndepărtate colţuri ale
lumii. Doftorul, pe armura si-ntre solzii căruia se prinseseră atîtea fire lungi şi
blonde, că arăta acum ca un pămătuf de bărbierit, abia reuşi să scape cu viaţă,
trecînd înot pe malul celălalt. Scuturîndu-se de apă ca un cîine, o porni din nou,
agale, către casă.
— Of, Aachena, Abababarosa, Abogalibza, Absa-loma, Aburita, Accccccca,
Aciduzza, Acostata, Acu-ratezza, Acushacusha, Adrenalina, Adorrrmeeta,
Afostodata, Agîgga, Ahîhha, Alkatela, Amarcorda, Ambizioza, Amfibraha,
Amjurapahta, Ammora (cu aluniţa ta de pe şold), Amniotitrabuniculugontzyas-da,
Amurezata, Amuzzitta, Anala, Anagrama, Ana-pesta, Antebraţa, Anulata, Anumita,
Anunkkktata, Aoa, Aoolitta, Apendicita, Apraxiologista, Aroganta, Arroganta,
Arrroganta, Arpaleta, Asta (şi o uitasem pe sora ta geamănă Aia), Aţiţica, Aţuţulica,
Aurica, Auscultata, Avangarda, Avuabila, Axiona, Ayyaha, Ayubalanga, Azamcitita,
Azamdormita, Azazazaza, Baaaaaaaaaaaaaa, Baaba, Baalbeka,
Barbecua,Xulsolara, Yucca, Yumida, Yuzufa, Zurlia, Zutamena, Zutta, Zuveika,
Zuza, Zygomatica, Zîzzzania, precum şi tu, neuitată Gabi! gemea zmeul la
amintirea anilor de pe insulă, pe cînd străbătea munţi şi văi sub un cer de furtună.
Niciodată ochii mei n-or să vă mai vadă, niciodată organul meu prinţesoreceptor n-
o să vă mai savureze feromonii...
De necaz, zmeul trînti roata de bicicletă, pe care-o cărase tot timpul în spate
împreună cu cablul coaxial, de un picior de stîncă dezgolită. Unde izbi roata, se
făcu o gaură rotundă în stîncă, mare cît să poată trece nestînjenit un zmeu de
mărimea lui Chung. Leuca prinse să zvîcnească în pumnul zmeului, îndemnîn-du-l
spre noi aventuri. Ce noi prinţese si cosînzene i se vor mai dărui? Peste ce paiaţe cu
arhitrave de fildeş va mai domni netulburat? înaintînd greoi prin culoarul săpat în
stîncă, zmeul văzu cu uimire cum pereţii zgrunţuroşi, pe care curgea apa şi de care
se agăţau stranii insecte oarbe, se fac din ce în ce mai străvezii, pînă^ ajunseră la
culoarea si limpezimea safirului pur. în grosimea uriaşei pietre preţioase care-l
înconjura din toate părţile se vedeau prinse, ca gîzele în chihlimbar, fiinţe de basm
şi de vis, ce nu erau de pe această lume. Toate întindeau rugătoare braţele către
zmeu, toate încercau parcă să şoptească un acelaşi cuvînt, cu buzele lor
curcubeene. Tunelul se încîlcea tot mai mult, suia şi cobora, pînă ce deodată se
80
lărgi, dînd într-o măreaţă sală subpă-mînteană. Si aici pereţii erau cu totul şi cu
totul de safir orbitor, în mijlocul sălii se afla o grămadă de cinci coţi înălţime,
alcătuită din toate odoarele pămîntului. Ce nu găseai acolo? Lanţuri de aur şi de
argint, înnodate şi încîlcite de n-ar mai fi putut nimeni să le desfacă, pocale de jad
străveziu, săpat cu măiestrie, cupe de aur încrustate cu opale, cruci presărate cu
mărgăritare strîmbe, tiare episcopale cu ochi împrejur, de beriliu, taleri si icosari şi
guldeni şi florini si pistoli şi mahmudele din aur verzui, pumni de diamante, unele
cît nuca, risipite pe podea, coroane regale, cîrje papale, moaşte ferecate în argint,
inele cu pietre răsucite şi brăţări înfăţişînd crocodili. Lăţit ca o broască pe grămada
de scule preţioase zăcea un balaur obez, cu douăsprezece capete ce se holbau săl-
batic la zmeul oprit în prag, orbit de-atîta scînteiere. Din botul unuia ţîşni o limbă
de cameleon, care-l prinse bine de mijloc pe zmeu şi-l trase cu o putere grozavă
către botul plin de pumnale. Felcerul crezu că i-a sunat ceasul. Nu mică-i fu
mirarea cînd se trezi pus uşurel pe picioare în faţa balaurului, înfundat pîn-la
genunchi în grămada de bijuterii. Cele douăsprezece capete îl priveau binevoitor.
Al doilea din dreapta luă cuvîntul:
— Salutare, coane. Uite care-i treaba, o să intru direct în subiect. Eu sînt... mă rog,
noi sîntem Balaurul din peştera de safir.
— Am bănuit eu ceva, întrerupse destul de obraznic Chung, care-şi mai venise-n
fire.
— Cică misiunea noastră e să păzim grămada asta de...
— Vorbeşte cuviincios, se amestecă un cap din extremitatea opusă, în definitiv, e o
onorabilă grămadă de aur şi giuvaeruri...
— ...cu un moţ cît toate zilele! Urăsc, urăsc, urăsc toate farafastîcurile astea pentru
bogătaşi, cucoane şi popi! Proletari din toate ţările, uniţi-vă!
— Hai, lasă revuluţia, zise împăciuitor alt cap. Aşa e numărul doi, zavragiu nevoie
mare, explică el, după care reluă pe alt ton. Cică soarta noastră e să păzim
comoara. Păi o păzim, ce să facem, parcă putem să ieşim de-aici? Doar capetele
ne-ar putea trece prin tunel, dar nicidecum burdufu-ăsta, hipopotamu-ăsta de care
sîntem legaţi cu toţii... Numai tu, doctore, ai putea să ne-ajuţi.
— Da, numai tu, doctore! Ajută-ne, doctore! se milogiră în cor toate celelalte
capete. De o mie de ani te aşteptăm! Vai! O mie de ani pierduţi din viaţă!
— Ne-au mîncat tinereţea moşierii şi fabricanţii, gemu numărul doi.
— Bine, fraţilor, dar de unde ştiţi că sînt doctor?

81
— Păi eşti zmeu cu colţi, şi mai şi miroşi a amalgam dentar de la o poştă. Ia zi,
numărul opt, care era planul nostru?
— Uite, ne gîndeam noi dacă nu ai putea mata să ne separi, ştii, ca pe fraţii
siamezi, şi în loc de balaur să ne faci doisprezece şerpi, ca să putem scăpa o dată
din grota asta, să uităm de giuvaeruri...
— ...şi unul de altul, completară ceilalţi, nostalgici.
— Ce zici? Te învoieşti?
Zmeul se uită lung la trupul mătăhălos al balaurului. Apoi, şi mai lung, spre
grămada de comori, îşi compuse, ca la poker, o figură de nepătruns. Scoase o pilă
de unghii şi începu să-şi ferchezuiască fără grabă o gheară.
— How much? catadicsi să zică, nepăsător, într-un tîrziu.
— A, oricît, ia orice, ia tot, săriră cu toţii. Cît poţi căra în spinare. Ba te mai ajutăm
si noi!
Zmeul îi privi chiorîş:
— E puţin, stimabile. Uite ce e. Eu vă servesc doar aşa, că-mi place de voi. Da' să
fie clar cine e de-acuma şeful.
— Tu eşti, conaşule! strigă numărul şase, iar ceilalţi încuviinţară.
— Bun. Uite ce vreau eu de la voi. Mai întîi, toată comoara mi-o duceţi pîn-acasă.
— Ducem!
— După-aia, spuneţi chiar acum o poveste.
— Ştiai tu Zurba lui Zurbalan, zmăul din Quatr'a, îi şopti patru lui unu. Unu
începu, într-o tăcere solemnă. Zmeii, ca şi balaurii, nu iubesc nimic mai mult decît
vechile basme. Fremătară la noianul de aventuri povestite în nobil vers. Cînd
numărul unu termină, se lăsă o tăcere mare. Parcă întregul munte de piatră scumpă
rezona încă, neauzit. Tot doctorul Chung întrerupse clipa de meditaţie.
— Şi trei: mă veţi ajuta în planul meu de cucerire a lumii. Cu ajutorul vostru şi al
comorii din muntele de safir voi fi proclamat împărat al universului cu trei tuiuri.
— Trăiască măria sa, doftorul Chung! răcniră entuziasmate cele douăsprezece
capete.
Atunci, felcerul se puse pe treabă. Narcotiza bine balaurii cu leuca si apoi se
apucă să spintece marele trup la rădăcina gîturilor şerpeşti, înfăşură bine cu sfoară
cele douăsprezece fîşii tăiate, dîndu-le forma unor rulouri de carne însolzată.
Vindecă rănile cu tinctură de codiţa-şoricelului, adusă de pe insula căl-cătoreselor.
Cînd se treziră, cei doisprezece şerpi începură să mişune prin toată peştera, beţi de
bucurie. Luară în gură cîte giuvaeruri putură şi ieşiră cîte unul la suprafaţă. Ieşi şi
82
zmeul, încărcat şi el cu o grămadă de scule de preţ. Opriră în prima mare cetate
întîlnită pe drum şi cumpărară o oaste de mercenari, începură cucerirea ţinuturilor
din preajmă. Una cîte una, fortăreţele cădeau, asediate de puternicii şi înţelepţii
generali-balaur, care din păcate rămăseseră numai unsprezece. Numărul doi
răsculase masele populare în teritoriul cucerit şi trebuise sacrificat.
încoronat împărat al universului şi sătul de atîţia ani de pribegie, doftorul se gîndea
cu tot mai mult dor la micul lui cabinet dentar şi la soaţa pe care-o lăsase să-l
aştepte credincioasă atîta timp. încoifat şi-mplătoşat, cu pieptul plin de decoraţii,
însoţit de trompetişti şi paji muiaţi în fir, zmeul descinse, emoţionat, în ţinutul
natal.
Totul era acolo neschimbat: lichenii fosforescenţi, bălţile de mercur,
fermecătorii vulcani noroioşi. Stalactitele din tavanul îndepărtat. Ostenit, eroul
bătu la uşa cabinetului său. Deschise soaţa, şi ea neschimbată de trecerea vremii.
— Unde-ai fost, nenorocitule, atîta vreme? îl fulgeră ea cu privirile. Şi ce e cu
firele astea blonde pe tine, depravatule?
— Dragă, pot să-ţi explic..., se bîlbîi zmeul, simţind cum îl năpădeşte o sudoare de
moarte.
Dar consoarta, fără să mai asculte, îl sugrumă cu cablul coaxial. ZURBA

LUI ZURBALAN, ZMĂUL DIN QUATR'A


O1, Matrak, înstrună-mi lira, si sub bolta-nţurţurată Am să-l cînt pe cel mai
tare zmău care-a trăit vreodată,
Şi-a cui glorie crescut-a zi de zi si an de an. O, Matrak, dă-mi inspirare ca
să-l cînt pe Zurbalan! Si ofrandă-ţi voi aduce zece mii de prăpădiţi Preparaţi în foi
de dafin, la foc moale perpeliţi, Ardere de tot să-ţifie, si de un miros plăcut. Dar de
nu-mi dai iscusinţă, eşti la rîndul tău pierdut: O să-ţi ciopîrtesc statuia, n-o să te
cunoşti tu singur, O să fac din tine doniţi, greble, ciubere si linguri, O să uit a tale
imnuri, capiştea ţi-o voi prăvale, Cocină de porci voi face din bisericile tale! Preoţii
ce te slujiră am să-i taifişii cu lama, încît n-o să se mai ştie care-i tata, care-i mama.
Fii atent că nu ştiu multe, să nu zici că nu ţi-am spus! Hai, Matrak, înstrună-mi lira,
de-un nou cînt mi-e dor nespus!
Şapte sunt minuni, si şapte sunt planeţi, se zice,n-ceruri,
Şapte centre de putere înşirate, giuvaeruri, Pe coloana vertebrală, luminînd
curcubean. Şapte sunt cetăţi în vastul teritoriu subteran.

83
Iar din cele şapte una străluceşte între toate Cum întrece briliantul veştedele
nestemate: Este Quatr'a cea săpată în porfirul cel mai dur. Şapte ziduri uriaşe îi dau
roată împrejur.
Acolo, în Quatr'a sfîntă, se născu printr-un miracul Un pruncuţ de zmău ce
chipul îl avea ca însuşi dracul, Ochii răi, urechi ciulite, colţii îi ieşeau prin buze...
Vă închipuiţi mîndria norocoasei de lehuze. Cînd îl duse să-l închine la Matrak,
fără de preget Mititelul pe cel preot îl muşcă adînc de-un deget, Semn că, iată, în
cetate se născuse un erou! Cînd vru iar să îl închine, pruncul îl muşcă din nou.
Atunci popa-i dădu nume, înălţîndu-l pînă-n nori, Zurbalan, ce însemnează: „M-a
muscat de două ori." Si i-a profeţit: „Măi tată, nu te mai zmuci atît, Stai să-ţi spun
o viziune, scoate-mi ghearele din gît! Zurbalane, multe rele tu vei face pe pămînt,
Mulţi sub jetul tău de flăcări îşi vor da suflarea-n vînt, Multe urbe ai să dărâmi,
multe sate o să strici, Dar pieri-vei de cîntarea unei biete păsăricii" Ar fi vrut mai
mult să spună preotul cu creasta lată, Dară pruncul îi înfipse toţi caninii-n beregată
De abia putură zmăii să-i despartă, să-i împace.
Zurbalan crescu năvalnic printre bîte şi matrace. La concurs de buzdugane
era pururi locu-ntîi, îşi durase vizuina-n labirintele spăimîi Ale unei mlaştini
putrezi, cu păianjeni transparenţi Şi ţînţari cît cormoranii, învîrtindu-se demenţi.
Cele zece coarne-n ţeastă îi crescură de o palmă, Auzeai numai ocară,-
njurătură şi sudalmă Dacă-i pătrundeai în grotă, şi apoi îţi dădeai duhul De
matrakul lui năpraznic, care spinteca văzduhul.
Ce s-o mai lungim, voinicul se lăţise an de an Şi în umeri, si în faimă: toţi
ştiau de Zurbalan! într-o seară, pe cînd zmăul sta pe jilţu-i de opal Si mînca ficat de
zînă dintr-un craniu de zombal, Uite-o pasăre că intră pe fereşti de cuarţ şi-ifată
Drept în sîn la zmăul crîncen ouşor de ciocolată, învelit în poleială
zugrăvită-n alb şi ros. Precum ştiţi, Ia ouă „Kinder" chiar si zmeii-s
pofticioşi.
Zmăul nostru staniolul netezind uşor cu gheara Se văzu ca-ntr-o oglindă si
văzu în spate seara, Iar apoi muscă din coaja ce-i din lapte si cacao Ca să dea de
jucărie: „Ce-ofi? beţe de Macao? Vreun hipopotam de plastic? Insulă cu palmier?"
Zurbalan abia aşteaptă să îşi facă şantier Ca să asambleze-n pripă jucăria, micul
dar. Scoase din ovalul moale fluture de insectar Cu aripe colorate şi cu ochii de
safir. Fluturele îi şopteşte în amurg de serasir: „Zmău nebun, tu zaci aicea
îndopîndu-te ca porcul Cînd de ţara ta îşi rîde Făt-Frumosul, trolul, orcul Si-alte
multe lighioane! Sus, voinice, la război! Hai, ciobeşte buza lunii, fii erou între
84
eroi!" Zurbalan se scoală-ndată fioros ca urşii berci, Fluturaşul de-l striveşte chiar
în sîn, îl face terci, Si cum noaptea se lăsase, drept în lună el ţinteşte Si matrakul îl
aruncă pe orbită, voiniceşte, Pînă ce, după trei zile, el ştirbeşte cornul lunii.
Astfel Zurbalan devine campionul naţiunii.
Apoi grelele războaie cu duşmanii dimprejur
Le porni de unul singur, luxînd falei, rupînd femur,
Deşelînd pitici şi nimfe, spintecînd pe uriaşi, Opărind la foc de nare sat,
cetate si oraş. Scorpioni cu zece coade, Feţi-Frumosi cu stea înfrunte Pe turbatul
fiu al Quatr'ei nu cutează să-l înfrunte, Incit ne-ntrebăm cu ciudă, cum se-ntreabă
naratorii, Dacă tot aşa vom duce-o, din victorii în victorii, Pîn-la capăt. Din păcate
nici de data asta n-am Vreo ieşire mai ca lumea, decît tot cherchez la
femme...
Aşadar, cînd răsăritul îl prăda, ajunse zmăul
La Kokorro, cetătuie aşezată pe pîrăul
Limpede de-acid sulfuric, plin de peşti din marmuri moi.
Zurbalan ieşi din codru şi le declară război, în Kokorro stau de secuii
asiaticii, zombalii, Clinchetind inele-n colţii coloraţi ca şi vitralii, Rezistenţe şi
tranzistori tot lipind cu cositor. Rege le era pe-atuncea ne-nfricatul Hydro F0rr.
Regele avea o fată mîndră ca ofloare-n glastră, Cu trei coarne-n vîrfid teslei:
roşă, galbenă şi-albastră,
Dar la nazuri ne-ntrecută: nu răbda orice zevzec Ca să-i pună mîna-n jurul
taliei, la Thisko-Tekk, Că-l trăznea cu tamburina peste ochi de vedea negru. „Ah,
Matrak, cînd voi da oare de-un mascul frumos, integru
Si deştept, să-mi ceară mîna si să fiu a lui pe veci?" Se-ntreba mereu Elvilla
tot hrănind la lilieci. „Nimenea n-o să mă aibă pînă nu o să-mi aducă Pasărea
Distrugătoare ce trăieşte într-o nucă Si l-al cărei glas teribil se preface totu-n
scrum." Să îi cate păsărică s-au găsit voinici duium, însă care cum plecat-a, sî-a
lăsat a sale oase
Prin coclauri neumblate, prin prăpăstii fioroase Unde zuuuzele-mblănite i-au
găsit si le-au scos ochii, Ca dovadă de ce suflet stă în piepţii unei rochii... Zurbalan
plecă si dînsul, cu matrakul greu în circă, Si pe drum, pe înserate, el găseşte o
năpîrcă Ce îi strigă: „Fă-ţi pomană, zmăule, am însetat, Du-mă pînă lafintînă, că
altfel m-am curăţat!" Zurbalan zîmbeşte nobil, generos piciorul saltă Pe năpîrcă de-
o trimite drept pe lumea ceealaltă. Mulţumit de fapta bună, o luă prin codru lin.

85
Traversă un rîu de lacrimi, apoi altul de pelin. Sui muntele de sticlă şi în
vîrfgăsi o casă, Lîngă ea un nuc cu frunza palidă si viermănoasă, Ce nu da nici pic
de umbră, parcă n-arfi existat. Nucile-n cămaşă verde putrezeau în înserat. Zmăul
s-apucă de trunchiul nucului, ca să-l smucească Dar era numai stafie, nu tu sevă, nu
tu iască, Aer doar strîngeai în braţe. Cătrănit, săltă matrakul Şi lovi cu duşmănie,
dar atunci dădu de dracul, Fiindcă gheoaga străbătuse prin copac, lovise-n sol Şi
zvîcnise drept în capul zmăului. Sună a gol Ca un clopot de aramă. Zurbalan căzu
în dos Şi văzu printre steluţe un bătrîn politicos Ce ieşise din căsuţă. „Ce e, cine
eşti mata?" la, un moş acolo, gîrbov. Dacă ţi-este voia-aşa Animicaştiutorul poţi să-
mi spui. Şi chiar aşa e, Am ştiut odată totul, şi-am văzut că-ifoc de paie Tot ce ştii
si tot ce este. Acum nu mai ştiu nemica, Doar mă bucur cum se suie pe sumanul
meu furnica Şi cum zboară funigeii licărind în cerul gol.
Oh, măreţ este nimicul ce dă lumilor ocol!
— Moşule, ia lasă vorba şi mă-nvaţă cum să sui între crengile aceste pîn-la nucile-
amărui,
Că într-una dintre ele pitulată-i, mi se pare, Pasărea Apocalipsei, Pasărea
Distrugătoare!
— Zurbalan, acea fiinţă nu e de pe lumea noastră. Ţi-a cerut-o o zmeoaică dulce ca
o floare-n glastră? la gîndeşte: ce îţi cere orice fată şi-orice floare? Dragostea e,
Zurbalane, Pasărea Distrugătoare! Dacă n-ai avut să-i dărui dragoste, de eşti uscat
Ca şi nucul ăsta care în veci umbră nu a dat, Dacăflutund ucis-ai, dacă ai strivit
năpîrcă, Poţi să fii voinicul lumii, dar în viaţă ai dat zbîrca...
— Moş nebun, înşiri la vorbe aruncate cu toptanul. Dragostea? Cum se mănîncă?
Mi-e năpraznic buzduganul
Si toţi tremură, se-ndeasă să îmi intre-n orice voie, Mă respectă ca pe-un
rege, de amor nu e nevoie. Chiar Elvilla,-nchipuita, o să-mi zică doar „stăpîne",
Smirnă o să stea nainte-mi, o să-mi lingă aste mîne, Că altfel întorc eu foaia. Ce
mai stai? Dă-mi ajutor Să mă urc în nuc, că altfel una-două te omor!
Vîjul ridică alene genele ce-s lungi de-un metru
Cu toiagul, dă pe spate pălăria cea de fetru
Şi un semn făcu din deget. Crengile atunci se lasă
Iară nucile căzură prin otava de mătasă.
Zurbalan cu buzduganul le zdrobeşte cîte una
Şi din ele el moşeşte cerul, stelele şi luna
Unei alte lumi, cu lacuri limpezi şi nisipuri de-aur,
86
Lume-n care stau alături o licornă şi-un centaur,
Smălţuit blazon ce-n vise îţi apare doar, cînd eşti
însetat de armonia tandră-a sferelor cereşti.
Doar o nucă mai rămase. Zurbalan o-nşfacă-n gheare
Şi cu colţii o sfîsie. Pasărea Distrugătoare
Se iveşte în haloul dragostei: un glob de foc
Orbitor, cu pîlpîire ca de cuarţuri în mijloc
Si în lumea ideală izvorăşte mii de raze Pe licornă si centaur, peste luncile-n
extaze... Buzduganul se topeşte si începe ca să curgă, Zmăului în ochii capii viaţa
prinde să amurgă, Că în ochi de lighioane, de mişei, de proşti, de fiare Dragostea
dumnezeiască-i Pasăre Distrugătoare...
Pe cel zmău îl vezi si astăzi, dacă ţi-este dor de dînsul, Sus, în vîrfde stei de
piatră, jalnic de te-apucă plînsul, împăiat cu zegras, ochii două cioburi reci de stras,
Buzduganul sprijinindu-l pe un mic iconostas Unde-au scrijelit elevii (vandalism si
nesimţire) Trei cuvinte:

POVESTEA ANIMICSTIUTORULUI
Ln îngîmfarea şi prostia Iui fără margini, Zurbalan uitase ceea ce pînă şi un
bătrîn ştie, că Ani-micştiutorul nu vorbeşte, sau cel puţin nu ca zmeii de rînd. Vîjul
cu gene atît de lungi încît trebuia să le ridice cu toiagul era mulţumit de lecţia pe
care-o dăduse zmăului, dar se simţea totuşi puţin ruşinat de înşelăciune. „O,
Animicştiutorule, iartă unui biet Om-de-flori-cu-barba-de-mătase că ţi-a luat
numele în desert!", murmura el pe cînd se întorcea în colibă. Acolo se aşeză pe o
laviţă şi rămase pierdut, con-templînd pe fereastră munţii albaştri din zare. Totul,
totul în lunga sa viaţă, care-i trecea acum prin faţa ochilor, fusese legat de chipul
mereu pierdut şi mereu întrezărit al Animicştiutorului.
Omul-de-flori-cu-barba-de-mătase, ce răspundea la numele de Umbello
(cum îi vom spune de-aici înainte), se născuse, asemenea tuturor celor din neamul
său, în vîrful unui munte de sticlă, atît de alunecos că nu-l putea nimeni urca si atît
de străveziu încît puteai vedea, în miezul său, un uriaş prunc nenăscut, ghemuit ca
într-un pîntec de mamă. Părinţii lui Umbello, plecaţi după hrană, fuseseră într-o zi
prinşi şi ucişi de nişte orei sălbatici. Micuţul îndurase o foarne crîncenă şi, cînd nu
mai putu răbda, se lăsă să alunece la vale pe o pantă a muntelui. Ajuns jos, o porni
şchiopătînd prin înspăimîntătoarele crîn-guri de licheni fosforescenţi, fojgăind de
insecte oarbe. Din fericire pentru el, trecu pe deasupra un zmeu al zmeelor, tocmai
87
la timp ca să-l scape din fălcile unui mare păianjen cavernicol. Umbello prinse
funia aruncată si se înălţă sub stalactitele bolţii. Trecură peste un lanţ de vulcani
activi, dincolo de care se ivi o cetate. Zmeul zmeelor coborî cît să-l lase pe micul
om-de-flori la pămînt si se-ndepărtă iarăşi în zbor pînă nu se mai văzu.
Umbello intră în cetăţuie, care era a zmeilor mioritici, şi rătăci toată ziua,
înfometat, pe străzile ei. Pe seară se aşeză abătut pe o bordură, privind forfota de
fiinţe cu solzi si fioroase buzdugane ce intrau în prăvălii şi se opreau la sfat, la cîte-
un colţ de stradă. Un vagabond cu cioarecii rupţi se aşeză alături de el.
— Ehe, grea e viaţa, măi, puştiulică, intră el în vorbă, stîlcind cuvintele din cauza a
o mulţime de colţi lipsă. Umbello nu răspunse nimic, dar burta îi ghiorăi atît de
tare, că şi acesta fu un răspuns.
— Ştiu, nepoate, ştiu, acelaşi sentiment metafizic îl am şi eu.
— Cum? Micuţul îl privi chiorîs pe vagabond.
— Adică mor de foame, ca să zic aşa.
— Nu, asta am înţeles, da' ce-nseamnă, nene, cu-vîntu-ăla, mate-fizică, sau cum i-
ai zis?
— Asta nu-i de mutriţa ta, măi pustiule. Uită-te la mine cum mi-au ieşit solzii prin
căciulă: e din pricina afurisitului ăstuia de cuvînt, aşa să ştii. Mai bine, hai cu mine
să scăpăm de pîrdalnicul de gol în stomac.
Cu inima cam îndoită, Umbello plecă de mînă cu vagabondul pe nişte uliţe
întortocheate pînă ce, la marginea cetăţii, sub zidul de apărare pe care trona ditamai
catapulta, dădură de o căsuţă împrejmuită cu gard. Săriră gardul şi nimeriră într-un
grajd în care omuleţul-de-flori recunoscu o gorgonă. Era un fel de vacă, atît de
mare, că umplea grajdul pînă sub acoperiş. Avea culoarea albastru ultramarin şi
coarne dintr-un metal alb ca argintul, între picioarele dindărăt avea un uger uriaş cu
patru ţîţe: una roşie, una neagră, una verde si ultima albă. Umbello îi văzuse poza
într-o carte din care-i citea, pe vremuri, mama lui la culcare, aşa că ştia la ce
trebuie să se aştepte. Se-nălţă pe vîrfuri ca să ajungă la ţîţa cea neagră, despre care-
si amintea că trebuie să fie cea cu sirop de zmeură. Scuipă imediat şi se şterse
caraghios pe limbă, căci dădu de un vin puterea ursului care nu-i fu nicidecum pe
plac.
— Micuţule, zise cu blîndeţe gorgona, privind către el cu ochiul ei de junincă, te-aş
sfătui s-o încerci pe cea roşie. De fapt, principiul e simplu: culoarea îţi arată
conţinutul.

88
— Mulţumim de explicaţii, doamnă, spuse politicos în locul lui Umbello
vagabondul, care se-apucă imediat să tragă vîrtos din ţîţa tocmai părăsită de cel
mic. Se înfruptară pe rînd din lapte, vin, sirop şi sevă de roua-spadei, pînă ce se
întremară cu totul. Cei doi se tolăniră pînă la urmă în paie, cu capetele sprijinite de
şoldul gorgonei, care rumega liniştită, înveselit de vin şi fără chef de culcare,
zmeul mioritic începu să-i vorbească lui Umbello despre cîte-n lună şi-n soare.
— Nepoate, să ştii că, aşa cum mă vezi, pîrlit şi amărît, nu mă dau pe zmeul
frumos şi viteaz care-am fost odată. E drept că acum rîd toţi de mine, dar nimeni
nu ştie ce ştiu eu. Nimeni nu l-a văzut pe el... pe el...
— Pe cine, nene?
— Nimeni nu i-a sorbit nesfîrsita înţelepciune, continuă zmeul fără să-l ia-n seamă.
Si cînd mă gîn-desc cît de neaşteptat a-nceput totul... O dată, trecînd pe lîngă nişte
rubedenii care pierduseră un sac de scalpuri, am auzit o zmeoaică grăind: „Eh,
degeaba mai bocim atît, căci e după cum grăit-a Animic-ştiu torul:
Ce este. este
Şi ce nu este, nu este.
Cînd am auzit vorbele-astea, am rămas împietrit: toată înţelepciunea lumii
mi se părea adunată în ele. Am lepădat într-o clipă scutul şi buzduganul şi mi-am
închinat viaţa gîndirii la aceste două versuri. Nici pînă azi nu le-am atins
străfundurile.
— „Ce este, este, şi ce nu este, nu este", repetă înfiorat si Umbello, simţind si el că
acea noapte îl va schimba pentru totdeauna.
— Cine este Animicstiutorul? întrebă el, tot numai urechi.
— L-am văzut o singură dată, şi-atunci în vis. Dar si atît e prea mult. în visul meu
se arăta un munte înalt pîn-la cer. Dar nu aici, sub ţurţuri, ci la Suprafaţă, unde se
zice că totul e acoperit de un fel de clopot din cel mai curat safir. Se zice că acolo
iarba e verde (deşi mi se pare cam exagerat) şi că prăpădiţii au şi ei oraşe ca şi noi
(scorniri de-ale călătorilor, probabil). Acolo, în munte, mi s-a arătat un gheţar
măreţ şi, în gheţar, o mare bulă de aer, cît o casă cuprinzătoare. „Eşti pe Acoperişul
Lumii", mi-a şoptit o voce dulce-n ureche. Acolo, în miezul globului de aer, l-am
văzut: mare copil gol, cu ochi limpezi de diamant, avînd într-o mînă Toiagul cu
Urechi şi încălţat cu ghetele de plumb. Privea prin peretele lui de sticlă, pe rînd, la
cîte un lucru din lumea de-afară: o pasăre, o vulpe albă, un arbore de tisă. Cînd îl
atingea privirea lui, lucrul scînteia, culorile i se aprindeau, şi vulpea sau arborele se
desprindeau dintre celelalte forme şi începeau cu adevărat să existe. Oricît de
89
departe ar fi fost, le puteai acum atinge, mirosi, gusta chiar, de parc-ar fi fost lîngă
tine. Mie doar o privire mi-a aruncat, într-un tîrziu, şi-a fost de-ajuns ca să mă
trezesc. Am crezut că-nţeleg tîlcul acestei vedenii: Animicstiutorul trăieşte acolo,
în împărăţia visului, de unde ne scoate la iveală doar cu privirea. Orice lucru există
pentru că el îl priveşte. Cînd el nu-l mai priveşte, lucrul dispare. Toţi, toţi am venit
pe lume scoşi dintr-un vis de privirea lui... Cerşetorul rămase tăcut, iar apoi
Umbello înţelese că probabil Animicstiutorul nu-l mai privea, căci moşul
adormi curînd şi începu să sforăie năpraznic. Umbello rămase multă vreme treaz.
Apoi, din toată inima lui, înălţă o rugă către ţurţurii bolţii: „Stăpîne, oricare ar fi
numele tău, fă ca în această viaţă să ajung să-l întîlnesc! Fie ca tu să mă fi adus pe
lume doar pentru clipa întîlnirii cu Animicstiutorul! la-mi tot, tinereţe şi sănătate,
dar dă-mi răcoarea privirii lui de diamant!"
Oamenii-de-flori-cu-barba-de-mătase sînt atît de fragili, încît fără ajutor
divin n-ar putea să trăiască în lumea teribilă a zmeilor. Ei nu au arme şi nu fac
vrăji, dar zeii îi iubesc şi le fac daruri, în clipa cînd şi-a terminat rugăciunea,
Umbello a simţit o apăsare dulce în palma stîngă. Era o perlă mare cît o portocală,
de consistenţa unui dinţişor de fetiţă, lucind cînd cenuşiu, cînd trandafiriu în
întuneric, în zilele care urmară, Umbello învăţă repede să folosească perla. Era
destul de simplu: o ţineai în amîndoi pumnii, suflai asupra ei, îi spuneai o
poezioară sau o glumită ca să o-nveseleşti, şi deodată simţeai cum se dezghemuie
ca un arici si devine moale, cu muşchi şi oscioare sub pieliţa de sidef, în cele din
urmă scotea un botisor şi trei corniţe cu ochi în vîrf, ca de melci, cu care se uita
curioasă în jur. Ondulîndu-şi carnea perlată, se plimba pe umerii lui Umbello, se
făcea uneori colier la gîtul lui, iar alteori i se suia în creştet ca o creastă ciudată.
Umbello numi mica fiinţă Hilozois (după numele unui vechi poet). Mari puteri
zăceau în ea. Te făcea nevăzut sau invincibil în luptă, te făcea fericit şi, cînd te
saturai de fericire, îţi trîntea şi cîte un mic necaz, pentru variaţie, Cînd, ghemuită
din nou, plutea la o palmă deasupra capului tău, puteai fi sigur că dorinţele ţi se-
mplinesc.
Ani de-a rîndul, cei doi cutreierară lumea, între-bînd şi căutînd. Cea mai
umilă urmă care-ar fi putut duce la Animicştiutor era nepreţuită pentru ei. în curînd
în jurul lor crescu o adevărată caravană. Sute de zmei ai zmeelor planau deasupra
lor, căutînd urme ale cizmelor de plumb. Patruzeci de zmei suri de văgăună îi
urmau, cărînd în cîrcă uriaşe cufere cu toate proverbele ce erau atribuite marelui
înţelept. Umbello le citise pe toate şi dăduse deoparte, pe rînd, vrafuri întregi de
90
falsuri grosolane. Adevăratele gînduri nemuritoare erau atît de puţine, că puteau
încăpea într-un caiet micuţ. Si toate puteau fi topite pînă la urmă în proverbul de la-
nceput:
Ce este. este
Şi ce nu este, nu este.
Umbello încărunţi, şi frumoasa lui barbă de mătase, odinioară castanie ca
pletele stiuletelui de porumb, deveni albă ca o încîlceală de funigei. O tristeţe
blîndă îi aburea ochii: spera tot mai puţin să ajungă vreodată în preajma
înţeleptului, pe care totuşi îl simţea atît de aproape. Numai Hilozois rămînea veşnic
tînără şi jucăuşă. Glob de sidef plutind deasupra creştetului, ea lumina partea cea
mai întunecată a lumii noastre: viitorul. Ea îl călăuzea pe Umbello pe drumuri ce
păreau alese la-ntîmplare, dar care la urmă îşi vădeau tîlcul ascuns, întîmplător să fi
fost că pînă la sfîrşitul vieţii el trecuse prin toate spaţiile lumii, din subteran si de la
suprafaţă? Că întîlnise toate neamurile de zmei, ca si celelalte neamuri ce
împărţeau pămîntul? Că desenase pe mari planşe toate animalele si toate plantele,
de la puricele de baltă pînă la enormii caşaloţi şi de la delicatul muşchi al copacului
pînă la eucalipţii măreţi? Că ştia acum să prevadă eclipsele şi să măsoare distantele
pînă la aştri? într-o seară adormi si visă şi el visul cerşetorului. Pluti si el prin
văzduhul albastru si curat, ca după ploaie, pînă la uriaşii munţi din depărtare. Plană
şi el, fără trup, pe deasupra crestelor înzăpezite, pînă văzu sclipirea ca de foiţă de
aur a gheţarului în soare. Alunecă peste limba de gheaţă străvezie, care-i aduse
aminte de dragul lui munte de sticlă, cu pruncul cît douăzeci de elefanţi ghemuit în
mijlocul lui. Dar în marele gheţar din Himalaia nu zări doar o bulă de aer, precum
bătrînul zmeu mioritic, ci sute, mii de globuri, fiecare cu copilul minunat înăuntrul
său. Erau si fetiţe, şi băieţi, goi si strălucitori, cu ochi de briliante, purtînd în mîini
toiagele cu urechi şi încălţaţi cu cizmele de plumb. Si deodată marile băşici de aer
începură să urce la suprafaţă, ca prin apă, de-formîndu-se si sclipind, pînă ieşiră şi
se-năltară asemenea a mii de baloane de săpun curcubeene. Vîntul le-mpinse-
ncoace şi-ncolo, le aşeză pe plaiuri înverzite, pe pajişti şi pe creste, si unde
atingeau pămîntul se topeau în binecuvîntarea lui, si atunci pămîntul prindea
realitate, totul se colora violent si cojile lucrurilor celor mai netede prindeau să
vibreze la pipăit,de parcă un desen ar căpăta deodată volum si viaţă adevărată. O
fetiţă coborî lin chiar în faţa lui Um-bello, pieliţa balonului pieri si ea întinse braţul
către el, atingîndu-l cu toiagul din mînă. Omul-de-flori se prăbuşi deodată în corpul
său adormit.
91
Trecerea vremii, care nu iartă pe nimeni, îl gîrbovi. Genele-i crescură,
năpădindu-i ochii. Ajunse-ntr-un tîrziu în vechea cetate Kokorro, unde regele,
uimit de suita sa pestriţă, îi dădu găzduire. Omul-de-flori îi arătă planşele sale,
coliviile cu păsări nemaivăzute, terariile cu tuute veninoase, lăzile cu minerale şi
flori de mină atît de frumoase că te făceau să plîngi, iar regele Hydro F0rr, la rîndul
său, îl conduse el însuşi prin halele în care zmeii asiatici, în halate albe şi cu mască
medicinală pe feţe, lucrau la minusculele circuite imprimate, în tăcerea acestor hale
unde nici un fir de praf nu putea pătrunde se auzeau din cînd în cînd clinchetele
armonioase ale ineluşelor din canini, prin care zombalii comunică. Uneori, cîte
unul din ei se dădea tumba pe coridor şi-apoi scădea văzînd cu ochii, pînă ce doar
la microscop îl mai puteai privi. Dacă te uitai prin lentila de sticlă, îl vedeai
umblînd pe firişoarele de staniu, reparînd vreo liţă de aur ruptă de la un
microprocesor sau căţărîndu-se pe picioruşele unei rezistente vărgate de linii
galbene, verzi şi roşii. Revenea apoi, crescînd, în lumea noastră, ca şi cînd nimic
nu s-ar fi întîmplat.
Regele-i dădu o căsuţă în vîrful unui munte de sticlă, lîngă un nuc ce nu
arunca umbră. Acolo medita îndelung la perla perfectă a vieţii lui, înconjurată de
noapte de parcă ar fi fost etalată pe o perniţă de catifea neagră. Acolo re văzu toate
locurile şi faptele copilăriei sale, apoi ale adolescenţei, maturităţii şi adîncii lui
bătrîneţi. Si fiecare dintre aceste locuri şi fapte, atinse de ochiul mintii lui, scînteia
în culori aprinse şi vii, în miresme îmbătătoare şi-ntr-o cascadă de sunete
curcubeene. Acolo stătea el acum, cu obra-jii-n palme, cu viaţa împlinită ca un
fruct copt, privind pe fereastră către munţii albaştri. Hilozois dormea încolăcită sub
apăsarea palmei lui stîngi. Bătrînul îi simţea pielea minerală dar caldă, abia vibrînd
de un tors mulţumit. Deodată îl năpădi lumina tomnatică a morţii şi, înfiorat, simţi
nevoia de tovărăşie. Luă animăluţul în palme, îl ridică spre faţa sa zbîrcită şi-i şopti
încetişor:
Hilozois, Hilozois, Singurei pe lume doi-s: Moş bătrîn cu barba moale Si-o
fetită ca matale. Hilozois, Hilozois, Vino pe genunchi ce moi-s, Cornuleţe lungi îţi
scoate, Fii poznaşă cît se poate, Norii suflă-i, ce cu ploi-s, Hilozois, Hilozois...
Perla se muie încetişor, dar de data aceasta nu se mai ivi din cărniţa ei sidefie un
botic cu mustăţi, ci prin coaja moale ca de ou de broască ţestoasă începu să se
străvadă ceva ca o inimă pulsînd. Pe măsură ce coaja devenea mai transparentă, se
vedea tot mai bine o fiinţă mică şi ghemuită, aidoma la înfăţişare celei din muntele
de sticlă. Sub ochii uimiţi ai vîju-lui, pruncul crescu, umplu coaja, o sparse si se
92
ridică uşurel în picioare. Creştea văzînd cu ochii, pînă ajunse să semene cu copiii
cu pleoape de diamant din globurile de aer, apoi cu altcineva, pe care Umbello îl
ştia bine, dar îl uitase de atîta amar de vreme. Copilul era acuma adolescent, apoi
un bărbat frumos cu barbă de mătase, si nu trecu multă vreme pînă ce spinarea
i se-ncovoie si în sprâncene apărură firele albe. După alte cîteva clipe doi Umbello
stăteau faţă-n fată, cel de-al doilea avînd în plus toiagul cu urechi în mîna dreaptă
şi cizme de plumb în picioare.
Bătrînul înţelese într-o clipă totul. Perla vieţii lui era acuma întreagă. Visul
vieţii lui era încheiat. Mulţumi necunoscuţilor zei pentru darul nepreţuit ce ne este
făcut tuturor: splendoarea fără margini a vieţii, închise apoi pleoapele si nu mai ştiu
nimic.
POVESTEA LUI DING-DING, PROGRAMATOAREA
Ce mai caută şi moşulică ăsta să ne-ncurce pe-aici? II caută moartea pe-
acasă şi el — unde se găseşte să fie? Taman în laboratorul nostru, unde nu pricepe
oricum nimic..., bodogănea Mol-loch, unul dintre electronişti, la trecerea regelui cu
Umbello. Apoi se dădu, nemulţumit, de trei ori peste cap şi se micşoră pînă la
dimensiuni microscopice, nu pentru că ar fi fost cu adevărat nevoie, ci, probabil,
mai mult ca să scape de chipul nesuferit al regelui Hydro F0rr. La ultima alegere
votase cu opoziţia.
Ding-Ding, programatoarea, strînse uşor din buze. Nu aprecia felul acesta de
exprimare la adresa bătrî-nilor, fie ei regi sau nu. Iar Mol-loch, cu veşnicele lui
zîmbete mieroase, cu nesuferitul fel de a-i face curte, cu încercările repetate de a o
vrăji (de cîte ori fata nu găsise pe birou, sub birou, în sertare şi unde cu gîndul nu
gîndeşti cerceluşi, poşetuţe, panglicute şi broşuţe, doar-doar o întinde mîna spre
una din ele pentru ca zmeul să-i trimită în pîntec vîrtejul de flacără portocalie),
depăşise în ultima vreme orice măsură. „Faci tu fiţe, dar tot a mea o să fii", îl
auzise într-o zi murmurînd. De-atunci nici să-i vorbească nu mai catadicsea.
Ding-Ding era o zmeoaică delicată, cu dinţi frumoşi, sculptaţi cu floricele şi
steluţe, şi cu solzi de sticlă gălbuie pe gît. Trăia singură, căci viata în harem i-ar fi
fost insuportabilă: statistic, la fiecare zmeu asiatic reveneau 2,14 zmeoaice. Cum
să-ţi împărţi soţul cu alte 1,14 ţipe? Hai, cea întreagă ar mai fi mers cum ar mai fi
mers, dar restul ce-ar fi fost? Un braţ, o pulpă, un pîntec cu buric împodobit cu
lănţişor, o fesă? Ding-Ding se cutremurase întotdeauna la imaginea zmeului iubit,
cu o mînă ţinînd-o după mijloc, iar în cealaltă cîntărind tandru o ciozvîrtă de
muiere. Aşa că alesese singurătatea, ca multe alte zombăliţe, si din această pricină
93
rasa se stingea cu încetul. Singurele satisfacţii le avea la slujbă, unde mînuia let-
conul cu atîta graţie încît părea, în mîna ei, o baghetă de zînă.
Acum lucra la un joc video complicat, care-i luase cîteva luni de
programare, si de care încă nu era mulţumită. Ca să construiască universul în care
urmau să aibă loc aventurile, frunzărise zeci de enciclopedii, manuale şi dicţionare.
Desenase mii de schiţe, decoruri măreţe, personaje impunătoare, monştri înspăi-
mîntători. Animase fiecare frunză din codru, fiecare firişor de păr de pe braţul
eroilor. Inventase apoi regulile jocului, arme şi capcane, dar, tocmai cînd se aştepta
ca totul să funcţioneze ca într-o lume adevărată, se întîmplase ceva şi jocul ei
devenise o aiureală. După ce regele si Umbello ieşiră, Ding-Ding căzu pe gînduri.
Ştia foarte bine ce era de făcut, dar îi venea atît de greu! „Ei, Ding-Ding, îşi zise în
cele din urmă, sus inima, ce naiba! Chiar dacă te duci pe copcă, atîta pagubă! Dar
poate că şi de data asta bunul 6 ™nV8^%o£2/3ooî o să te-ajute."
Şi fata se ridică brusc, ca să nu mai aibă timp să se răzgîndească, si se rostogoli de
trei ori pe culoar. Lucrurile în jurul ei începură să crească. Biroul deveni
o mare bazilică, scaunul o clopotniţă pînă la cer. Bucla agrafei de pe podea îi
ajunse pînă la brîu. Acum toate lucrurile erau departe, iar podeaua era un deşert
uriaş, zgrunţuros, cu văi şi dealuri altădată neobservate. Trebui să meargă zile-n şir
pînă ajunse la muchia compact-discului cu jocul, pe care-l aşezase dinainte pe
podea, în muchia nespus de înaltă erau săpate trepte, pe care minuscula Ding-Ding
le urcă încă un timp nesfîrşit. Cînd, adunîndu-şi ultimele puteri, reuşi să se ridice
pe suprafaţa netedă a discului, se petrecu minunea care o speriase atît de tare în
prima ei călătorie virtuală, dar care acum i se păru chiar plăcută. Un fulger brusc o
izbi şi-o prefăcu-n pulbere, pulberea-n cifre si cifrele-n pixeli coloraţi. Se simţea
acum mai uşoară si mai pură. De-acum nu mai trebuia să mănînce şi să doarmă.
Pe suprafaţa discului, nu foarte departe, se zărea marginea unei păduri. Ding-Ding
se îndreptă într-a-colo, şi curînd străbătea codrul cu arbori seculari, ce-şi înfigeau
rădăcinile în plasticul transparent, încet, şi acest plastic dispăru, acoperit de pămînt,
iar printre crengi nu se mai văzu, la o enormă depărtare, tavanul laboratorului, ci
un cer azuriu ca o piatră preţioasă.
Cît de ciudat era să umbli prin locuri închipuite şi desenate de tine! Să
cunoşti fiecare bulgăre de pămînt şi fiecare fiinţă vie... Uite, ciupercuţele astea
delicate le desenase sîmbăta trecută, iar acum erau vii şi fragede, cu un strop de
rouă pe pălărie. Sau uite strigoaica ghemuită pe creanga de copac... Dar Ding-Ding
nu mai apucă să-şi ducă gîndul pînă la capăt, că mica strigoaica sări cu agilitate de
94
pe creangă drept în capul fetei si-o apucă de ureche cu cleş-tisorul, făcînd-o să ţipe
de durere.
— Hei, ce-i asta, dă-mi drumul, strigă zmeoaica luptîndu-se s-o dea jos. Tu trebuia
să fii blinda! Toate strigoaicele sînt blînde, că doar aşa v-am făcut.
— Eu nu, îi răspunse telepatic animăluţul, făcînd o mutră fioroasă.
— Noi nu, urlară în graiul lor sute si sute de păianjeni, miriapozi, harpii, tuute,
zuuuze, fiuuuuuse, ţiuuuuuuuuuuuuuure si miuuuuuuuuuuuuuuuu-uuuuuune,
răsărite deodată ca din pămînt. Mişuna codrul de ele, şi toate se apropiau mîrîind şi
fluierînd de biata Ding-Ding, care-o luă la fugă cît o duceau picioarele, cu hoarda
de bîzdîgănii furioase după ea. „Doamne, ce imaginaţie bolnavă am, ce mi-o fi
venit să le născocesc pe toate?" îşi spunea ea gîfîind, dar era cam tîrziu pentru
regrete. De fapt, era tîrziu pentru orice. Din clipă-n clipă avea să fie ajunsă si
făcută bucăţi-bucăţele. Cînd prima cange de harpie i se-nfipse în platoşă şi prima
fiuuuuusă i se-ncolăci de picior, deodată disperata Ding-Ding zări în faţa ochilor,
cobo-rînd din cer, un capăt de frînghie, pe care-l apucă aşa cum cel ce se-neacă
apucă si-un pai, si fu ridicată brusc în văzduh. Privind în sus, zări vreo două duzini
de zmee feerice şi pestriţe, cu cozi împopoţonate cu panglicuţe, iar deasupra lor
unul uriaş, în formă de fluture tropical. Atîrnat de ele, îi făcea semne cu mîna un
zmeu micuţ si rotofei, bine cunoscut tinerei zmeoaice.
— Lobo, nebunule, strigă ea plină de bucurie, ţi-nîndu-se bine de funie. Zmeele îi
purtau peste sate şi lanuri de grîu pîrguite. In depărtare se vedeau munţii, pierduţi
în ceţuri albastre. Dar multe sate erau în flăcări, din multe fîntîni ieşeau aburi verzi,
mirosind înţepător, şi nori deşi de lăcuste întunecau soarele, în cîte-o mlaştină se
zăreau oşti măcelărindu-se una pe alta şi se auzeau strigăte de ajutor. „Ce se-ntîm-
plă, Dumnezeule?" se-ntrebă dezolată zmeoaica.
Se lăsară lin pe vîrful unui deal, lîngă o turmă de oi cu lîna arsă şi încîlcită.
Ding-Ding îşi îmbrăţişa salvatorul (care-i venea cam pînă la brîu), scoase creionul
şi guma şi-i îndreptă un pic trăsăturile, iar apoi se aşezară la sfat. Lobo îi povesti că
de la o vreme sosise în lumea lor un trol rău, care construise spre centrul găurit al
compact-discului o cetate, pe care-o numise Castelul Negru. De-atunci totul era cu
susu-n jos: norii luminau, din soare ploua, florile muşcau, iar zmeii se dedau la tot
felul de blestemăţii care-nainte nici nu le trecuseră prin cap.
— Şi ce-i de făcut? întrebase după un timp Ding-Ding, care vedea cum munca sa
de luni de zile se ducea de rîpă. Cine să fi fost trolul ăsta pe care ea nu-l
programase? Si de ce făcea atîta rău?
95
Lobo se scărpină-n cap.
— Pe trol nimeni nu poate să-l înfrunte de-a dreptul. A-ncercat pînă şi Zurbalan,
dar s-a ales cu şalele frînte. Prost cum e, a vrut să dărîme stîlpii porţii de la castel,
şi l-a trăznit o vrajă de umbla apoi după popă şi luminare. Dar am auzit ceva...
cumva...
— Ceva, cumva? întrebă nerăbdătoare zmeoaica.
— Ceva... cumva... repetă Lobo cu o privire vicleană, îţi spun dacă... dacă o
lungeşti puţin pe Grun-hilda. Uite, am zis-o. Măcar cu vreo zece centimetri...
— Lobo, nu fi ticălos, răspunse severă Ding-Ding. Toate poveştile rămîn cum am
stabilit. Zi imediat tot ce ştii.
— Bine, oftă Lobo. Am încercat şi eu marea cu degetul... Uite, cică l-ai putea birui
pe trol — scrie asta pe o coajă de ou preistoric de-a Animicstiuto-rului pe care mi-a
citit-o frate-meu acum vreo trei zile — dacă ne aduni pe toţi la un loc.
— Pe cine să adun?
— Cum pe cine, pe noi, personajele jocului video. Pe mine, pe Fofo, pe Vasiliska,
pe Astor, pe...
— Şi cum Dumnezeu să dau de voi toţi? Unde să vă caut?
— Păi unde ne-ai aşezat. Eu nu ştiu decît de soarta lui frate-meu, care a ajuns deja
spătarul unui rege local. Trebuie să coborîm pe Tărîmul Celălalt ca s-ajungem
acolo, si poate că el, om politic, de, ştie mai multe ca mine.
Plecară chiar în după-amiaza aceea. Ajunseră-n zbor pînă la munţii din zare şi
coborîră lîngă o intrare în subteran. Pătrunseră în măruntaiele pămîntului, în lucirea
slabă a piritelor şi a cristalelor de pe pereţi. Coridorul se lărgi şi cei doi se văzură
deodată în hala imensă de sub continent, vrăjiţi de minunăţia lacurilor de mercur, a
rîurilor de lavă incandescentă, a moliilor palide, mari cît bufniţele, lopătînd moale
prin aer. Aici îşi reluară zborul, urcînd pînă la ţurţurii sticloşi, îngălbeniţi de dîre de
sulf, ai plafonului. Coborîră într-un tîrziu chiar în mijlocul cetăţii unde Fofo
ajunsese demnitar, îl găsiră stînd smirnă în spatele taburetului regal. Tolănit pe
taburet, regele se sprijinea cu toată greutatea pe pieptul lui.
— Eu credeam că eşti spătar de oaste, nu spătar de scaun, zise mirată Ding-Ding.
— Ei, trebuie să ai răbdare dacă vrei să faci carieră, făcu Fofo resemnat. Zmeoaica
îl trase deoparte aşa de brusc, că regele se rostogoli pe podea. Cei trei apucaseră
însă să se ascundă într-o cămară. Fofo le destăinui secretul victoriei asupra trolului.
Fiecare personaj trebuia să-i dea un lucruşor programatoarei. Abia cînd avea să le
aibă pe toate, ea putea face cu ele o vrajă eficientă. Deocamdată Lobo îi dădu un
96
nasture, iar Fofo un iadeş de găină. Nu aveau altceva, se scuzară ei ridicînd din
umeri.
Toată povestea i se păru lui Ding-Ding o nebunie. Dar nu avea altă şansă,
aşa că porni, cu inima strîn-să, în căutarea celorlalte personaje. Urmă o odisee
întreagă. Primul de care dădură fu spionul Bombas, ce tocmai se confruntase cu
Făt-Frumosul din castel. Acum zăcea pe un pat de spital, într-un ghips din care i se
mai vedea doar un ochi. O labă i se-nălţa spre tavan, prinsă cu o contragreutate.
Abia reuşiră să smulgă o amintire de la el: o bucăţică de leucoplast roz, medicinal.
„Vă fac raport!", ameninţa el în rîsul tuturor. Servitorii lui Fofo îi luară patul pe sus
şi-o porniră spre Castelul Negru. Ceilalţi zburară apoi pînă la cabinetul medical al
doftorului Chung, pe care-l găsiră torturînd un zmeu sur de văgăună. Acesta urla
din răsputeri, încercînd să rezolve o problemă cu căzi găurite. Indignaţi de
tratamentul inuman, zmeii îi cerură un obiect şi nu căpătară decît o foaie cu orarul
cabinetului, „poate mai poftiţi pe aici". Fu si el îndrumat spre Castelul Negru. De
Zurbalan dădură în vîrful muntelui de sticlă, chinu-indu-se să se suie în nucul
fermecat. Era nervos şi ciufut, îi păli năpraznic cu buzduganul, uitînd că el nu era
decît un personaj din povestea unui cap de balaur. Aşa că buzduganul sări din ei cît
colo. Atunci zmeul se mai îmblînzi suprimi chiar să-i însoţească pînă la castelul
trolului. în semn de pace îi dădu lui Ding-Ding un mic elf sculptat de el cu gheara
într-un bloc de cretă albastră.
Şi spaţiul subteran era devastat. Cristalele se opacizaseră, crîngurile de
licheni fosforescenţi erau aproape uscaţi, minele de sarmale si de ouă umplute cu
maioneză miroseau acru. O tristeţe cumplită o-nvălui pe Ding-Ding.
La Cornichonn, cîinele-de-zmeu, ajunseră pe înnoptate. Rătăcea pe malul
mării de acid sulfuric, în-cercînd să-şi aducă aminte un citat din Violon. Zmeul îi
privi de sus, le vorbi pe o păsărească împănată cu epitete nobile si veni cu ei, cu
condiţia să poată spune oricînd un citat savant. Toţi primiră cu întristare. De la el
căpătară un caiet cu poezii scrise cu o caligrafie ascuţită. Dădură şi de Vasiliska,
fericită în cercul ei de poeţi, primiră de la ea un inel cu o agată frumos faţetată şi
porniră cu toţii mai departe, ieşind din nou la suprafaţă. Intr-un sat dădură de Astor,
fiul zmeilor de văgăună, acum aproape complet orb, dar avînd pe umeri doi scatii
care vedeau pentru el.
— Astor! Astor! strigară toţi cu bucurie.

97
— Care Astor? Poate vreţi să spuneţi Gheorghiţă, făcu el cu bunăvoinţă. Din casă
ieşi o muiere de prăpădit cu vreo trei prunci, jumate zmei, jumate oameni, agăţaţi
de fusta ei.
— Te-ai şi însurat, amărîtule, rîse mînzeşte Lobo, tot cu gîndul la Grunhilda lui.
— Ce să facem şi noi? Ca tot creştinul...
Primiră de la el un cocean de porumb şi promisiunea că va fi în faţa castelului,
„doar să-mi pun oleacă gospodăria la cale". De Umbello dădură în munţi, rătăcind
în căutarea Animicştiutorului. Primiră şi de la el, si din partea celui mereu nevăzut,
două lucrusoare neînsemnate, un peştişor de aur şi un ac, şi se grăbiră să meargă
mai departe, simţind că povestirea e pe terminate. Zumm, muma zmeilor, smerit ca
o călugăriţă, primi să meargă cu ei si îşi aduse si el obolul: o bucăţică de etamină
pe care cususe un ghiocel. Ultimul personaj vizitat fu Ding-Ding, care, în
laboratorul ei electronic, privea prin microscop un circuit imprimat. Toate
personajele celelalte rînjiră cînd o văzură, căci adevărata Ding-Ding nu era nici pe
jumătate atît de frumoasă. „Ei, aşa e cînd ai pîinea şi cuţitul", comentase ironic
Fofo. Privind-o cam de sus pe programatoare, Ding-Ding din compact disc îi
întinse cu vîrful degetelor o diodă.
După cîteva zile în care se aşteptară unul pe altul, se reuniră în sfîrşit cu toţii
în faţa marelui si negrului castel. Trolul uriaş era pe ziduri şi se uita cu dispreţ către
ei. Orificiul din centrul compact discului începuse să se lăţească, sorbind totul în
jur. Pe cînd personajele se sfătuiau ce să facă cu lucrusoarele disparate care
zdrăngăneau în palmele zmeoaicei, deodată pămîntul se zgudui şi trolul se arătă în
mijlocul lor. O înhaţă pe Ding-Ding şi se-nchise cu ea, din nou, în cetatea de
bazalt.
— Pînă la urmă ai călcat în capcana mea, rosti colegul ei Mol-loch, scoţîndu-şi
masca de trol. Măcar în lumea virtuală, şi tot o să fii a mea!
— Niciodată, strigă Ding-Ding, şi mintea începu să-i meargă cu viteza disperării.
Recapitula: nasture, iades, leucoplast, orar, elf, caiet, inel, cocean, peştişor, ac,
etamină, diodă... Vraja era-n obiecte sau în numele obiectelor? In nume, căci aici
totul era fără realitate ca şi numele. Reţinu primele litere ale celor douăsprezece
nume: N, I, L, O, E, C, I, C, P, A, E, D. „Asta e!", ţipă ea înţelegînd deodată. Era
chiar numele compact discului ei! îşi îndreptă umerii şi rosti cu voce sonoră:

ENCICLOPEDIA

98
La acest cuvînt zidurile castelului căzură, Mol-loch începu să scadă pînă nu
se mai văzu, cîmpiile înverziră, oraşele şi satele înfloriră din nou, iar per-
sonajele plecară fiecare la locul său, făcînd cu mîna pentru ultima oară către cea
care le dăduse viată. Cît despre Ding-Ding, ea reveni în lumea adevărată, termină
compact discul şi se-apucă de alte treburi, fără ca măcar o clipă să bănuiască
adevărul: că ea însăşi este personaj într-o poveste, ca şi cealaltă Ding-Ding, din
frumosul disc cu piste argintii.
POVESTEA LUI ZUMM, MUMA ZMEILOR
Intr-o frumoasă dimineaţă de august, Zu-zulina, sora haiducilor, îi lăsă
horăind pe cei doisprezece tovarăşi ai ei în coliba din pădure si ieşi pe pajişte la
cules ciupercuţe. De fapt, haiducii se prefăceau doar că dorm, ca-n fiecare
dimineaţă, ca s-o poată zări printre gene, doar în cămăşuţă de noapte, pe nurlia
copilă care le făcea mîncare şi le deretica prin casă. Abia după ce ea ieşea pe uşă
voinicii adormeau la loc, mîngîindu-şi cu mulţumire hangerele, pe care nici
noaptea nu le scoteau de la brîu. Zuzulina avea şaptesprezece primăveri, şi de trei
ani împliniţi trăia în pace în mijlocul pădurii. Fugise de-acasă de răul unei mame
vitrege, care-o persecuta punînd-o să-şi facă zilnic lecţiile, şi aflase dragoste şi
înţelegere tocmai unde se aşteptase mai puţin: la haiduci, dovadă că inima omului
este o enigmă.
Am uitat să vă spun că Zuzulina era o cosînzeană, şi că părul ei de aur
mătura pămîntul în urma ei, făcînd să-nflorească miraculos toţi bobocii, să crească
iarba cu vreun centimetru şi să se transforme brusc omizile-n fluturi la atingerea
vîrfurilor puţin tocite ale buclelor ei. Mai rău era cînd părul i se-ncurca în mărăcini
si fata rămînea priponită şi cîte-o zi întreagă, pînă veneau haiducii să-i reteze
pletele cu hangerul, eliberînd-o. Drept mulţumire, le gătea atunci o cină mai bună
ca de obicei, şi apoi îi adormea cu un cîntec duios. în dimineaţa cu care-ncepe
povestea noastră, fata o porni cu picioarele goale prin rouă către poalele pădurii,
acolo unde ciupercuţe numeroase îşi ridicau căpşoarele către lumină. Pe braţ,
Zuzulina avea un coşuleţ de răchită pe care-l purta cu nespusă graţie. Ajunsă la
ciupercute, copila le măsură mulţumită cu privirile: crescuseră mult faţă de ziua
trecută. Pălăriile rosietice le luceau în soare şi, în jurul lor, vacile-Domnului, ca
nişte seminţe roşii cu puncte negre, fojgăiau grăbite. Aşezată comod pe vine, fata
începu să culeagă. încet-încet, cosuleţul i se umplea de bureţi, ghebe şi hribi
ţigăneşti, în timp ce culegea, fata cînta cu un glăscior cristalin de soprană de
coloratură. Fiinţe gingaşe ca: iepuraşi, ciocănitoare, veveriţe, rădaşte, greieri, rîşi,
99
jderi, hîrciogi, pîrşi, cucuvele, cîrtiţe, soboli si raci (dintr-o baltă din preajmă)
cîntau în cor împreună cu ea:
Inimioară mititică,
Unde rătăceşti?
Iată, codrul frunza-i pică,
Să nu-nnebuneşti?
Unde vei afla iubirea,
Tainicul amor?
Se desfată toată firea,
Doar eu mor de dor!
Chorus: Mor de dor, De dor mor, Mor de dor, De dor mor...
Sufleţel care oftează, Unde oare-i el?
Unde mi-e ursitul, rază? Oare într-a lunii pază? Oare-ntr-un castel? Unde voi afla
iubirea, Tainicul amor? Se desfată toată firea, Doar eu mor de dor!
Chorus: Mor de dor, De dor mor, Mor de dor, De dor mor, etc. etc...
Atît de puternică era vocea Zuzulinei, arîta tînjire se revărsa din ea, încît
ajungea pînă la coliba din pădure, în care haiducii, abia treziţi, se spălau cu apă de
izvor şi-apoi se bărbiereau atent cu hangerele. Ei răspundeau cu triluri tiroleze care
înviorau atmosfera: lolari-iolari, iolari-iola, Fii iubita mea, Fii numai a mea, lolari-
iolari, iolari-iuhu, A altuia nu, A altuia nu!
Plecau apoi, veseli, la slujba lor de fiecare zi: nobila haiducie. Zuzulina nu
ştia prea bine în ce consta aceasta, dar era mulţumită văzînd că tovarăşii se întorc
în fiecare seară cu parale bune, şi nu punea întrebări incomode.
Pe cînd culegea cosînzeana la ciuperci, iată că de după vîrfurile copacilor (şi
depăşindu-le considerabil) se ivi o bătrânică. Era înfăşurată într-un fulgarin
demodat, iar pe urechi purta căşti de walkman. Ce asculta oare? După paşii de dans
în care înainta, puteai ghici cîntecul la modă în toată lumea zmeiască: „Fete bune
sîntem, zmeoaice de zmeoaice..." Zuzulina o observă de departe, dar nu-si
întrerupse nici culesul, nici cîntecul. Nu era, desigur, altceva decît una dintre
cerşetoarele bătrîne care mai treceau uneori si pe la căsuţa din pădure, în speranţa
vreunei pomeni. Miloşi din fire, haiducii le primeau bine, le dădeau pe spinare cîte
puteau duce şi li se adresau cu blîndeţe: „Cară-te de-aici, hoască afurisită!" E drept,
băbuţei de-acum îi cam uitase Dumnezeu măsura, dar aşa erau ele, unele mai mari,
altele mai mici... în realitate, după cum poate aţi ghicit deja, bătrîni-ca nu era
bătrînică, ci o mumă a zmeilor, sau mai bine zis un mumă a zmeilor în căutare de
100
cosînzene. O simţise din depărtare cu organul prinţesoreceptor răsfirat ca nişte
pene de coţofană în dosul urechilor, dar văzînd-o acum în faţa lui îşi linse buzele
cu limba despicată, lungă de mai bine de un metru: cosînzea-na asta depăşea orice
aşteptare. La priveliştea nurilor pe care cămăşuţa de noapte mai mult îi dezvăluia
decît îi acoperea, Zumm, căci acesta îi era numele (care înseamnă într-unul dintre
numeroasele dialecte aglutinante „Bărbatul care tratează femeile cu generozitate,
dar ele se dovedesc a fi nerecunoscătoare, devenindu-i curînd infidele"), luă
deodată poziţia reflexă de atac: se cocîrjă cît putu, îşi legă mai bine basmaua pe
cap si pătrunse sonticăind în poieniţă. La paşii săi iarba se usca, greierii leşinau,
fluturii se schimbau la loc în omizi şi, în general, era cum nu se poate mai nasol.
Cintezoii şi sticleţii, bătînd speriaţi din aripi, se grăbiră să-si avertizeze
prietena cea cu părul de aur:
Zuzulina, Zuzulina, Iată, piere-n cer lumina,
Asta nu e o mamaie, Este Zumm, cel lat în frunte, Este Zumm, cel cît un
munte! Fugi, odor cu plete lucii, Cheamă repede haiducii!
Insă zglobia fată nu ţinu seama de ciripitul speriat al păsărilor. O dată pornită
după ciuperci, ciuperci avea să culeagă cît era ziua de lungă. Loc în paneraş mai
era, iar ciupercuţe, slavă Domnului, cîte pofteşti sub poala codrului. Aşa că, atunci
cînd Zumm fu lîngă ea, privind-o de la înălţimea unui bloc cu trei etaje,
Zuzulina i se adresă politicos:
— Săru'mîna, bunicuto!
— Să trăieşti, fetiţa maichii, răspunse şi Zumm, la fel de prevenitor.
Se lăsă apoi o tăcere stînjenitoare. Negăsind repede un subiect de
conversaţie, Zumm începu să fluiere printre dinţi ceva aiuristic, uitîndu-se către
cer. Fata mai smulse două-trei ghebe din pămîntul reavăn şi apoi se ridică,
netezindu-si faimoasa, de-acum, cămăşuţa de noapte, îl privi pe muma zmeilor
drept în ochi, fîlfîind des din genele bogate:
— Da... ce vînt te-aduce pe-aici, mătuşico? Zumm se pierdu cu firea:
— A, eu... nimic... şi eu, pe-aici... ca tot omu'... adică... nu vrei să fii nevasta mea?
Iar o făcuse lată! Zumm se blestemă în sinea lui cu năduf. Cîte mături pe spinare,
cîte tocuri ascuţite de pantof nu mîncase pînă atunci din cauza afurisitei lui
timidităţi şi stîngăcii. „Ascultă, puiule, îi spusese de zeci de ori tatăl lui, Klamm
(«Muma zmeilor care nu ratează niciodată si în faţa căruia muierile leşină ca
muştele»), în copilărie. Ca să cucereşti o femeie trebuie să ai tactică, strategie, simt
politic şi diplomatic. Trebuie să calculezi din timp unghiurile de incidenţă,
101
împrăştierea balistică şi rezistenţa materialelor. Orice neglijenţă în camuflaj, nodul
basmalei strîns neglijent, ghebosarea neconvingătoare, sonticăitul prea stilizat,
poate fi fatală. Şi mai ales ţine minte: o adevărată mumă a zmeilor nu gîndeste,
loveşte! O pîndesti, o vrăjeşti, o apuci şi o duci. Atît. Fără farafastîcuri demodate."
Aşa se face că Zumm avea vreo patru sute de frăţiori, toţi bine instruiţi, care
nu gîndeau, ci loveau. Doar el, dintre toţi, se născuse idiot. Căci chinul fără limite
al vieţii lui Zumm era chiar acesta: se-ndrăgostea pînă peste urechi de fiecare
domniţă pe care-o vedea, fie ea frumoasă sau urîtă, grasă sau slabă, săracă sau
bogată. „Cîrpă sînt, nu coşcogea zmeul", îşi striga el adesea, cărîndu-şi la pumni în
ţeastă. Şi doar mereu îşi propunea să fie dur si necruţător. Dar inima, pîrdalnica...
Aşa că si acum, în poieniţă, Zumm căzu în genunchi în faţa Zuzulinei si
începu să cînte cu glas duios:
Noapte cu lună, Noapte cu stele, Fii adorata Vieţii mele! Seară de vară, Seară
de dor, Dacă nu vrei, am Să mă omor!
Zuzulina ascultă visătoare. Se-nălţă apoi pe vîr-furi cît putu si netezi penele
prinţesoreceptoare care i se zbîrliseră lui Zumm de emoţie, îşi lăsă căpşorul buclat
pe umărul matahalei si-i şterse ochii lăcrămosi cu basmaua.
— Dar nu trebuie să-ti pui capăt zilelor, voinice, rosti ea cu blîndeţe. Nu e căzu',
finea şi eu te iubesc. Hai în codrul verde, si-am să fiu mireasa ta! 154
Muma zmeilor rămase trăznit. Cum, nici un paner în cap? Nici un ţipăt
deznădăjduit? Nici o jignire grosolană, că, adică, „nu te-ai uitat niciodată în
oglindă, măi, Banderas?" Ah, dar asta însemna fericirea! Pentru prima dată în viaţă
Zumm se simţea înţeles de un suflet geamăn. Cei doi se înlănţuiră şi, pe cînd picio-
rul de plai din jur începea parcă să lumineze, pe cînd norişorii păreau oiţe păscînd
pe cerul de peruzea, pe cînd iarba şi florile care le ajungeau pîn-la brîu ridicau
căpşoarele către soare, începură să cînte obraz lîngă obraz:
Gondoli, gondola, Toată lumea parcă-i a mea, Gondola, gondoli, Asta
înseamnă a iubi!
Gondoli, gondola, Nu mai există altcineva, Gondola, gondoli, Amorul meu
numai tu vei fi! Guarda che luna, Guarda che mare, Haide în codru, Hai la
plimbare, Guarda che mare, Guarda che luna, Să-mi fii alături întotdeauna.
Gondoli, gondola Toată lumea parcă-i a mea, Gondola, gondoli, Asta înseamnă a
iuuuuuu-uuu-biiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii!
Un ropot de aplauze izbucni: toată pădurea era cuprinsă de entuziasm.

102
Perechi-perechi, iepuraşii, căprioarele, sticleţii si celelalte animale graţioase
enumerate mai sus îşi cîntau şi ele dragostea, fiecare pe limba sa. Cei doi amorezaţi
dispărură în codrul verde, lăsînd baltă ciupercuţele împrăştiate şi strivite în iarbă.
Ajunşi la poalele unui bătrîn stejar, se culcară sub crengile lui şi farmecul
pădurii îi cuprinse...
Destinul însă, care veghează rotirea sferelor cereşti, nu îngăduie prea multă
fericire pe pămînt. Zefirul, cu plete scînteietoare, cu obrajii umflaţi, suflă către
căsuţa din pădure, aducînd la urechile haiducilor ultimele cuvinte ale duetului
amoros: „...înseamnă... a iubi..." Oroare: urechea lor deprinsă cu glasul fiarelor din
codru desluşi, alături de vocea dragă ce le spunea poveşti în fiecare seară, hîrîitul
monstruos al unei mume a zmeilor. Fără o vorbă, cei doisprezece fraţi de cruce
săriră pe caii lor iuţi şi, cu hange-rele-n dinţi, cu ochii aruncînd flăcări, grăbiră să
răzbune jignirea adusă domniţei lor. O dată cu ei gonea Miazănoaptea, pasăre
uriaşă de ale cărei aripi negre se întunecase cerul. Fulgere şi trăznete ţîşneau dintre
penele ei. în goana cea mai mare a cailor, haiducii cîntau în cor. Păcat că, din cauza
hangerelor ţinute-n dinţi, cuvintele ieşeau puţin deformate:
Hohahi-hohahi, hohahi-hoha, He horn hăzbuna, He hom hapărha, Hohahi-
hohahi, hohahi-huhu, Ahungem ahu, Ahungem ahu!
Toată natura era însă împotriva lor, încercînd să-i ascundă pe fugari.
Căprioarele-i îndrumau în direcţie greşită, păsările îi izbeau cu aripioarele peste
faţă, aricii răneau picioarele cailor. Cînd ajunseră lîngă stejarul cel bătrîn, era prea
tîrziu: nu mai găsiră decît un bileţel, impregnat cu parfumul atît de bine cunoscut
(„Ysatis de Givenchy", luat odată de la o bogată şi dăruit unei sărace), şi în care
scria cu caligrafia cunoscută:
Haiducii se aşezară la \ rădăcina copacului si începură să plîngă. Plînse-
ră un an încheiat, pînă cînd, în locul poieniţei de altădată, se ivi pe acele meleaguri
un lac cu ape sărate, nimic altceva decît lacrimile voinicilor. Cum în tot acest timp
ei nu au mai haiducit, bogaţii s-au înmulţit peste măsură şi, nemaiavînd ce mînca,
au murit cu toţii. Săracii au murit de asemenea, fiindcă nimeni nu le-a mai dat banii
luaţi de la bogaţi, în schimb, lacul se dovedi bogat în peşte, aşa că haiducii
deveniră pescari.
Intre timp, fericitul Zumm o duse pe Zuzulina lui într-o ţară îndepărtată, în
care trăiau toţi cei patru sute de fraţi ai săi, avînd fiecare cîte-un frumos harem de
cosînzene. Dar Zuzulina le depăşea pe toate în frumuseţe şi înţelepciune. Ea-l
adormea în fiecare seară pe norocosul ei soţ cu un cîntec duios si lua apoi cărarea-n
103
codru, sub luna plină, la cules de bureţi şi ghebe, întîmpinată cu drag de o mulţime
de bunicuţe ivite din întîmplare cam tot pe acolo. Noaptea întreagă sporovăiau,
depanau amintiri din vremurile de odinioară, rezolvau probleme de isteţime...
A doua zi în zori îl trezea pe Zumm, îi punea căştile pe urechi si-l trimitea la
slujbă, la împărţit dreptatea. La tribunal, Zumm era renumit pentru rapiditatea cu
care rezolva pricinile: pe cînd măciuca altora zbura două săptămîni prin văzduh
pînă să cadă în capul împricinaţilor, a sa făcea doar zvîc! pîn-la tavan, si cădea în
doar patru secunde, fără să provoace mai mult de un cucui mititel căci, în bunătatea
inimii lui, Zumm n-ar fi luat nici viata unui şoarice. Pe seară, alerga din nou la
căsuţa lui dragă, unde-l aştepta, cu o floare după ureche, Zuzulina. Gospodărie ca a
lor şi voie bună ca a lor n-o să găseşti cît vei umbla, n-o să găseşti la nimenea...
Curînd, fericirea cuplului deveni întreagă, căci si cei doisprezece pescari, foşti
haiduci, se mutară în ţara lui Zumm, la doi paşi de casa acestuia. Mare-i fu bucuria
copilei cînd îşi revăzu tovarăşii de joacă si voie bună de pe vremuri, mai ales că, de
cînd nu se mai epilase cu hangerele lor, un pufuşor inestetic îi invadase picioarele.

POVESTEA MAESTRULUI CORNICHONN, CÎINELE DE ZMEU


Tribunalul din Săpata ocupa odinioară trei sferturi din oraş, şi era o
construcţie mai mare decît şi-o poate imagina mintea zmeiască. Avea o sută de
intrări monumentale, străjuite de suie menhire din cel mai pur lapis-lazuli, si o
singură ieşire mică şi nenorocită, mai mult o gaură în zid, prin care puţinii ce
scăpau vii din mîna legii se tîrau afară ca din pîn-tecele mamei lor. Li se şi zicea,
mai apoi, „nou-născuţii". Aici, la Săpata, se judecau cele mai însemnate pricini din
tot Tărîmul întunecimii. In interiorul tribunalului se aflau coridoare nesfîrşite şi-
ntortocheate, fiecare zugrăvit în altă culoare, cu uşi de-o parte şi de alta, ce dădeau
în săli şi săliţe sinistre, pline de judecători, toţi mume ale zmeilor cu bîta dreptăţii
în mînă si coiful hotărîrii definitive pe cap, înveşmîn-taţi în robe largi/ verzi cu
buline roşii. In tavan, fiecare odaie avea cîte o mare gaură, pe unde se vedeau
ţurţurii sclipitori ai boltii la o ameţitoare înălţime. Pe acolo ieşeau bîtele azvîrlite-n
văzduh de Judecători, bîte din care săreau scîntei, aşa că, de departe, imensul
tribunal se vedea acoperit ca de un continuu foc de artificii, împricinaţii formau
lungi cozi pe culoare, în aşteptarea proceselor. Tot timpul se auzeau din săli răcnete
cumplite şi se scoteau zmei cu capetele făcute varză. „Ăsta-i un judecător aspru,
dar drept", comentau cei de la coadă. Alteori, ieşea cîte-un zmeu ameţit, ţinîndu-se

104
de pereţi, şi cu ditamai cucuiul în creştet. „I-au dat circumstanţe atenuante", se
comenta.
Undeva, pe la jumătatea unei cozi nesfîrşite, aştepta Cornichonn, cîinele de
zmeu, venit să se judece cu porcul său de cîine favorit, Karakeridosbelloia-nisoglu,
căruia toţi cunoscuţii îi ziceau Mr. K. Procesul lor era cu totul neobişnuit şi
atrăsese atenţia lumii zmeiesti, căci, în general, cîinii de zmeu îşi rezolvau
diferendele cu slujitorii lor consumîndu-i la cină, bine rumeniţi si presăraţi cu
enibahar. Cornichonn era însă vegetarian, mai mult, adept al alimentaţiei
macrobiotice, prin care spera să trăiască atît de mult încît să poată citi toate cărţile.
Neputînd să-l înfulece, îl chemase pe Mr. K. la judecată, ca să-l înveţe minte să mai
calomnieze un savant de reputaţia lui Cornichonn. In toată coada, ei erau singurii
care stăteau în patru labe, e drept, cu demnitatea pe care le-o conferea ţinuta de
mare gală: zmeul în frac, ghetre si mănuşi de culoarea lămîii, iar slujitorul într-un
mun-dir moştenit de la bunicul, cu o gaură-n dos, prin care i se strecura coada
îmbîrligată. Gloata din preajmă, zmei de toate rasele şi categoriile, trăgea cu ure-
chea la distinsa conversaţie a celor doi.
— Mai întîi şi-ntîi, adu-ţi aminte, domnule... ăăă... K. (parc-aşa ţi se spune), ce erai
cînd te-am adus, de milă, în casa mea: nimic altceva decît un godad
— Ba să avem par-par...
— Nici un pardon! Un godac şi nimic altceva. Parcă te văd guiţînd în paie şi
sugînd la biberon. Fiindcă eu, cu mîna asta pe care-o musti acum, ţi-am dat să sugi.
Erai dezgustător de pe-atunci. Cîh! Ţi se scurgea laptele pe bărbie...
— A-a-a-asta n-are ni-ni-ni-mic de-a face cu...
— Ba are. Are, domnule... ăăă... K. Fiindcă fără mine ai fi fost de mult un purcel
de lapte cu un măr în gură, înconjurat de salată pe-o tăvită de inox.
— Vă-vă-vă amintesc că por-porcii de cîine sînt fiinţe gîn-gîn-gîn...
— Gînditoare, vrei să spui? Poate gîngăvitoare! Ha, ha, ha! Da, gîngăvitoare, dacă
asta vă aranjează, stimate domnule... K. Lasă, mai vedem noi. Crezi că nu sînt zei
acolo sus, care veghează, care pedepsesc nerecunoştinţa? A, da' uite-l pe domnul
judecător. Să trăiţi, maestre!
Făcîndu-şi drum ca un tanc prin gloată, se apropiase de ei mătăhălosul
Zumm, care, de căldură, îşi dăduse basmaua jos din cap, lăsînd să i se vadă craniul
diform si solzos. Pe un umăr căra bîta, un frumos şi eficient obiect de palisandru,
împodobit cu un scris mărunt de sus şi pînă jos.

105
— Bună ziua, făcu el preocupat, răsfoind un dosar din care curgeau hîrtiile. Prin
urmare... Cornichonn contra Karakeridosbelloianisoglu. Da, da, bun. Pricina:
calomnie. Pedeapsa cerută? Moartea! Nu e cam mult, stimabile? întrebă el, uitîndu-
se lung la Cornichonn, care se ridicase în două labe, ca un căţel la circ, să ajungă
mai bine la marea ureche a mumei zmeilor.
— Dimpotrivă, e prea puţin, domnule judecător, căci amintiţi-vă de spusele
marelui nostru Animic-ştiutor în legătură cu păcatul mortal al ingratitudinii:
Cel care uită binele făcut înseamnă că nu şi-l mai aminteşte.
La fel, poetul Violon, în „Egloga a MCMLVIII-a", dezvoltînd magistral
acest aforism, glăsuieste cu îndreptăţire:
Cel care uită vreun bine făcut Hu şi-l aduce aminte, şi-aMt.
Versuri pe care sublimul Joopp le glosează, ară-tînd că...
— Destul, destul... O să vedem, aruncă peste umăr Zumm, ameţit de atîta erudiţie.
Plecă apoi mai departe, grăbindu-se să intre în odaia judecăţii.
— Vezi, porc de cîine ce eşti, domnul judecător mi-a dat dreptate, îşi reluă
Cornichonn discursul acuzator, în locul tău, as cădea chiar acum în faţa mea în
genunchi si as spune: „Stăpîne, am greşit, iertare, de mii de ori iertare!" Nu că te-aş
ierta, dimpotrivă, te-aş lovi cu piciorul uite-asa...
— Uauuuu! se tîngui Mr. K.
— ...si iar aşa...
— Uhuhuuuuuuu! făcu din nou porcul de cîine. Apoi îl privi crunt în ochi pe
stăpînul său: Poţi să da-da-dai cît v-v-v-rei, că tot ai fu-fu-fu-fu...
— Ce?
— Ai fu-fu-fu... rât! Ai furat! Ai furat! strigă cît putu Mr. K., fericit că reuşise în
fine să spună cuvîntul.
Zmeii din jur se amuzau copios de conversaţia celor doi. Cei mai mulţi erau
ditamai voinicii, încinşi în platoşe greoaie de piatră translucidă si sprijinin-du-se-n
gigantice buzdugane. Erau si două-trei zme-oaice cu corniţe în vîrful capului,
îndreptate spre cele trei puncte cardinale. Mai la o parte se ţinea un bătrîn zmeu al
zmeelor, atît de aţos că nu făcea poftă nimănui. Stătea călare pe mormanul lui de
zmee colorate şi trăgea şi el cu urechea. Toţi cei din jur aflaseră ce căuta la
tribunal: venise pentru un testament, prin care lăsa celor doi neisprăviţi fii ai săi,
Lobo şi Fofo, o moştenire neaşteptată... Din cînd în cînd, bătrînul chicotea cu
multă răutate.

106
— Iar o ţii gaia-maţu' cu absurditatea asta? Ia spune, stimabile, să audă si zmeii
ăştia cumsecade, ce-am furat? Ce-am furat eu, Magistrul cu patru briliante,
Sublimul poet al Curţii Cereşti (uitaţi certificatele, domnilor!), Necontestatul
Alchimist al Salivei Imperiale (am cucerit titlul ăsta în turnirul de critică literară de
la Hornyland, unde l-am umplut pe slăvi-tul Nigrofitz de bodaproste, de se mai
ştergea cu prosopul pe ochi si după o săptămînă), Poetul Nepereche al
împerecherilor Perfecte, Geniul Titanic al Hiperboreei, Iniţiatul de Rangul al
Nouăsprezecelea cu Indispensabili de Blăniţă (singurul de pe planetă, cinstiţi
cetăţeni), Văcarul Capodoperelor, Ctitorul Şa-manic al Literaturii Ecumenice,
Nepreţuitul îndrumător al Tuturor Imbecililor în ale Retoricii, Prezer-vatorul Celor
Patruzeci si Sase de Chivoturi Strict Autentice şi al Celor încă Unsprezece Aproape
Sigure, Veioza Galaxiei si Călăuzitorul Epilepticilor... Asta sînt eu, domnilor, un
produs perfect al culturii şi civilizaţiei, nu că mă laud. Iar dumnealui — dumnealui
ştiţi cine e? Dumnealui e o literă. Dumnealui e litera K de la kilogram.
— Karake-ke... dădu să-l corecteze porcul de cîine, vădit intimidat de desfăşurarea
de forţe a stăpînu-lui său, dar acesta ridică şi mai tare vocea. Acum, toată coada
căsca gura la cei doi.
— O literal O literă proastă, cu doar o pagină în dicţionare. Domnul kilometru,
domnul kilowatt, domnul kiwi mă contestă pe mine! Pe mine, care tata a fost stareţ
al marelui zeu @ la Mînăstirea de Cri-solit! Care unchiul meu a fost...
— Ai fu-fu-fu...
— Absurd! Grotesc! Penibil! Ce am furat, domnule porc de cîine?
-Po-po-po...
—Domnilor, conchise plictisit Cornichonn, vorba
multă, sărăcie. Uitaţi care-i tărăşenia, într-o zi bles
temată a vieţii mele l-am găsit pe domnul Kilometru
pe o mare tavă de friptură, înfăşurat în foi de viţă
şi legat aşa strîns, că era gata-gata să-şi dea duhul.
Nişte vecini de-ai mei voiau să-l consume la prînz.
Pe-atunci eram mai tînăr şi-aveam tot soiul de fu
muri în cap: civilizaţie, emancipare, aboliţionism...
L-am salvat pe dumnealui, l-am şters de zeama de
bordeleză, i-am dat să sugă, cum vă spuneam... L-am
primit apoi în biblioteca mea, l-am lăsat să asculte
cele mai subtile conversaţii şi vorbe de duh în salonul
meu literar, l-am făcut părtaş la cariera mea ştiinţi
fică şi artistică. I-am încredinţat şi înalta, nemeritata
onoare de păstrător al buzduganului meu. Si care mi-a

107
fost răsplata? Cum mi-ai mulţumit, demon nere
cunoscător?
—Păi da-da-dacă ai fu-fu-ratpo-po...
—Poeziile? Am furat eu poeziile? Ţi-am furat eu
poeziile, bestie cu faţă zmeiască?
—Nu ale me-me-mele, a-a-a-le lui Bo-bo-bo...
—Şi ce, eşti avocatul lui? De ce nu vine Bolboro
ăsta să mă dea în judecată, ai?
—E mo-mo-mort de mult...
—Pretexte! Mofturi! Cinstiţi zmei, citeam acum
vreo lună Faima Qhfloffei (noi sîntem de pe me
leagurile acelea) şi — ce-mi văd ochii? Un articol cu
litere de-O şchioapă... „

ÎNCĂ UN CAZ DE PLAGIAT"...


Da', uitaţi, îl am aici. Si Cornichonn despături un petic de ziar foarte
mototolit.
—Acum, spuneţi si dumneavoastră, cinstiţi ce tăţeni, urmă dispreţuitor
Cornichonn.
xxxx Mănînc aici si acum articolul ăsta dacă veţi găsi cea mai mică
asemănare între inepţia clasicizantă si pretenţioasă din stînga si (nu că am scris-o
eu) admirabila satiră, sclipind de ironie din partea dreaptă. Vă rog să observaţi
misoginismul amar al geniului dezamăgit de iubita care nu s-a putut ridica la
înălţimea lui, dar şi triumful esenţei lui nemuritoare. Acel „nuuuu" — cîtă
suferinţă, cîtă frămîntare l-au precedat! Si cîtă voinţă mîndră în hotărîrea „Te voi
uita!" Şi abia în partea a doua marea poezie îşi desface aripile: nu se poate să nu fi
remarcat stoicismul viril al celor doi „de", care exprimă nu acceptarea resemnată a
apo-calipsei, ci, dimpotrivă, o linişte interioară divină, de nezdruncinat. Iar finalul?
Acel „prăpădito" cade ca un trăznet, marcînd diferenţa dintre două regnuri
incompatibile. Da, domnilor, focul si apa, lumina si întunericul, piscurile si văile
nu pot nunti niciodată. Concluzia vine firesc, ca o răbufnire a ororii de hybris: „Fi-
vei în veci de veci a mea???!!!" Finis coronat opus. Avem aici, domnilor, o
capodoperă, ca, de altfel, tot ce am scris vreodată!
Cornichonn termină discursul înălţat din nou pe două labe ca un căţel savant,
si aplauze frenetice îl răsplătiră. Nefericitul domn K. se făcuse acum mic şi tresărea
la privirile pline de ură si la ghiontii celor din preajmă. Curentul de opinie îi era net
favorabil maestrului. „Da' las-că îmi vine şi mie apa la moară. Cîinii latră, caravana
trece. Judecata îşi va spune cu-vîntul, nu ignoranţii ăştia pe care i-a dus de nas pan-
glicarul de stăpînu-rneu." Cînd gîndea, Mr. K. nu se bîlbîia deloc, aşa că încă din

108
pruncie preferase să gîn-dească în loc să vorbească, de unde reputaţia sa de fire
închisă. „Escrocul", îşi urmă el firul gîndurilor. „Mi-a dat să sug cu biberonul, hai?
Dar a uitat să mai spună că după ce mă îndopa bine juca tenis la perete cu
mine... Că de-aia n-are ursul coadă. M-a primit în salonul lui literar? Care salon, în
primul rînd? Trei amărîţi cu ţurţuri în bărbie si cu foamea-n gît, care-i ridicau în
slăvi deşteptăciunile în speranţa că după lectură mă vor găti la capac? Eu nu
vedeam cum se uită la mine? Si-atunci îmi mai ardea mie de lecturi şi comentarii?
Lasă, lasă, stimabile, că o să simţi tu măciuca dreptăţii în scăfîrlie, aşa cum
am visat în fiecare nopticică a chinuitei mele vieţi!" Epuizat de acest discurs
interior, Mr. K. se strînse şi mai tare în mundirul lui.
Pe nesimţite, coada înaintase binişor, şi cei doi împricinaţi patrupezi se
treziră deodată în fata uşii odăii de judecată. Deşi priveau sfidător în jur, solzii
amîndurora se zburliseră în toate părţile de teamă.
— Karakeridosbelloianisoglu contra Cornichonn! anunţă în sfîrsit un portărel. Cei
doi pătrunseră în sumbra odaie.
Trei sferturi din ea era ocupată de mătăhălosul Zumm, care-si smulgea cu o pensetă
penele voini-coreceptoare, atrofiate cam de multişor. Era în maiestuoasa lui robă cu
buline si, la intrarea celor doi, luă un aer semeţ care nu-i ieşi prea grozav. Basmaua
de bătrînică de pe cap strica tot efectul.
— Mda, mda, făcu el, cu nasu-nfundat în dosare. Cauza numărul 3442: escrocherie
sentimentală. Care e escrocatul?
— Pardon, făcu maestrul cu demnitate, aţi încurcat dosarele, onorabile domn
judecător. Al nostru e acela... da, acela cu copertă bleu...
— Aşa... Bun! Furt intelectual, care va să zică. Şi cine e hoţul?
— Durn-dum-dum... nealui! arătă răzbunător Mr. K. spre stăpînul lui.
— Să fim serioşi, dom' judecător. Ce mai atîta vorbă, tot ce vrem e să se facă
dreptate mai repede, în ceea ce mă priveşte, declar aici, de fată cu dumneavoastră,
că, în virtutea drepturilor mele inali...
— Treceţi de-o parte şi de alta a mea, îi tăie vorba, nepoliticos, Zumm.
Cei doi se conformară. Zumm scoase basmaua, îşi puse pe cap coiful hotărîrii
definitive si apucă de pe birou frumoasa lui măciucă, sculptată cu versete
caligrafiate bizar.
— Ia te uită, făcu siderat Cornichonn, citind puţin de pe măciucă. Păi asta e
faimoasa „Zurbă Inelară a lui Meer-Tscha", descrisă doar într-un manuscris de la
abaţia Platta... Uluitor! Maestre, aveţi singurul exemplar autentic!
109
— Serios? făcu Zumm. Mi-a vîndut-o acum trei ani un cerşetor caraghios. Avea la
toiag ceva ca nişte urechi. E... preţioasă? mai întrebă, interesat, Zumm.
— E cea mai frumoasă zurbă a tuturor timpurilor, rosti si Mr. K., uluit de
descoperire. De emoţie, nici nu se mai bîlbîise.
Uitînd si de judecată, şi de tot, zmeii se aşezară turceşte în faţa bîtei si-ncepură să
citească pe feţele ei cele zece poveşti întreţesute. Si citiră, şi citiră, şi citiră....
CUPRINS

Prefaţă/5 Partea I: UNIVERSUL


Anatomie/11
Rase şi varietăţi/15
Geograf ie/27
Istorie/33
Arme/40
Ocupaţii şi unelte/47
Economie/52
Civilizaţie/55
Limbă/60
Ştiinţe/64
Arte şi literatură/66
Partea a Il-a: POVEŞTILE
Povestea lui Lobo şi a lui Fofo, feciorii zmeului zmeelor/75
Povestea micuţei poete Vasiliska/84
169Povestea spionului Bombas/93 Povestea lui Astor, puiul zmeului de
văgăună/103
Povestea doftorului Chung/112 Zurba lui Zurbalan, zmăul din Quatr'a/122
Povestea Animicstiutorului/129 Povestea lui Ding-Ding, programatoarea/139
Povestea lui Zumm, muma zmeilor/149
Povestea Maestrului Cornichonn, cîinele de
zmeu/159
La preţul de vînzare se adaugă 2%, reprezentînd valoarea timbrului
literar re se vitează
Uniunii Scriitorilor din România,
Cont nr. 2511.l-l71.1 / ROL,
B.C.R. Filiala sector l, Bucureşti
110
Redactor
VLAD ZOGRAFI
Tehnoredactor
DOINA ELEXA FODARU
Corector GEORGIANA BECHERU
Apărut
Tiparul2004 BUCUREŞTI
executat — ROMÂNIA
la Regia Autonomă „MONITORUL OFICIAL" Bucureşti

DESPRE TOBIAS
de Geoffrey Hoppe
Nu auzisem niciodată de Tobias, atunci când mi-a apărut prima oară, în
timpul unui zbor cu avionul, în anul 1997. Nu am auzit până mai târziu, timp de
multe luni de zile, când am aflat cine a fost şi de unde venea. La început,
comunicările mele cu Tobias erau cam confuze. Asemanatoare unui post de radio
îndepărtat, mesajele erau truncheate sau subiect de interferenţă, prin intelectul meu.
Într-o zi l-am ăntrebat : „Tobias, cine eşti tu, de fapt ?” Răspunsul lui a fost simplu,
dar m-a derutat. „Mă vei găsi în Biblie”, mi-a spus. Chiar dacă cunoştinţele mele în
materie de Biblie erau limitate, nu-mi aminteam să fi citit sau auzit de Tobias. Am
căutat în Vechiul şi Noul Testament al lui Gideon, încercând să dau de Tobias.
Ghinion! Am rugat chiar şi un prieten, care avea pe laptop-ul său un program de
căutare în Biblie, să-l găseacă pe Tobias. Tot ghinion! Începusem să mă îndoiesc de
existenţa lui Tobias şi a cui era, de fapt, vocea din capul meu. În culmea frustrării
mele, am descoperit, în sfârşit, povestea lui Tobias. Tobias uitase să-mi spună că el
fusese în Biblie. Cartea lui Tobit este în Apocrypha sau în „cărţile pierdute” din
Biblie, care au fost îndepărtate din Biblie, în anul 1546, la Consiliul din Trent. Am
descoperit mai târziu, că unele exemplare ale vechii biblii catolice mai conţin
Cartea lui Tobit. Am fost încântat să-l găsesc pe Tobias şi m-am amuzat că am
onoarea să vorbesc cu cineva, care fusese scos din Biblie. Tobias este unul din
personajele principale din Cartea lui Tobit. Perioada istorică s-a situat undeva, între
anii 700-600 î.H. Tobit (sau Tobias senior) aparţinea tribului evreiesc Naftali şi
trăia în exil în Ninive (actualul Iraq). Conform doctrinei evlaviei evreieşti, Tobias
ardea corpurile celor din neamul său israelit, după ce aceştia fuseseră executaţi.
Tobias poate fi considerat, de asemeni, unul dintre primii „Mortii Gratificati”. Într-
o zi, în timp ce ardea corpul unui mort, un găinaţ de vrabie încins, i-a sărit în ochi
şi la orbit.
Ajuns la limita sărăciei, Tobias şi-a reamintit că odată făcuse un depozit în
arginţi la Rages, în Media. L-a trimis acolo pe fiul său,Tobias junior, împreună cu
111
un tovarăş de drum, care de fapt era Arhanghelul Rafael, deghizat în evreu, să
recupereze acel depozit. În timpul călătoriei, pe când Tobias junior se scălda în
Tibru, un peşte uriaş l-a atacat , aproape să-l ucidă. Rafael l-a sfătuit pe Tobias să
scoată splina, inima şi ficatul din corpul peştelui. El i-a spus tânărului Tobias că
fumul din inima şi ficatul peştelui are puterea de a exorciza demonii şi că alifia
făcuta din splină, poate vindeca orbirea. Pe drum, Rafael şi tânărul Tobias s-au
oprit în Ecbatana (Persia), unde locuia Raguel, un membru al familiei lui Tobias.
Fata acestuia, Sarah, fusese măritată de şapte ori, dar bărbaţii ei fuseseră omorâţi
de către demonul Asmodeus, chiar înainte de noaptea nunţii. Sfătuit de Rafael,
Tobias cere să se căsătorească cu fiica lui Raguel. Ca şi până atunci, Asmodeus a
venit să-l omoare pe Tobias junior în noaptea nunţii, pentru că acest demon se
îndrăgostise de Sarah şi Sarah, la rândul ei, se îndrăgostise de el. Dar tânărul şi
curajosul Tobias l-a gonit pe demon cu fumul şi mirosul emanat prin arderea
ficatului şi a inimii pestelui.
Rafael a ajuns la Rages şi s-a întors cu suma de bani lăsată acolo. Întors în
Ninive, împreuna cu tânăra sa soţie şi cu Rafael, Tobias i-a redat vederea tatălui
său, ungându-l la ochi cu alifia făcută din splina peştelui. Atunci, Rafael le-a
dezvăluit că el era unul din cei şapte îngeri ai lui Dumnezeu şi după aceea, s-a
întors în împărăţia cerurilor. După ce am citit Cartea apocrifă a lui Tobit şi, mai
târziu, versiunea romanţată a lui Frederick Buechner, „Pe Drum cu Arhanghelul”,
l-am întrebat pe Tobias dacă povestea era adevarată. „Nu chiar !” a fost răspunsul
lui. „Parţial, aşa s-a întâmplat”, a continuat el, „dar este o parabolă. Este o poveste
despre frică şi despre cum poţi să-ţi depăşeşti frica”. La un atelier, câţiva ani mai
târziu, Tobias a decodificat această poveste despre frică şi a spus celor prezenţi, că
Arhanghelul Rafael era Îngerul Fricii. Energia Arhanghelului Rafael este
disponibilă tuturor celor care au de-a face cu frica şi intenţionează să treaca prin ea,
cu ajutorul virtuţilor iubirii, integrităţii şi curajului. De aceea, este de înteles de ce
Arhanghelul Rafael joacă un rol atât de important în Cartea lui Tobit, o poveste a
multor oameni, puşi faţă în faţă cu fricile interioare şi exterioare.
Tobias, entitatea fermecătoare şi plină de afecţiune cu care conversez, mi-a
spus că a fost Tobias senior şi că m-a cunoscut în acea viaţă ca fiind fiul său,
tânărul Tobias. Tobias a spus că ultima sa viaţă pe Pământ a fost cu puţină vreme
înaintea venirii lui Iisus. El a fost deţinător de pământ şi negustor în acea perioadă.
Un vecin lacom, care era în graţiile oficialităţilor locale, l-a aruncat în închisoare
pentru tot restul vieţii. După spusele lui Tobias, aceea a fost cea mai chinuitoare
dar şi cea mai înălţătoare viaţă a lui. În închisoare a învăţat să elibereze gratiile şi
zidurile umane care-i ţineau spiritul ostatec. Dupa cum povesteşte Tobias, o pasăre
minunată venea în fiecare dimineaţă la fereastra închisorii şi cânta bucuria vietii şi
a libertăţii. La început, lui Tobias îi era necaz pe pasăre, o alunga de acolo, ca sa
poată fi singur, cu suferinţa lui. Într-una din zile, înainte de moartea sa, pasărea s-a
112
aşezat pe fereastră să cânte şi Tobias şi-a dat seama că ce auzea, era mai mult decât
cântecul unei păsări. Era Arhanghelul Mihail, venit să-i ceară să se întoarcă
„dincolo”. Arhanghelul i-a spus lui Tobias că urmau să vină pe Pământ timpuri de
mari transformări. El i-a spus că sufletele înţelepte şi sfinte, care umblaseră pe
calea umană, erau necesare de cealaltă parte, pentru a-i asista pe cei rămaşi pe
Pământ. Tobias a decis să părăsească forma umană şi nu s-a mai întors de atunci,
pe Pământ. Evenimentul la care se referea Arhanghelul Mihail, era trezirea
conştiinţei Cristice din noi, un proces care a început cu Buddha, s-a intensificat cu
Iisus şi a continuat cu Mohammed, cât şi cu alţi profeţi şi oameni sfinţi. Astăzi,
Tobias şi cei din tărâmurile angelice, continuă să ne călăuzească şi să ne sprijine.
Tobias spune că ei nu pot acţiona în locul nostru – noi trebuie să ne asumăm
responsabilitatea pentru propria noastră călătorie şi divinitate – însă ei ne stau
oricând la dispoziţie pentru îndrumare, prietenie şi sustinere. În limbajul obişnuit al
lui Tobias, „voi nu sunteţi singuri, niciodată”.
Personajul Tobias este o energie, un spirit, canalizat prin Geoffrey Hoppe.
Tobias face parte dintr-un grup spiritual, numit Consiliul Crimson. Acest consiliu
are ca obiectiv spiritual să înveţe şi să predea utilizarea energiei pe această planeta
şi în alte locuri ale Universului. Tobias si Consiliul Crimson aduc energia
înţelepciunii, a iubirii şi o perspectivă din cealaltă parte a voalului. Mesajele lui
Tobaias din Consiliul Crimson au început în 1999, printr-un grup de lucrători ai
luminii, din zona Colorado, cunoscuţi ca Shaumbra. Ei obişnuiau să înceapă
sesiunea de comunicari cu vorbe ca acestea: „În acestă zi, eu, Tobias, voi vorbi prin
prietenul vostru, pe care noi îl numim Cauldre (Geoffrey Hoppe), dar în acelaşi
timp, vă vom vorbi fiecaruiă, ne vom adresa inimilor voastre, Sinelui vostru Divin.
Cuvintele pe care le veţi auzi (şi citi) nu sunt atât de importante, pe cât sunt
mesajele, iubirea şi energia, pe care le aducem familiei Shaumbra în această zi”.
Tobias a numit Cercul Crimson „Clasa Noii Energii Spirituale”. El este aici pentru
ca noi să învăţăm dinamica noii împuterniciri şi iluminări. Asa cum a spus Tobias,
noi ajutăm la crearea arhitecturii noii energii. Noi învăţăm cum să integrăm
adevăratul nostru Sine în Sinele nostru Uman, pentru a deveni Divini Umani, care
umblă pe acestă planetă. Pe măsură ce învăţăm despre natura noastră divină, uşor şi
în linişte, noi îi instruim pe ceilalţi ca să-şi accepte şi să-şi înţeleagă propria
divinitate.
“Shaumbra” înseamnă familie şi prietenie interioară profundă, iar conform
lui Geoffrey Hoppe şi Tobias, simptomele shaumbra, adică cele douăsprezece
semne ale trezirii divinităţii tale sunt urmatoarele: 1. Corpul manifestă durere şi
suferinţă, mai ales în zona cefei, a umerilor şi a spatelui. Acesta este rezultatul
schimbărilor intense ce apar la nivelul ADN-ului, pe măsura ce “sămânţa Cristică”
din interior se trezeşte. Aceste dureri vor trece. 2. Sentimentul de profundă tristeţe
interioară, fără nici un motiv aparent. Vă eliberaţi trecutul, din această viaţă şi din
113
celelalte, iar acest lucru determină un sentiment de tristeţe. Această experienţă este
similară cu cea pe care o aveţi atunci când vă mutaţi dintr-o casă în care aţi trăit
foarte mulţi ani, în alta nouă. Oricât de mult v-aţi dori să vă mutaţi în casa nouă,
există totuşi o tristeţe legată de lăsarea în urmă a amintirilor, energiei şi experienţei
acumulate în vechea casă. Tristeţea vă trece. 3. Plângeţi fără nici un motiv aparent.
Motivaţia este similară cu cea de mai înainte. Este bine şi sănătos să lăsaţi
lacrimile să curgă. Ajută la eliberarea vechilor energii din interior. Şi aceasta va
trece. 4. O schimbare bruscă a locului de muncă sau a carierei. Un simptom
frecvent întâlnit. Pe măsură ce vă schimbaţi, lucrurile din jurul vostru se schimbă şi
ele. Nu vă îngrijoraţi de găsirea unui loc de muncă sau a unei cariere perfecte, în
acest moment! Şi aceasta va trece. Vă aflaţi acum în tranziţie şi poate că veţi
schimba mai multe locuri de munca, până când vă veţi stabili la unul, care se va
potrivi pasiunii voastre. 5. Retragerea din relaţiile cu familia. Sunteţi conectaţi cu
familia biologică prin intermediul vechii karme. Când ieşiţi din ciclul karmic,
legăturile din vechile relaţii sunt eliberate. Aparent vă îndepărtaţi de familie şi
prieteni. Şi aceasta va trece. Dupa o perioadă de timp, veţi crea o nouă relaţie cu ei,
dacă va fi potrivit. Relaţia se va baza pe noua energie, fără legaturile karmice. 6.
Tipare neobişnuite de somn. Este posibil să vă sculaţi în timpul multor nopţi între
2:00 şi 4:00 dimineaţă . Multă activitate are loc în interiorul vostru şi aceasta vă
determină să vă treziţi, pentru “o pauză”. Nu vă îngrijoraţi! Dacă nu puteţi adormi,
sculaţi-vă şi decât să staţi în pat şi să vă îngrijoraţi de lucruri umane, faceţi ceva,
orice vă poate ditrage atenţia. Şi aceasta va trece. 7. Vise intense. Acestea pot
include vise despre bătălii şi razboaie, urmăriri sau monştri. Pur şi simplu, eliberaţi
vechile energii din interior pentru că aceste energii ale trecutului sunt simbolizate
adesea, prin războaie, fuga pentru a scap sau fuga dintre oamenii răi. Şi aceasta va
trece. 8. Dezorientare fizică. Uneori, vă simţiţi foarte dezrădăcinaţi. Veţi fi
“provocat spaţial” de sentimentul că nu sunteţi în stare să fiţi cu ambele picioare pe
pământ sau că vă aflaţi între două lumi. Pe masură ce experimentaţi tranziţia către
noua energie, corpul s-ar putea să rămână în urmă. Petreceţi mai mult timp în
natură, pentru a ajuta la încorporarea noii energii în interior. Şi aceasta va trece. 9 .
O “autoconversaţie” mărită. Vă veţi trezi vorbind cu voi înşivă, mai des.
Dintr-o dată veţi realiza că aţi discutat cu voi înşivă, în ultimele 30 de minute.
Apare un nou nivel de comunicare, care se instalează în interiorul fiinţei
voastre şi autoconversaţia este doar vârful icebergului acelei comunicări.
Conversaţiile se vor înteţi şi vor deveni mai fluide, mai coerente şi introspective.
Nu aţi înnebunit, ci doar sunteţi Shaumbra, aţi pătruns în noua energie. 10.
Sentimente de singurătate chiar şi în compania altora. S-ar putea să vă simţiţi
singuri şi desprinşi de ceilalţi. S-ar putea să aveţi dorinţa să fugiţi de grupuri şi
mulţimi. Ca Shaumbra, voi mergeţi pe o cale sacră şi solitară. Pe masură ce
sentimentul de singuratate vă crează anxietate, devine mai dificil să aveţi relaţii cu
114
ceilalţi. Sentimentele de singurătate sunt de asemenea asociate cu faptul că Ghizii
voştri au plecat. Au fost cu voi în toate călătoriile voastre, pe parcursul tuturor
vieţilor. Este timpul ca ei să se îndepărteze, ca să vă umpleţi spaţiul cu propria
divinitate. Şi aceasta va trece. Golul din interior va fi umplut cu iubirea şi energia
propriei tale conştiinţe Christice. 11 . Lipsa pasiunii. S-ar putea să vă simţiţi total
lipsiţi de pasiune, cu o foarte mică dorinţă sau chiar fără dorinţa de a face ceva.
Este în regulă, aceasta este o parte a procesului. Acordaţi-vă timp ca să nu faceţi
nimic! Nu vă luptaţi cu asta, pentru că şi aceasta va trece. Este similar operaţiunii
de rebootare a calculatorului. Este nevoie să fie deconectat un timp, pentru a instala
noul şi sofisticatul software, sau în acest caz, noua energie a sămânţei Christice.
12. Un dor profund, de a merge Acasă. Aceasta este, poate, cea mai dificilă şi
provocatoare dintre condiţii. S-ar putea să experimentaţi o profundă şi
compleşitoare dorinţă de a părăsi planeta şi de a vă reîntoarce Acasa. Acesta nu
este un sentiment de “sinucidere”. Nu este bazat pe furie sau frustrare. Nu vreţi să
faceţi un spectacol sau o dramă din asta, pentru voi sau pentru alţii. Este o parte
tăcuta a voastra, care îşi doreşte să meargă Acasă. Cauza principală este foarte
simplă. V-aţi completat ciclul karmic. V-aţi completat contractul pentru această
viaţă. Sunteţi pregătiţi să începeţi o nouă viaţă în timp ce încă sunteţi în corpul
fizic actual. În timpul acestui proces de tranziţie, aveţi amintiri interioare despre
cum este sa fiţi pe partea cealaltă. Sunteţi pregătiţi să vă înscrieţi pentru o altă serie
de îndatoriri, aici pe Pământ? Sunteţi pregătiţi să vă asumaţi provocările intrării în
Noua Energie? Da, într-adevăr aţi putea merge Acasă, chiar acum. Dar ajuns atât
de departe şi după multe, multe vieţi anterioare, ar fi păcat să plecaţi înainte de
sfârşitul filmului. Şi pe de altă parte, Spiritul are nevoie de voi aici, pentru a-i ajuta
pe alţii în tranziţia lor către Noua Energie. Ei vor avea nevoie de un ghid uman, ca
voi, care aţi pornit în călătorie de la vechea energie, la noua energie. Calea pe care
mergeţi acum vă oferă experienţa care vă face capabili să deveniţi un Învăţător
pentru Noul Om Divin. Oricât de întunecată şi solitară poate fi călătoria voastra,
uneori, reamintiţi-vă că nu sunteţi niciodată singuri.
Dreptul de autor 2001 îl deţine Geoffrey Hoppe, Golden, CO. Pregătit în
colaborare cu Tobias, din Consiliul Crimson. Material distribuit gratuit, fără
scopuri comerciale. De la Tobias prin channeling, transmis prin Geoffrey Hoppe.
Sursă:http://www.shaumbraconstanta.ro

9 iulie 2010 – Cartea lui Tobias


Editura “For you” a publicat în 2004 volumul lui Geoffrey Hoppe, intitulat
„Învăţăturile lui Tobias. Seria Creatorului.” Este vorba de un volum cu o puternică
tentă New Age, aparţinând unui gen literar foarte „gustat” în ultimii ani în special
de publicul american. Autorul acestui volum susţine că dialoghează cu o entitate
superioară care prin intermediul său transmite învăţături fiinţelor umane. Ceea ce,
115
în principiu, ar putea fi ceva nobil şi minunat. Problema reală vine de la conţinutul
acestor învăţături. În marea majoritate a cazurilor, publicul le apreciază tocmai
pentru că sunt foarte facile, ambigue şi laxe. Promit spiritualitate, dar nu cer
eforturi reale şi creează cu dibăcie iluzia „superiorităţii” celor care devin adepţi şi
propagă mai departe acele idei. O astfel de capcană întinde şi volumul lui Geoffrey
Hope, care redă aşa-zisele învăţături spirituale pe care autorul le-a primit de la o
entitate subtilă pe care o numeşte Tobias. Geoffrey Hoppe susţine că pentru prima
dată Tobias i-a „apărut” în 1997, în timpul unei călătorii cu avionul. E vorba de o
comunicare la nivel mental cu această entitate astrală nu foarte elevată. Geoffrey
citise cărţi similare celei pe care a publicat-o el, cărţi din curentul New Age, şi
ajunsese să creadă că a trăit experienţe iluminatorii extraordinare… Sau pur şi
simplu i-a venit ideea că poate şi el să scrie la fel de bine ca ceilalţi autori New-
Age. Geoffrey subliniază convingerea lui că entitatea cu care el comunică este
personajul principal din „Cartea apocrifă a lui Tobias” şi că el însuşi a fost într-o
viaţă anterioară fiul acestuia, care apare de asemenea în istorisirea biblică. Tobias
aparţinea tribului naftali şi trăia în exil în Ninive, unde ardea trupurile celor
executaţi până într-o zi, când i-au căzut scântei fierbinţi pe ochi şi l-au orbit. Fiul
său însă a reuşit, după o serie de aventuri, să îi redea vederea lui Tobias. Oricum,
simbolic şi istoric, Tobias este orb.
În 1999, după un an şi jumătate de „dialoguri” periodice cu Tobias, Geoffrey
Hoppe a înfiinţat Cercul Purpuriu (Crimson Circle), un grup de persoane care se
consideră profesori ai celorlalte fiinţe umane. Ei cred că menirea lor este să facă
publice „mesajele lui Tobias” şi prin intermediul lor să îi îndrume spiritual pe
ceilalţi oameni. Iată cum şi-a demarat activitatea acest grup: „Tobias a informat
micul grup de acolo că Ghizii lor Spirituali erau pe punctul de a-i părăsi. Acest
mesaj a şocat şi consternat pe mulţi dintre ei, dar Tobias le-a explicat, cu multă
dragoste şi blândeţe, că era vremea ca oamenii să-şi accepte responsabilitatea
pentru propria lor divinitate. El a spus că a venit momentul ca oamenii să devină
Îngeri-pe-Pământ şi că, desprinzându-ne de Ghizii noştri şi de majoritatea vechilor
credinţe şi ritualuri, vom începe să ne luăm în primire propria noastră divinitate.
(…)Cercul Purpuriu este grupul de oameni care se numără printre primii ce păşesc
în Noua Energie.” Acest mesaj, care desigur le-a gâdilat egoul multor auto-
intitulaţi profesori, vine în contradicţie cu revelaţiile tuturor religiilor, care ne
învaţă că fiecare om are un Înger Păzitor, înger care ne însoţeşte întreaga viaţă şi ne
ghidează creşterea spirituală. Respingând protecţia şi inspiraţia divină a Îngerului
Păzitor, nu ne vom apropia nicidecum de Dumnezeu! Dar tentaţia Cercului
Purpuriu este puternică… în acestă epocă, fiecare vrea să fie maestru şi foarte
puţini acceptă să fie discipoli. Problema este că nu e suficient să afirmi că eşti
maestru. Ultimele revelaţii pe care Tobias le face prin Geoffrey au loc în Colorado
şi durează 90 de minute, care este intervalul maxim pe care autorul îl poate susţine
116
din punct de vedere fizic şi energetic. Dacă se răsfoieşte cartea, se va vedea ce
ajung oamenii să creadă şi să spună atunci când se lasă conduşi de un „orb”.
„Esenţa mesajelor lui Tobias este simplă: suntem primii care trecem prin
acest proces de transformare spirituală de tip „de la omidă, la fluture”. Vor urma
mulţi alţii. Apoi, va urma întreaga omenire, îngerii şi Spiritul vor veni după noi!”.
Desigur, omenirea evoluează gradat, în ansamblul ei, acesta este mersul firesc al
lucrurilor. Dar pe această planetă au trăit atât de mulţi înţelepţi care le-au dăruit
oamenilor aspiraţie prin măreţia fiinţei lor, compasiune din generozitatea inimii lor
şi învăţături din înţelepciunea lor… Este oare inteligent să presupunem că noi
acum suntem primii? De ce să credem că toţi ghizii spirituali ne-au părăsit şi că
înaintea noastră nimeni nu a atins starea de înţelepciune? De ce să credem că toată
tradiţia spirituală a planetei este nulă ca valoare? Doar ca să ne amăgim în nebunia
noastră că suntem „deschizători de drumuri”?
Îngerii sunt prin menirea lor, în cadrul creaţie,i mesageri între Dumnezeu şi
oameni. Cine ne inspiră oare atunci când ne credem mai presus de îngerii, înaintea
îngerilor? Dar atunci când ne credem mai presus de spirit şi mai presus de
Dumnezeu? Prin această afirmaţie, Tobias îşi dezvăluie natura luciferică. La urma
urmei şi Satana s-a crezut mai presus de Dumnezeu. Aici autorul recunoaşte că
multe mesaje ale lui Tobias sunt „perle”, dar nu-i trece prin cap că sunt doar nişte
prostii scornite de mintea lui şi inspirate de entităţi demoniace. Tobias zice: „…nu
e vorba ca noi să vă predăm vouă. Este vorba despre ce învăţăm noi de la voi”.
„Profesor drag, pătrundem în cercul tău acum, ca să te îmbrăţişăm şi să-ţi
mulţumim şi să plângem de bucurie pentru ceea ce faci.” Moment euforic pentru
egourile din Cercul Purpuriu: nu numai că sunt profesorii celorlalţi oameni, dar
sunt şi profesorii entităţilor care le transmit mesaje şi sfaturi. „…Spiritul cel Etern
nu deţinea controlul. Vă situaserăţi în afara Primei Creaţii.” Oare există vreun loc
în acest vast univers sau vreun moment în spirala aparent nesfârşită a timpului în
care să fie ceva mai presus de Spiritul Divin, mai presus de Dumnezeu? Cu
siguranţă nu. Dumnezeu este atotputernic, dintotdeauna şi pentru totdeauna şi nu
există nimic deasupra lui, nimic care să se sustragă voinţei sale supreme.
Dumnezeu este prezent în fiecare fiinţă umană sub forma Sinelui său divin
nemuritor, Atman. Ori iată că aici orbul Tobias afimă contrariul. „Tot prin ceea ce
treceţi acum, în viaţa voastră, nu se referă la vieţile voastre trecute! Angajamentele
voastre s-au încheiat.” „Nimic din ceea ce aţi făcut pe Pământ nu a fost greşit sau
rău!”. „Nu mai sunteţi legaţi de karmă”. Iată o imensă tentaţie. După ce îi învaţă pe
oameni că sunt mai presus de îngeri, Tobias caută să le distrugă şi simţul
responsabilităţii. Nu contează ce faceţi, spune el. Nu contează ce aţi făcut… Chiar
nu contează dacă facem bine sau rău? Legea karmei, legea cauzei şi a efectului,
este o lege divină universală, care stă la baza întregii manifestări. „Bine faci, bine
găseşti”, spune învăţătura populară. „Cine seamănă vânt, culege furtună”, ne învaţă
117
Iisus. Legile universului sunt aceleaşi de când lumea şi vor guverna întotdeauna
universul. Nu contează că Tobias „afirmă” altceva, iar Geoffrey Hoppe îşi publică
ideile în milioane de exemplare şi se îmbogăţeşte din naivitatea oamenilor. Legea
karmei va continua să funcţioneze, chiar şi pentru el. „Nu a existat niciodată un
Lucifer care să vă arunce din rai. Toate acestea sunt metafore.” Aşa să fie? Un
aforism al înelepciunii spune că „cea mai mare păcăleală a demonilor este să ne
facă să credem că ei nu există”. „Eu, Tobias, împreună cu cei din Cercul Purpuriu
privim în inimile voastre şi în chakra voastră unică.” Poate că privesc ei undeva,
dar fiinţa umană în realitate are 7 chakre principale şi mai multe chakre secundare.
Iată încă o amăgire pentru cei cu voinţa slabă: „Carne, cereale, fructe şi
legume – nu contează, dragi prieteni, astea nu sunt lucruri negative. Acestea sunt
resurse pentru a hrăni corpul vostru biologic.” Întotdeauna calea cea uşoară
amăgeşte uşor oamenii. Este uşor să nu faci nimic, este uşor să nu respecţi nici o
regulă. Dintoteauna falşii profeţi au avut un succes nebun. Ştiţi de ce? Pentru că îi
fac pe oameni să creadă că sunt grozavi aşa cum sunt. Ei afirmă că spiritualitatea
nu necesită eforturi, că nu există consecinţe ale acţiunilor noastre, că nu contează
ce mâncăm sau ce prostii facem.
Pasul următor în amăgirea noilor învăţăcei ai lui Tobias este să-i facă să
renunţe la diferitele tehnici spirituale pe care le practică. Şi mai ales la meditaţie,
care le-ar putea trezi discernământul şi i-ar face să realizeze că sunt manipulaţi şi
prostiţi. „Meditaţiile au fost, în majoritatea lor, chinuitoare şi dificile. Sigur însă că
v-au ajutat să ajungeţi până aici. Vă îndemnăm ca să cinstiţi întotdeauna această
parte a voastră. Dar, pe măsură ce pătrundeţi în Noua Energie, nu mai e nevoie să
staţi zilnic jos şi să meditaţi un anumit interval de timp şi să vă luptaţi cu gândurile
care vă trec prin minte.” Pentru un practicanţii yoga meditaţia este bucurie. Pentru
un credincios creştin rugăciunea este pace. Pentru dervişii sufiţi dansul este extaz.
Toate modalităţile şi tehnicile spirituale trebuiesc practicate stăruitor, cu bucurie,
pentru că ele ne ajută să creştem şi să ne apropiem de Dumnezeu. A te opri din
practica spirituală crezând că ai ajuns la capătul căii spirituale este cea mai
frecventă eroare pe care o menţionează toate tratatele înţelepciunii. Şi iată acum la
ce degradare se ajunge: Tobias îi învaţă pe „profesorii” Cercului Purpuriu să profite
material de pe urma celor pe care îi vor ghida. Tobias afirmă: „În adâncul vostru
există un sentiment că energia banului şi energia Spiritului să nu fie amestecate. Nu
înţelegem de ce voi nu aveţi un respect egal şi echilibrat pentru amândouă. Şi acum
mai venim şi noi cu ceva în plus. Voi sunteţi cei care mergeţi undeva ca să-i
învăţaţi pe alţii. Veţi avea nevoie de o maşină ca să mergeţi la cabinet sau la casa
cuiva. Veţi avea nevoie de căldură şi mâncare. Nu este oare potrivit să fiţi
compensaţi pentru munca pe care o faceţi? Oare nu este potrivit ca cei care au
nevoie de serviciul vostru să consume un anumit gen de energie şi efort ca să
contrabalanseze ceea ce faceţi voi pentru ei? Munca pe care o faceţi pentru ei, ca
118
învăţători, este mult mai valoroasă decât toţi banii lor din bancă. Cât veţi încasa ca
să fiţi ghizi oameni şi să ajutaţi la iluminarea altora?”
Meschinăria acestei abordări nu are nevoie de comentarii. Dar niciodată şi
sub nici o formă nu trebuie să ne imaginăm că banii şi Spiritul au aceeaşi valoare.
Haideţi să revenim la înţelepciunea populară: „Banul este ochiul dracului”. Iar
tentaţia banului, tentaţia materială, este considerată de toate religiile şi căile
spirituale un obstacol foarte mare pe calea spirituală. Isus spunea: „Mai uşor trece
o cămilă prin urechea unui ac decât intră un om bogat în Împărăţia Cerurilor”. Iar
ca pervertirea adepţilor să fie completă, Tobias nu uită nici aspectul sexual: „noi
vorbim mult despre sex, la fel ca şi voi, stăm în jurul vostru şi zâmbim pentru că
nouă nu ne pasă deloc dacă relaţia este între un bărbat şi o femeie, sau oameni de
acelaşi sex. Noi nu avem prejudecăţi în această privinţă. Ceea ce ne face plăcere
este dragostea dintre doi oameni.” Şi atunci de ce oare toate religiile plantei
noastre, exceptând satanismul, avertizează asupra pericolelor pervertirii sexuale?
Principalul efect al homosexualităţii este că îl îndepărtează pe om de Dumnezeu.
Iar oamenii au dreptul să ştie asta. Iniţierea noilor adepţi culminează cu nebunia de
la originea dualităţii lumii. Aşa cum Lucifer s-a crezut mai presus de Dumnezeu, şi
discipolii lui Tobias sunt învăţaţi că: „voi daţi naştere la un nou tip de Divinitate
care nu a mai fost văzut în nici o altă creaţie.” Să ne mai mirăm atunci că după
toată această învăţătură nebunească, Tobias conchide: „ nu puteţi merge înapoi,
acasă. Nu puteţi?” Aici într-adevăr suntem de acord cu Tobias şi Geoffrey Hoppe.
Cei care au crezut toate aceste aiureli şi, fiind amăgiţi, le-au pus apoi în practică,
nu au nici o şansă să pătrundă în Împărăţia Tatălui Ceresc, să revină Acasă. Nu câtă
vreme se lasă conduşi de orbul Tobias, care îi va conduce, ca în proverb, în
prăpastie!

25 iunie 2010 – Îngerii căzuţi


Apocalipsa 12:9 este cel mai clar pasaj din Sfânta Scriptură care descrie
identitatea demonilor: “Şi balaurul cel mare, şarpele cel vechi, numit Diavolul şi
Satana, acela care înşeală întreaga lume, a fost aruncat pe pământ; şi împreună cu
el au fost aruncaţi şi îngerii lui”. Biblia indică faptul că demonii sunt îngeri căzuţi
– îngeri care s-au răzvrătit împotriva lui Dumnezeu alături de Satan. Căderea lui
Satan din cer este, deasemenea, descrisă în Apocalipsa, iar pasajul 12:4 pare să
indice faptul că Satan a atras cu el o treime din îngeri atunci când a păcătuit. În
versetul 6, Iuda face referire la îngerii care au păcătuit. Aşadar, demonii par să fie
îngerii care l-au urmat pe Satan în păcatul lor de răzvrătire împotriva lui
Dumnezeu. Demonii sunt fiinţe spirituale, însă ei pot să apară înaintea oamenilor
chiar şi luând forme fizice. Demonii sau îngerii căzuţi sunt duşmani ai lui
Dumnezeu – însă creştinii spun că ei sunt inamici învinşi deja. Întunecatele duhuri
ale răutăţii au săvârşit două nelegiuiri grele: prima a fost pricina lepădării lor din
119
ceata sfinţilor îngeri; a doua a fost pricina lepădării lor fără putinţă de întoarcere. În
cer ei s-au răzvrătit împotriva lui Dumnezeu; căpetenia lor, oarbă din pricina
părerii de sine, a vrut să se facă deopotrivă cu Dumnezeu. Aruncaţi din cer în
tărâmul de sub cer pentru nelegiuita lor încercare, îngerii căzuţi au pizmuit
fericirea omului nou-zidit şi au săvârşit o nouă fărădelege: amăgindu-l pe om, l-au
tras în căderea lor. Cea din urmă nelegiuire a îngerilor căzuţi a hotărât soarta lor
pentru totdeauna: prin ea au pus asupra lor pecetea răului pe veci; din pricina ei s-a
depărtat de la ei cu desăvârşire harul lui Dumnezeu; au fost lăsaţi în seama lor, în
seama răutăţii lor, în seama păcatului lor, pe care l-au zămislit şi l-au născut în ei,
de care au îngăduit să se pătrundă firea lor. De atunci nici un gând bun, nici un
simţământ bun nu i-a mai venit îngerului lepădat. El este pe de-a-ntregul, cu totul,
cufundat în rău, doreşte răul, născoceşte răul. Ars de o sete nepotolită a răului, el
caută să se sature prin rău – şi nu poate. Tot răul pe care l-a săvârşit şi îl săvârşeşte
i se pare neîndestulător în faţa răului pe care şi-l închipuie el, pe care îl caută setea
lui cea cu neputinţă de răbdat după rău.
Îngerii căzuţi sunt tot făpturi spirituale, sunt îngerii care l-au urmat pe
Lucifer când acesta a fost alungat din rai. Îngerii căzuţi au aproape toate însuşirile
îngerilor cu diferenţa că ei luptă neîncetat împotriva lui Dumnezeu, prin înşelarea
şi aducerea omului în păcat, împiedicându-l să urce la ceruri de unde ei au fost
aruncaţi. Păcatul lor cel mai mare este ura neînfricată faţă de Dumnezeu şi de aceea
căderea lor este fără întoarcere. Ei î-şi găsesc plăcerea în tot felul de păcate, însă
neputând săvârşi păcate trupeşti, ei păcătuiesc cu imaginaţia şi cu simţurile, astfel
esenţa lor este obiţnuită cu viciile fireşti ale cărnii. Îngerii căzuţi nu pot face nimic
rău Creatorului, aşa că ei î-şi indreapta intreaga răutate şi cruzime asupra
oamenilor. Ei sunt îngerii lui Satana şi îi urmează poruncile pentru că se află într-
un număr foarte mare şi sunt răspândiţi peste tot, în văzduh, pe pământ, în pământ,
chiar şi în apă. Ei au puterea de a intra în mintea omului şi a-i insufla gânduri
păcătoase. De remarcat este şi faptul că cel mai des se întâlneşte nu instalarea
diavolului în om, ci posedarea omului de diavol, prin subordonarea sufletului său
voinţei demonice. Duhul necurat al îngerilor căzuţi se poate înfăţişa sub chip
prefăcut, întinzând oamenilor o cursă sau alta. Ei reprezintă fie răul evident, fie se
transformă în înger luminos, luând chipul binelui şi cucerind astfel minţile noastre.
Demonii au nevoie de hrană, iar aceasta este jertfa în sange. În timp ce
jertfele se ard în foc, sângele lor se transformă prin ardere în vapori si
descompunându-se în felul acesta în particule fine, se prefac într-o stare ce
corespunde esenţei demonilor. Ei se hranesc cu aceste emanaţii, desigur nu aşa ca
şi cum le-ar mânca sau şi-ar umple cu ele pântecele, ci asemenea unor animale,
care primesc hrana cu întreaga lor fiintă. Din aceasta pricină demonii devorează cu
lăcomie gazele ce se produc în urma arderilor jertfelor si inhalează fumul
aromatelor, ca substanţe pe care şi le-au adaptat pentru hrană. Iată cum se explică
120
cultul jertfirilor în faţa statuilor idolilor, la popoarele păgâne.Toţi idolii la care se
închină păgânii sunt înconjuraţi de diavoli, care îşi găsesc plăcerea în jertfele care
se fac. Iată de ce toate sectele satanice aduc jertfe de animale şi chiar umane
demonilor la care se închină si slujesc. Când se aducea jertfă unui idol, o parte din
ea era destinată demonului. De aceea, cel care bea din paharul umplut pentru
jertfele idoleşti, bea din paharul demonului. Sfântul Ioan Gură de Aur ne spune
exact motivele pentru care Dumnezeu îngăduie existenţa diavolului şi nu-l
împiedică să ne atace cu ispitele sale: “în primul rând ca să cunosti că te-ai făcut
mai puternic decât diavolul, însemnându-te, în numele lui Hristos, cu Crucea
dătătoare de viată; în al doilea rând, pentru trai în smerenie şi a nu te preamări prin
bogăţia darurilor si să nu uiţi neputinţa ta şi puterea celui care te ajută; în al treilea
rând pentru că acest duh necurat, văzându-ţi răbdarea cu care rezişti ispitelor, să se
convingă că l-ai părăsit cu desăvârşire şi te-ai depărtat de el”. Satan şi îngerii lui nu
şi-au pierdut prin căderea lor voinţa, simţurile, şi marea lor inteligenţă. Peste tot în
Biblie este accentuată viclenia şi cunoştinţele lor. Ei Îl cunosc pe Domnul Isus, se
pleacă înaintea Lui Îl recunosc ca Fiu al Celui Preaînalt, ca Dumnezeu Sfânt, dar
niciodată nu Îl numesc „Domn“. Demonii cred că Dumnezeu este Unul, deci ei
mărturisesc acest lucru ca şi iudeii, însă această credinţă este numai o credinţă
intelectuală pentru că Icaov spune că „… dracii cred şi se înfioară“. Deci ei
recunosc că între ei şi Domnul Isus nu poate exista nici o părtăşie şi ascultă când li
se porunceşte să iasă din oameni. Îngerii căzuţi îşi împing victimele spre a se
autorăni sau autodistruge şi sunt conştienţi că destinul lor veşnic este chin şi
distrugere, aşa că ţinta lor este să distrugă cât de mulţi oameni posibil şi să îi ducă
în locul hotărât pentru ei pe veşnicie. Demonii au însă o experienţă de secole
petrecute în jurul omului. Ei ştiu exact cum reacţionează oamenii în anumite
situaţii. Aceasta se poate compara ilustrativ, cu oamenii care prin observaţii şi fiind
alături de animale, ştiu cum acestea reacţionează în anumite situaţii. Vicleni
precum sunt, Satan şi îngerii săi intervin cu dibăcie în dorinţele oamenilor. Aşa a
venit de fapt păcatul în lume.
Aşa cum Biblia îi numeşte pe îngerii aleşi „duhuri slujitoare“, pe demoni
Biblia îi numeşte „duhuri rele“. Ei sunt deosebit de activi în distrugerea adevărului
şi răspândirea minciunii, iar caracterul lor rău se evidenţiază în special prin
necurăţie. De aceea citim deseori despre „duhuri necurate“. Satan nu dă numai
„târcoale ca un leu care răcneşte“, ci el apare oamenilor şi ca „înger de lumină“,
otrăvind gândirea oamenilor, promiţându-le libertatea. Pentru aceasta el foloseşte
învăţători falşi. Aceştia povestesc istorii frumoase despre libertate, despre voinţa
proprie şi le pun înainte oamenilor perspectivele a tot felul de plăceri. Prin
inspiraţia acestor duhuri s-au ţinut predici despre libertatea sexuală. Urmările ?
Familii distruse, apariţii de tot felul de forme de viaţă conjugală, familii
dezechilibrate, tineri neînfrânaţi. Premisele libertăţii se dovedesc a fi factori ce
121
conduc spre dependenţe mortale. Cutremurător de mulţi se lasă momiţi… Sfânta
Scriptură ne spune că duhurile rele au facut parte, la început, din lumea îngerilor
buni, dar prin răzvrătire au rupt comuniunea lor cu Dumnezeu. Despre aceste
duhuri, Sfânta Scriputră ne vorbeşte în unele locuri, numind pe îngerii căzuţi
duhuri rele, duhuri necurate, duhuri ale răutăţii, diavoli, draci, demoni, îngerii
diavolului, îngerii Satanei, iar căpetenia lor este numită diavolul, ispititorul,
Satana, Belzebul, Veliar, domnul lumii acesteia , domnul puterilor aerului, domnul
dracilor şamd. Duhurile rele sunt şi ele în număr indefinit de mare, constituind o
adevărată împărăţie a răului şi prezintă o ie¬rarhie, căci nu numai că au o căpetenie
a lor, Satana, ci se găsesc împărţite pe trepte diferite : începătorii, domnii şi
stăpânii întunericului. Mântuitorul însuşi confir¬mă existenţa diavolului în
răspunsul dat fariseilor care îl acuzau că scoa¬te demonii cu ajutorul domnului
acestora. Diavolii nu sunt personificari ale răului, ci fiinţe reale, rele, pe care le
aşteaptă pedeapsa veşnică, fiinţe reale şi raţionale care cugetă, “cred şi se
cutremură”, dar nu se mântuiesc, au voinţă pro¬prie, păcătuiesc dintru început şi îşi
au planurile lor. Biserica a crezut totdeauna în existenţa duhurilor rele, cum
dovedeşte practica ei de la botez, când celui ce se botează i se cere lepa¬dare de
diavolul, de toţi îngerii lui şi de lucrurile lui.
Apariţia duhurilor rele pe Pământ se datorează despărţirii libere de
Dumnezeu a unora dintre îngeri din mândrie, dorind să aibă fericirea în ei şi prin ei
şi nu prin relaţia cu Dumnezeu. Acest lucru îl arată sfântul Vasile cel Mare
descriind că¬derea Satanei, în opoziţie cu persistenţa lui Mihail în comuniune cu
Dum¬nezeu : “De unde este rău omul ? Din propria lui libertate. De unde este rău
diavolul ? Din aceeasi cauză, având şi el viaţa liberă şi prin liberta¬tea lui având
putinţa să rămână lângă Dumnezeu sau să se înstrăineze de El. Mihail era înger şi a
rămas lângă Dumnezeu pentru vecie. Satana era înger şi a căzut din treapta lui. Pe
acela voinţa liberă l-a păzit în cele de sus ; pe acesta libertatea alegerii l-a alungat.
Pe acela l-a salvat nesăturarea de iu¬birea lui Dumnezeu, pe acesta l-a făcut
lepădat depărtarea de Dumnezeu. Acesta este răul: înstrainarea de lumină. O mică
întoarcere a ochiu¬lui ne face să fim cu soarele sau cu umbra trupului nostru. Cel
ce priveşte spre soare se luminează îndată; cel ce se întoarce spre umbră va avea
parte în suflet de întuneric. Astfel diavolul are răutatea prin libera alegere, dar firea
lui nu e opusă binelui”.
Explicaţia creştină a răului ca provenind din folosirea libertătii este singura
care nu leagă răul de esenţa realităţii, a realitătii eterne sau a ce¬lei create de
Dumnezeu. Sfântul Vasile cel Mare zice: ” Răul este o lipsă a binelui. Ochiul a fost
creat, orbia s-a produs ulterior prin pierderea ochilor… Aşa şi răutatea nu are o
subzistenta proprie, ci vine dupa aceea, datorită rănilor sufletului.” Dar nici
existenţa şi mărimea răului din lume nu s-ar putea explica numai din libertatea
umană. Trebuie să admitem o origine suplimen¬tară a răului, libertatea unor spirite
122
mai puternice decât spiritul uman, ca¬pabile de un rău cu mult mai mare, dar nu o
origine a răului în libertatea spiritului divin atotputernic, căci atunci nu ar mai fi
posibilă mântuirea lumii de rău. Oricât ar fi de stăpânit de rău, omul poartă în sine,
totdeauna, resturi de bine, rezistente împotriva răului, puteri de întoarcere spre bine
prin convertire şi puteri de frânare a răului şi de căinţă pentru el. Îngerii căzuţi, în
schimb, nu mai păstrează în ei nici un rest de bine. Răul le-a devenit o a doua
natură a lor. Dar chiar şi răul produs de duhurile rele nu-şi are originea în fiinţa lor,
ci în libertatea lor, care consimte neîncetat cu ei. Posibilitatea căderii unor îngeri şi
transformarea lor în duhuri rele, este implicată în faptul că au natura spirituală
creată, deci ca sunt fiinţe raţionale şi libere, mărginite, putând să rămână şi să
progreseze în bine, precum şi să se îndrepte spre rău. Căci orice creatură este
schimbătoare, numai ceea ce este necreat este neschimbător. Diavolul s-a făcut din
proprie iniţiativă cauza căderii pentru sine şi pentru ceilalti; înainte de diavol n-a
păcatuit nimeni, iar el a căzut nu fiindcă în natura sa ar fi fost sădita aplecarea spre
rău, ci fiind creat bun s-a hotarat el însuşi spre păcat. Sfantul Ioan Damaschin,
vorbind despre aceasta, zice : “Dintre puterile îngereşti, întâistătătorul cetei celei
mai de jos nu a fost rău prin natură, ci a fost bun, a fost făcut spre bine, şi nu avea
în el, de la Creator, nici cea mai mică urmă de răutate; cu toate acestea, el n-a
su¬ferit luminarea şi cinstea pe care Creatorul i-a dăruit-o, ci, prin voinţa lui liberă,
s-a mutat de la starea sa naturală la o stare contrara naturii sale şi s-a ridicat
împotriva lui Dumnezeu care l-a facut, voind sa se împotrivească Lui… “
Cât priveşte căderea îngerilor răi, biserica nu a formulat o învăţătură
oficiala.Totuşi, se poate determina cu siguranţă că aceasta a avut loc înainte de
începutul istoriei umane, daca se are în vedere că: de la crearea îngerilor până la
căderea unora a trebuit să treacă un oarecare timp; diavolul a apărut ca ispititor al
celor dintâi oameni, deci căzuse înainte de a fi fost creat omul, şi că Sfânta
Scriptură ne spune că „dia¬volul păcătuieşte dintru început”. Căderea îngerilor răi
a fost, după învăţătura Bisericii, radicală şi de¬finitivă, pentru ei nemaiexistând
posibilitatea mântuirii. Consecinţa căde¬rii lor este condamnarea veşnică.
Diavolului şi îngerilor lui le este pre¬gatit focul cel veşnic, greşeala lor fiind
aşa de mare şi împietrirea totală, încât nu mai pot fi cruţaţi, căci nu şi-au păstrat
vrednicia şi au părasit locaşul în care au fost aşe¬zaţi la creaţie. Sfântul Ioan
Damaschin spune: “După cădere ei nu mai au posibilitatea pocăin¬ţei, după cum
nu o au nici oamenii după moarte”.

Cartea lui Enoch


Cartea lui Enoch face parte din Evangheliile considerate “apocrife”, nume
dat încă din vechime de către biserică scrierilor care provin din ambianţa iudaică,
fiind legate de istoria originii creştinismului, dar care nu sunt incluse în canon. În
vechime, cu trecerea timpului aceste scrieri au fost uitate sau chiar pierdute Şi nu
123
au fost redescoperite decât foarte recent. O astfel, de lucrare este Cartea lui Enoch
care a fost regăsită de abia la finalul secolului 18 în nişte manuscrise etiopiene.
Această carte este de o foarte mare importanţă pentru biserica creştină din
timpul primelor secole, carte în care Noul Testament este numit “scriptură sfântă”.
Această lucrare se ocupă de îngeri şi este o autentică mină de informaţii; se poate
spune că această carte prezintă o angeologie clar dezvoltată, o adevărată doctrină a
îngerilor. Chiar de la începutul cărţii autorul vorbeşte despre făpturi înaripate,
mesageri divini, afirmând că ştie de existenţa lor atunci când scrie: “Acesta este cel
pe care mi l-au arătat îngerii; am ascultat tot ce mi s-a spus şi am notat totul, nu
pentru această generaţie, ci pentru cea care va să vină, generaţia viitoare.” Dar
capitolul cel mai important este capitolul şase, denumit şi „Cartea celor vigilenţi”,
aceasta trebuie considerată una dintre cele mai vechi informaţii legate de existenţa
îngerilor căzuţi. Din lunga listă cu îngeri căzuţi putem enumera pe Asael, Batraal,
Anani, Ramuel, Ezeqeel şi mulţi alţii. Textul Cărţii lui Enoch poveşteşte despre
aceştia că: “şi-au luat de soţii pe fiicele oamenilor şi ele i-au învăţat incantaţii şi
magie, le-au vorbit depre puterea plantelor şi a rădăcinilor lor. Ele au rămas
însărcinate şi au născut nişte copii giganţi. Aceştia mâncau toate fructele pe care le
cultivau oamenii, până când oamenii şi-au dat seama că nu mai pot să-i hrănească.
Atunci, giganţii au început să păcătuiască împotriva păsărilor, animalelor,
reptilelor, peştilor, mâncăndu-le carnea şi bându-le sângele. Pământul acuza de
toate aceste atrocităţi pe nedoriţi.” Un alt pasaj din Cartea lui Enoch spune:” Odată
cu îngerii căzuţi a venit pe Pământ răul, aceştia învăţându-i pe oameni să fabrice
arme şi paloşe, să cunoască valoarea aurului şi a pietrelor preţioase, să.practice
magia şi astrologia, să se lupte. Pe femei, îngerii căzuţile-au învăţat să se machieze,
să poarte bijuterii, să se împopoţoneze. În consecinţă, prezenţa lor nu a condus la o
dezvoltare a cunoaşterii, ci la apariţia păcatului, impurificării şi a războaielor. Cu
multe referiri la prezenţa îngerilor există şi un alt text apocrif intitulat „Cartea
Giubileelor”, cunoscut şi drept “Mica Geneză”, pentru că în ea sunt povestite
evenimentele de la creaţia lumii până în momentul în care Moise a primit, pe
muntele Sinai, de la Dumnezeu legile . Deşi Vechiul Testament nu spune nimic
despre momentul în care Dumnezeu a creat îngerii, Cartea Giubileelor spune clar
că încă din prima zi a Genezei, Dumnezeu a creat îngerii şi spiritele naturii. În
această carte este scris că de fapt Angelus Faciei, îngerul care se află întotdeauna
alături de Dumnezeu, este cel care i-a explicat lui Moise procesul Genezei: “Aici
sunt scrise toate lucrurile creaţiei, modul în care Dumnezeu a creat lumea în şase
zile şi s-a odihnit în cea de-a şaptea, cum creaţia este sfântă pentru că este a lui
Dumnezeu şi pentru că El şi-a lăsat semnătura asupra ei. În Cartea Giubileelor este
descris cum în prima zi Dumnezeua creat atât cerul din înalturi cât şi pământul şi
apele şi toate corurile îngereşti care trebuie să-l ajute la desăvârşirea creaţiei.
Corurile îngereşti sunt formate din îngeri cu diferite funcţii; unii rămân întotdeauna
124
alături de Dumnezeu, alţii sunt îngerii care sunt alături de sfinţi, ajutându-i în
misiunea lor sau îngerii protectori ai oamenilor, sau îngerii care protejează natura şi
spiritele naturii, ale focului, vântului, furtunii, a zăpezii şi grindinei, ai tunetelor şi
trăznetelor, ai frigului sau ai căldurii, ai perioadelor ploioase sau ai primăverii, ai
toamnei, îngeri protectori ai tuturor spiritelor care există în cer, pe pământ, pe
culmi şi în abisuri, ai luminii şi ai întunericului, al zorilor şi al serii, toţi fiind
ghidaţi de înţelepciunea inimii divine.”
În literatura angelologică, cu toate că există o mulţime de cărţi, două opere
se detaşează prin forţa divină pe care o emană: Dialoguri cu Îngerul, scrisă de Gita
Mallasz şi Cartea lui Enoh. Ambele scrieri sunt „periculoase” şi bulversante pentru
cei dogmatici, care pretind că sunt preocupaţi de spiritualitate. Pentru că ambele
arată clar că se poate dialoga direct cu Dumnezeu şi cu Îngerii, fără vreun
intermediar, fie el preot sau rabin. Din acest motiv, cele două cărţi sunt în mod
deliberat „uitate” sau cenzurate, căci autorităţile religioase nu agreează textele care
oferă o mare libertate celor care le citesc. Unul dintre cele mai enigmatice
manuscrise descoperite la Marea Moartă este Cartea lui Enoh, text considerat
apocrif de către autorităţile bisericeşti. În urma unor îndelungate controverse,
cercetătorii au ajuns la concluzia că aceasta a fost „cartea de căpătâi” a lui Iisus şi
că El o ştia pe de rost, ceea ce explică numărul mare de pasaje din Cartea lui Enoh
citate în Evanghelii. Teologii experţi în Sfânta Scriptură au afirmat timp de sute de
ani, în decursul secolelor al XIX-lea şi al XX-lea, că textele lui Enoh au fost scrise
cu cel puţin 100 de ani şi cu cel mult 300 de ani după moartea lui Iisus. A existat o
întreagă dispută asupra subiectului anteriorităţii Cărţii lui Enoh faţă de Evanghelii.
Însă descoperirea manuscriselor din cea de-a patra cavernă de la Qumran a permis
stabilirea în mod ştiinţific a faptului că textele lui Enoh disponibile la ora actuală
sunt anterioare cu cel puţin 200 de ani naşterii lui Iisus.
Una din implicaţiile majore ale acestei descoperiri este faptul că astfel se
dovedeşte că Iisus era un foarte bun cunoscător al Cărţii lui Enoh, că aceasta era de
fapt cartea Lui preferată, dacă ţinem cont de numărul frazelor „enohiene” care se
regăsesc în rostirile Sale, aşa cum sunt ele relatate în Evanghelii. Mai mult,
scrierile lui Enoh propulsează cititorul într-o nouă şi fascinantă dimensiune, cea a
lumilor astrale. Ele conţin toate revelaţiile pe care ni le-au adus cercetările realizate
în ultimii anii asupra experienţelor de la graniţele dintre viaţă şi moarte. De
asemenea, revelaţiile cuprinse în Cartea lui Enoh sunt întru totul la unison, până în
cele mai mici detalii, cu descoperirile lui Robert Monroe referitoare la experienţele
extracorporale (ieşirile din corpul fizic în decursul dedublării astrale) – de pildă,
fenomenul retrăririi in extenso a vieţii de până în acel moment (faptul de a-ţi
revedea întreaga viaţa „defilând” prin faţa ochilor). Cartea lui Enoh, reprezintă
totodată una dintre cele mai vechi şi mai importante surse ale tradiţiei creştine în
ceea ce priveşte descrierea îngerilor. Excepţional de moderne, cu implicaţii
125
deosebit de importante datorită vechimii lor, dialogurile lui Enoh cu Dumnezeu şi
cu Îngerii (Uriel, Gabriel, Mihail şi Rafael) reprezintă un document de importanţă
capitală, care merită să fie citit de cât mai mulţi oameni. Cartea lui Enoh era şi un
text sacru evreiesc, înainte ca reformatorul evreu Simon Ben Jochai să o condamne
vehement, în anul 70 d.C., împreună cu toţi cei care ar îndrăzni s-o citească.
Motivul acestei mânii era acela că Alesul despre care vorbeşte Enoh semăna foarte
mult cu Fiul Omului, cu Mesia despre care începea să se vorbească. Apoi, povestea
Îngerilor care nu ezitau să flirteze cu fiicele oamenilor îl indignase profund. În
antiteză, Iuda Tadeu, fratele lui Iisus, citează în mod deschis din Cartea lui Enoh în
epistola sa redactată în anul 61, deci la aproximativ 30 de ani după moartea lui
Iisus. Este un fapt logic, de vreme ce creştinii preţuiau foarte mult această scriere,
care era inclusă în canonul biblic al acelor vremuri.
Timp de aproape 300 de ani după Iisus, Cartea lui Enoh a fost neobosit
copiată şi recopiată, ca toate celelalte pergamente cu scripturi sfinte. De-abia în
anul 325, atunci când un prim conciliu ecumenic hotărăşte să compună Biblia şi să
aleagă textele care vor deveni „publice” sau „ascunse” publicului, Cartea lui Enoh
şi Cartea lui Tobias vor fi clasificate în categoria cărţilor cu conţinut secret. Cu
toate acestea, Cartea lui Enoh îşi continuă cariera literară până când un exeget
decide să întocmească un catalog critic al tuturor textelor „apocrife”. Italianul
Filastrius din Brescia, indignat şi el de aceşti Îngeri ştrengari, o condamnă în
catalogul său „raţional” de texte eretice „Liber de Haeresibus”. Un alt motiv al lui
Filastrius pentru a-şi justifica verdictul l-a constituit prezenţa cu totul de neînţeles a
frazelor rostite de Iisus, „copiate” în Cartea lui Enoh. După el, aceasta dovedea un
singur lucru: redactarea ei era în mod obligatoriu ulterioară celor patru evanghelii
ale lui Matei, Marcu, Luca şi Ioan.
În 1906, la aceeaşi concluzie a ajuns şi preotul François Martin, (fără să ştie
că manuscrisul lui Enoh era de fapt anterior, grotele de la Qumran având să fie
descoperite de-abia în 1947), care scria că „incredulii văd în Cartea lui Enoh un
mijloc puternic, irezistibil, de a ruina din temelii credinţa creştină, dacă ar fi
adevărat că această Carte ar fi anterioară naşterii lui Iisus”. Este aşadar de înţeles
de ce conciliul din Laodiceea, din secolul al IV-lea, a validat concluzia lui
Filastrius, condamnând definitiv Cartea lui Enoh. Numai puţine exemplare au
reuşit să supravieţuiască acestui conciliu, graţie unor bibliotecari competenţi. Iar
cele care au reuşit aceasta, nu au rezistat în faţa îngrozitoarei Inchiziţii… Aceasta a
ars ultimele exemplare, împreună cu proprietarii lor, ceea ce i-a descurajat definitiv
pe colecţionarii de cărţi interzise. Iar timp de 1400 de ani nimeni nu va mai auzi
nimic despre ea, ajungându-se chiar ca existenţa ei să fie complet uitată. Însă în
1773 exploratorul scoţian James Bruce a găsit, într-o veche mănăstire din Abisinia
(Etiopia), câteva copii intacte ale Cărţii lui Enoh. Acei călugări din deşert
reproduceau cu fidelitate Cartea, din generaţie în generaţie, de îndată ce copiile lor
126
se alterau, pur şi simplu pentru că în cadrul Bisericii Etiopiene Cartea lui Enoh era
în continuare considerată o carte sfântă, care făcea parte din scripturile lor
canonice. Bruce a adus cu el trei exemplare, unul pentru Universitatea din Oxford,
unul pentru el însuşi şi încă unul pe care l-a oferit regelui Ludovic al XV-lea al
Franţei. Graţie acestei descoperiri a lui Bruce, Cartea lui Enoh a ieşit din nou din
umbră. Însă de îndată ce, în 1821, lingvistul englez Richard Laurence, profesor la
Oxford, reuşeşte să traducă această lucrare din etiopiană în engleză, el îi insuflă,
fără să ştie, o nouă viaţă.
Revitalizată de interesul care i se arată, Cartea lui Enoh se „trezeşte” pe
deplin, pentru că toate celelalte exemplare care supravieţuiseră Evului Mediu
creştin european reapar la suprafaţă: în 1832, un cercetător găseşte, aparent
întâmplător, în Biblioteca Vaticanului câteva fragmente dintr-o versiune în limba
greacă. În 1880, profesorul rus Popov găseşte o versiune moldovenească,
incompletă, datând din secolul al XVII-lea. Ea va fi urmată, 6 ani mai târziu, de o
alta găsită în Iugoslavia, mult mai importantă: profesorul Sokolov descoperă şi el,
tot „din întâmplare”, în arhiva Bibliotecii Naţionale din Belgrad, o Carte a lui Enoh
acoperită de praf. După o examinare lingvistică, manuscrisul îşi dezvăluie tainele:
fusese scris într-un amestec de bulgară veche şi de sârbă medievală din secolul al
XV-lea, numită şi „slavonă”, o limbă arhaică. Această versiune de la Belgrad va
deveni Cartea secretelor lui Enoh, Cartea lui Enoh slavonă, sau Enoh 2. Primele
traduceri au fost realizate de preoţii Morfill – în engleză, Bonwetsch – în germană
şi François Martin – în franceză. Analizele lingvistice mai avansate au demonstrat
că stilul de redactare provenea din traducerea unei cărţi greceşti. Marea noutate
consta în text: acesta era complet diferit de versiunea etiopiană (sau Enoh 1), fiind
însă complementară acesteia. Şi, ca şi cum toate Cărţile lui Enoh s-ar fi înţeles
între ele, un an mai târziu, în 1887, săpăturile arheologice franceze realizate în situl
egiptean de la Akhmin au dus la descoperirea unei copii a Cărţii lui Enoh în
versiune greacă. Această versiune a fost tradusă în 1892 în franceză de preotul
Bouriant. Examinările lingvistice comparative ale tuturor ediţiilor disponibile au
permis stabilirea, cu deplină certitudine, a faptului că, iniţial, Cartea lui Enoh a fost
scrisă în versuri, stil care s-a pierdut în decursul traducerilor succesive. După cum
explica profesorul Laurence în ediţia din 1911 a Enciclopediei Britannica, „câteva
pasaje incomprehensibile au făcut chiar să fie necesară retraducerea pasajelor
etiopiene în greacă, apoi din greacă acestea au fost traduse în aramaică pentru a se
detecta repetiţiile din versiunea greacă”. Laurence presupune astfel că versiunile
etiopiană, slavonă şi greacă proveneau dintr-o singură sursă, dintr-o singură carte,
cea originară, autentică, scrisă într-o limbă semitică. Însă aceasta era definitiv
pierdută în negura vremurilor – cel puţin, aşa s-a considerat până la fantastica
descoperire a manuscriselor de la Qumran, din 1952, care aveau să dovedească
anterioritatea absolută a Cărţii lui Enoh faţă de toate celelalte texte creştine. La
127
întrebarea „Cum se explică faptul că extrase din Cartea lui Enoh se regăsesc în
Noul Testament?”, Joszef Milik, un renumit specialist în manuscrisele de la Marea
Moartă, a răspuns: „Nu ştiu. Sfântul Iuda îl citează până în cele mai mici
amănunte, ceea ce demonstrează clar că în acele vremuri Cartea lui Enoh era
considerată un text de referinţă”. În noiembrie 1991, Profesorii James Robinson şi
Robert Einsmann de la California State University din Long Beach au ţinut o
conferinţă de presă la New York pentru a prezenta un nou manuscris de la Qumran,
total necunoscut publicului. Prezentând peste 200 de fotografii ale unor fragmente
din manuscris, cei doi experţi au comentat în faţa reprezentanţilor mass-media
rezultatele muncii lor de asamblare şi de traducere a textului. Efectul senzaţional al
acestei conferinţe a relansat imediat scandalul manuscriselor de la Marea Moartă,
ţinute secrete, în cea mai mare parte a lor, de către Vatican. Aceasta l-a determinat
pe jurnalistul Stephan Hoeller să scrie în 1992 în revista Gnosis Spring: „Membrii
echipei de la Qumran erau aproape în exclusivitate preoţi catolici, cu excepţia
profesorului John Allegro. Aceste manuscrise ar fi rămas necunoscute publicului
dacă Edmund Wilson nu ar fi publicat în 1955 o serie de articole în cotidianul The
New Yorker, în care arăta că Vaticanul se temea ca aceste documente să nu reveleze
informaţii defavorabile creştinismului, precum şi comunităţii evreieşti aflate la
originea Noului Testament.
Imediat după publicarea articolelor lui Wilson în The New Yorker, numărul
de documente de la Qumran făcute publice a diminuat brusc şi apoi s-a redus la
zero. Toţi specialiştii sunt de acord că fragmentele cele mai „sensibile” din punct
de vedere teologic i-au fost încredinţate preotului de origine poloneză, Milik.
Aproape toate manuscrisele nepublicate erau în mâinile sale şi au rămas astfel până
în ziua de azi, iar această echipă de la Qumran a ridicat o adevărată „cortină de
fier” în jurul fragmentelor. A trebuit să apară protestul public al dr. Allegro, din
1985: „De ce oare colegii mei ţin ascunse aceste comori? Publicul trebuie să afle
despre ele…”. Astăzi, această „cortină de fier” a căzut, îndeosebi după ce
Huntington Library din San Marino, California, a decis să facă publice fotografiile
acestor manuscrise. Atunci, cărui fapt i se datorează această întârziere? Criticii
acuză Vaticanul şi pe specialiştii săi, în special pe Milik. Oare au descoperit pasaje
atât de „periculoase” în aceste manuscrise încât au fost nevoiţi să le păstreze
secrete? Concluzia care se impune de la sine este una singură: Cartea lui Enoh era
într-adevăr cartea favorită a lui Iisus. De fapt, în Cartea lui Enoh regăsim prezenţa
cristică într-un mod tainic, ca şi cum această scriere nu fusese decât o imensă
repetiţie, un avertisment extraordinar dincolo de timp şi de spaţiu, adresat tuturor
celor care îşi dau pur şi simplu osteneala de a deschide cărţile. În ceea ce-l priveşte
pe Enoh, tradiţia spirituală afirmă că a fost un mare iniţiat care a trebuit să
realizeze legătura între cer şi pământ. El şi-a asumat sarcina dificilă a învăţării şi
ghidării oamenilor, aplanând conflicte şi îndemnând mereu la bine şi la progres. El
128
era numit „Pacificatorul”, fiind o fiinţă umană foarte evoluată spiritual. Acesta a
fost probabil motivul pentru care Enoh „a fost luat în ceruri”, unde a primit iniţieri
şi revelaţii secrete. La revenirea sa, după cum afirmă tradiţia spirituală, „Enoh a
rămas ascuns şi nici o fiinţă umană nu ştia unde anume el trăia, ce făcea şi care
erau intenţiile sale”. Parte integrantă a misiunii sale a fost intensa activitate de
răspândire a învăţăturilor divine. Există referiri conform cărora el ar fi scris 366 de
cărţi. În tradiţia iudaică se afirmă că „în timp ce Enoh le vorbea oamenilor, aceştia
au văzut un armăsar alb coborând din ceruri, în mijlocul unui vârtej de vânt şi de
praf. Enoh le-a spus celor ce se aflau acolo că acel armăsar a coborât din ceruri
pentru a-l lua pe el într-o lungă călătorie, din care însă el nu se va mai întoarce
printre oameni”.

Creaţionismul / Geneza (partea III-a


În mitologia incaşă Manco Capac, care este fondatorul Imperiului Incaş, dar
şi unul din oamenii care, conform unor mituri, au fost creaţi odată cu însăşi lumea.
În mitologia incaşă, mitul creaţiei lumii se bazează pe informaţiile transmise prin
iconografia şi arhitectura civilizaţiei Inca şi pe cale orală de către oamenii băştinaşi
ce au supravieţuit. Conform acestor informaţii, pentru incaşi, la începuturi,
pământul era învăluit în întuneric. Apoi, din lacul numit Collasuyu (astăzi
Titicaca), s-a înălţat zeul Viracocha (Con Tiqui Viracocha), aducând cu el câţiva
oameni. Zeul a creat soarele (Inti), luna şi stelele pentru a lumina lumea. Din
pietre, Viracocha a modelat mai mulţi oameni, mai ales femei, pe care le-a creat
deja însărcinate. Apoi zeul a trimis oameni în toate colţurile pământului, însă a
reţinut cu sine un bărbat şi o femeie la Cusco, locul despre care se credea că este
„centrul lumii”. Un alt zeu creator a fost Con, zeu ce avea forma unui bărbat, dar
fără oase. Forţa lui creatoare s-a exercitat asupra creării lucrurilor bune de pe
pământ, care să satisfacă nevoile primilor oameni. Cu toate acestea, oamenii i-au
uitat bunătatea şi s-au răsculat. Con s-a înfuriat şi i-a pedepsit oprind ploaia şi
forţându-i să sufere din cauza setei. Zeul Pachacamac a venit în cele din urmă şi l-a
îndepărtat pe Con, apoi a transformat oamenii răsculaţi în maimuţe. Noul
conducător al lumii a creat noi oameni, strămoşii celor de astăzi. Întemeietorul
primei dinastii a regatului Cuzco a fost Manco Capac. Într-o legendă, el a fost adus
din adâncimile lacului Titicaca de către zeul soarelui Inti. În altă legendă, el este
chiar fiul lui Viracocha. Cu toate acestea, oamenii de rând nu aveau voie să
pronunţe numele lui Viracocha, de aceea s-au născut şi legende alternative în
legătură cu primul mare conducător al civilizaţiei incaşe.
Mitul mayaş al genezei este descris în detaliu în cartea sacră Popol Vuh.
Conform acestei cărţi, Universul, Pământul şi oamenii au fost creaţi de trei şerpi
marini şi trei entităţi paradisiace. Popol Vuh, literal Cartea Sfatului sau Cartea
Comunităţii, este documentul cel mai important de care dispunem referitor la
129
miturile civilizaţiei maya, fiind cel mai vechi mit Maya care s-a păstrat în totalitate.
Popol Vuh a fost scris de un indian necunoscut din Guatemala imediat după
cucerirea spaniolă, dar se bazează pe tradiţii nescrise mult mai vechi. Popol Vuh
este o cronică a regilor şi a luptelor purtate între aceştia sau cu vecinii lor. Tema sa
mitologică principală este efortul continuu al zeităţilor din America pre-
columbiană de a crea o fiinţă umană evoluată care să aibă capacitatea de a-şi
cunoaşte şi a-şi venera creatorul. Eroii Gemeni, Hun-Ahpu („Vînătorul”) şi
Xbalanque („Pruncul jaguar”) sunt figurile centrale din această naraţiune. În prima
parte se spune ca totul era în suspans, totul era calm şi linişte, toate erau nemişcate
precum şi întinderea cerului era goală. Acesta este prima naraţiune. Nu era niciun
bărbat, niciun animal, păsări, peşti, crabi, copaci, pietre, peşteri, bovine, ierburi sau
păduri; acolo era doar cerul. Suprafaţa pământului încă nu apăruse. Era doar o
mare liniştită şi întinderea imensă a cerului. Nu era nimic adus împreună, nimic
care să facă vreun zgomot, nimic mişcător sau tremurător, nimeni nu era ca să facă
zgomot în cer. Nimic nu era în picioare; doar apa calmă, marea plată, singură şi
liniştită. Nimic nu exista. Era doar nemişcare şi linişte în întuneric, în noapte.
Numai Creatorul, Făuritorul, Tepeu, Gucumatz, Strămoşii, erau în apă înconjuraţi
de lumină. Ei erau ascunşi sub pene verzi şi albastre şi de aceea s-au numit
Gucumatz. Prin natura lor aceştia erau cei mai mari înţelepţi şi cei mai mari
gânditori. Prin ei cerul exista şi, de asemenea, inima lui Alom, literalmente este cea
care a conceput şi a dat naştere, şi Qaholom, cel care naşte copii. În scopul de a
uşura înţelegerea textului din Popol Vuh, cei doi termeni Alom şi Qaholom sunt
traduşi ca fiind “Strămoşii”.
În religiile gnostice, Adevăratul Dumnezeu nu este cel care a creat lumea.
Geneza acesteia este opera unor puteri inferioare, uneori chiar diavoleşti. Lumea
oamenilor este o imitare demonică, nereuşită, a unei lumi superioare, divine.
Crearea lumii nu numai că nu mai este o dovadă a puterii lui Dumnezeu, ci este
explicată ca un accident survenit în regiunile superioare, sau drept rezultat al
atacului primordial al întunericului asupra luminii. În gnosa valentineană apare o
zeitate cu cap de leu, care este înfăţişată pe un giuvaer gnostic, iar după părerea lui
Bernard de Montfaucon zeul este chiar Demiurg, creatorul lumii materiale în
religia gnostică. După profetul Valentin, prima entitate care s-a desprins din haos
este Tatăl sau Primul Principiu, absolut, invizibil, transcendent şi incomprehensibil.
El s-a unit cu o divinitate feminină, Ennoia („Gândirea”), cu care a dat naştere
celor cincisprezece perechi de eoni. Aceştia formau lumea spirituală din jurul
divinităţii primordiale, numită şi Pleroma. Ultimul dintre eoni a fost zeiţa Sophia
(„Înţelepciunea”), care din nesăbuinţa de a încerca să-şi cunoască Tatăl, a provocat
apariţia răului şi a patimilor, elemente ce vor compune o înţelepciune inferioară.
Între timp, Pleroma îl zămisleşte pe Mântuitor (Iisus), care coborând din lumea
superioară compune materia invizibilă şi îl creează pe Demiurg, cel ce va fi
130
făuritorul lumii noastre. După ce Demiurg săvârşeşte geneza, ignoră existenţa lumii
superioare şi se consideră pe sine unicul Dumnezeu. Tot el însufleţindu-i cu
respiraţia sa, făureşte două categorii de oameni: “hylicii” şi “psihicii”. Însă
elementele spirituale răspândite de Sophia în lumea inferioară intră în respiraţia lui
Demiurg şi duce la apariţia celei de-a treia clase umane, “pneumaticii”, singurii
capabili să se mântuiască.
Gnosa răspândită de Mani susţine că la începuturi cele două substanţe
primordiale, lumina şi întunericul, binele şi răul, Dumnezeu şi materia, coexistau,
dar erau bine despărţite de o graniţă. La nord domnea Părintele Măreţiei (asimilat
cu Dumnezeu, tatăl la creştini), iar la sud Prinţul Întunericului (identificat cu
Ahriman, la perşi şi Diavolul la creştini). Din cauza „mişcării dezordonate a
materiei”, Prinţul Întunericului este împins către graniţa nordică a regatului său. El
zăreşte splendoarea luminii şi doreşte să o cucerească. Atunci Părintele Măreţiei
hotărărşte să-l respingă el însuşi pe duşman. O zămisleşte pe Mama Vieţii, care la
rândul ei dă naştere Omului Primordial. Având o armură alcătuită din cinci straturi
de lumină, acesta coboară la graniţă, dar este învins în lupta cu întunericul şi cu
demonii (arhonţii). În urma acestei înfrângeri, lumina se amestecă pentru prima
dată cu întunericul, iar materia deţine o parte din sufletul divin.
În a doua etapă a creaţiei, Părintele Măreţiei evocă Spiritul Viu, care
coborând în întuneric îl prinde de mână pe Omul primordial şi îl înalţă către
Paradisul Luminilor. Totodată, Spiritul Viu îi doboară pe demoni şi făureşte din
pieile lor bolţile cerurilor, din oasele lor munţii, iar din carnea lor pământul. Apoi
creează soarele şi luna. În a treia etapă a creaţiei, Părintele Măreţiei decide să
recupereze toate particulele luminoase răspândite de Omul Primordial în întuneric.
De aceea el îl emană pe al “Treilea Trimis”. Acesta organizează cosmosul ca pe o
fântână de captat particulele de lumină. În primele cincisprezece zile ale unei luni,
aceste particule urcă până în lună, care ajunge lună plină; în următoarele
cincisprezece, lumina se mută în soare şi în cele din urmă în Paradisul Luminilor.
Cu toate acestea mai rămân particule captive, deoarece au fost înghiţite de
demoni. Atunci Trimisul se arată demonilor masculi sub înfăţişarea unei tinere
fecioare, iar demonilor femele sub chipul unui tânăr bărbat. Înflăcăraţi de dorinţă,
arhondiţii masculi îşi răspândesc sămânţa şi o dată cu ea şi lumina pe care o
înghiţiseră, iar femelele nasc înainte de vreme, avortonii lor fiind aruncaţi pe
pământ. Prinţul Întunericului îşi face griji pentru pierderea preţioaselor particule şi
de aceea recurge la un gest disperat trimiţând doi demoni, unul mascul şi celălalt
femelă, pentru a devora toţi avortonii, care aveau închisă în ei lumina. După ce
săvârşesc acest macabru proces, cei doi demoni se împerechează, zămislind-i astfel
pe Adam şi Eva, primii oameni. Astfel o mare cantitate de lumină ajunge în trupul
oamenilor, ei devenind acum obiectul principal al răscumpărării. Conform religiei
maniheiste, principalul obiectiv al omului este de a se mântui pentru a putea
131
readuce particulele luminoase din corpul lui la origini, în Paradisul Luminilor.
Erezia bogomilistă susţinea că lumea materială a fost creată de Satanail (Satan sau
Diavolul), “Dumnezeu cel aspru” din Vechiul Testament. Bogomiliştii credeau că
Satanail era fratele lui Hristos şi fiul lui Dumnezeu. Pentru ei lumea era rea,
demonică, tainele, icoanele, ceremoniile religioase şi crucea erau deşarte, singura
posibilitate de izbăvire fiind viaţa în sărăcie, umilinţă, pocăinţă şi rugăciune.
Chiar dacă poporul român nu are o mitologie de sine stătătoare, mituri
cosmogonice şi antropogonice s-au păstrat sub formă de legende. Stoparea creării
unei mitologii a fost datorată creştinării timpurii a poporului român, mai exact din
faza de formare, faza ce s-a înteţit după retragerea aureliană din 271. Influenţele
culturii romane, în special, dar şi a celei greceşti, compilate în contextul mediului
predominant rural şi agricultural a dus la formarea unor fiinţe şi a unor obiceiuri
endemice. Totuşi, creştinarea a împiedicat dezvoltarea lor, acestea transformându-
se în superstiţii, asociate de obicei răului, dar şi binelui, devenind sfinţi. Un
exemplu de modificare locală a nervurii mitice biblice reprezintă dorinţa lui Adam
şi a Evei, morţi la vârsta de 700 de ani, de a fi îngropaţi în muntele Alelei. În
folclorul bucovinean s-au păstrat variante cosmogonice stranii, cu rădăcini foarte
vechi: la început nu era nimic pe lume, decât un munte mare purtat de vânturi; din
vârful său ieşea foc, iar din foc s-a născut o femeie neînsufleţită al cărei trup a fost
purtat multă vreme de vânturi până a ajuns la Vântul-cel-mai-de-sus, care i-a dat
viaţă. De acolo femeia coboară pe munte unde, găsind două bucăţi de fier le
înghite, rămânând astfel însărcinată, naşte doi copii: unul şchiop şi deştept, altul
teafăr şi prost. Muntele neavând fier şi fraţii având nevoie de lut, cel prost aduce
lut din adâncul mărilor, iar cel deştept creează din lut un cal fără viaţă. Ei intră pe
rând în cal ca să-l mişte, făcând apoi şi o căruţă; fiindcă numai fratele prost
izbutise să mişte calul, rămâne să tragă el toată viaţa. Ceea ce acest mit vrea să
exprime este ca Dumnezeu era necunoscut în acele timpuri, deci creştinismul nu se
infiltrase în teritoriul românesc, sau se infiltrase sporadic.
Mitologia română, în formele cunoscute de noi astăzi nu cuprinde zei, ci
numai duhuri şi divinităţi de origine totemică (Sfânta Vineri, Pasărea Măiastră),
animale oraculare (Oaia Năzdrăvană, Calul Năzdrăvan), demoni (ielele, dracul,
Muma-Pădurii), divinităţi luciferice (căţelul pământului), monştri zoomorfi
(balaurii), giganţi (uriaşii, novacii), eroi miraculoşi (Făt-Frumos, Prâslea) şi zâne
(ursitoarele, Ileana-Cosânzeana), divinităţi ale naturii aduse de creştinism
(Sânpetru, Sântilie). Există şi instrumente magice, folosite de eroi în scopul
învingerii răului sau în scopul de a face rău (căciula fermecată, flautul fermecat,
buşteanul ielelor). Există şi tărâmuri paralele, cel mai cunoscut dintre ele fiind
Tărâmul Celălalt, care nu este infernul ci o lume para-umană din alt univers.
Mitologia română are patru caracteristici de bază: a) lumea populată de duhuri rele
şi bune pe care omul le poate păcăli cu ajutorul inteligenţei sale; b) destinul
132
implacabil, aşa cum spune şi Dimitrie Cantemir despre credinţa românilor, ce cred
că punctul de sfârşit al vieţii este pus de zei şi nu poate fi schimbat, de asemenea
orice moment din viaţă. Un exemplu în acest sens este balada populară Mioriţa,
unde oracolul nu este o prevenire ci o anunţare obiectivă a unui fenomen natural ce
nu poate fi modificat; c) credinţa într-un tărâm secund paralel, rar infernal şi de
obicei paradisiac, dar nu în sensul biblic, deoarece credinţele păgâne nu au pătruns
încă în acest mit; d) convingerea că undeva există nemurire, aşa numita tinereţe-
fără-bătrâneţe-şi-viaţă-fără-de-moarte.
Zeul creator sau demiurgul reprezintă entitatea responsabilă pentru creaţia
întregii lumi materiale şi spirituale, în unele cazuri, sau doar a lumii materiale. De
obicei, zeul creator este şi cel care a dat viaţă primilor oameni. Existenţa lui
reflectă necesitatea omului de a-şi explica originea universului printr-un proces
fabulos. Actul creaţiei este sacru, pur, original, unic şi irevocabil, reprezintă o
biruinţă a ordinii asupra haosului primordial. Din această cauză zeul creator şi-a
câştigat în majoritatea religiilor o reputaţie foarte mare. El este uneori zeul suprem,
ca în cazul lui Odin, din mitologia nordică, a lui Atum din cea egipteană sau a lui
Marduk din cea mesopotamică. Cu toate acestea religiile gnostice dispreţuiesc zeul
creator precum şi materia creată de acesta şi îl consideră un demon sau o divinitate
inferioară care a încercat să imite prin creaţie Paradisul.
Zeus îl înfrânge pe titanul Typhon, o personificare a haosului primordial.
Înainte de săvârşirea actului creator şi de stabilire a ordinii în univers, lumea era
stăpânită de întuneric şi dezordine, sau pe scurt de haos primordial. Acest termen
abstract defineşte un spaţiu gol, infinit şi indefinit. În multe mitologii lumea a fost
creată din haos, adică din nimic, ceea ce amplifică puterea zeului demiurg. Există
însă şi mituri în care geneza lumii se desăvârşeşte prin sacrificarea unui monstru,
unui gigant sau a unui zeu care personifică haosul primordial. Sacrificiul este
obligatoriu în acest caz, fără el neputându-se clădi ceva semnificativ şi durabil. De
exemplu, în mitologia nordică, Universul a fost făcut din trupul uriaşului Ymir, iar
în mitologia mesopotamică, Marduk a sacrificat-o pe zeiţa-dragon Tiamat, formând
cu trupul enorm cerul şi pământul. În religia maniheistă lumea oamenilor a fost
făurită din măruntaiele demonilor arhonţi. În plan simbolic, biruinţa zeilor
olimpieni asupra titanilor, în mitologia greacă şi a zeilor Tuatha de Danann asupra
fomorilor în credinţa celtică, reprezintă victoria ordinii asupra anarhiei şi a creaţiei
asupra haosului.
Zeiţa mamă este în mitologie un simbol al fertilităţii, al bogăţiei şi al
pământului. Ea este asociată adeseori cu mitul genezei, şi chiar dacă nu este
creatoarea lumii, are un rol decisiv în acest proces. În mitologia greacă şi cea
egipteană, zeiţa mamă are nevoie de o jumătate, de o zeitate opusă, masculină.
Astfel în aceste mitologii, geneza este văzută ca un ritual al iubirii, ca o împreunare
între cele două elemente antagonice ale naturii: pământ-cer şi masculin-feminin.
133
Dacă în mitologia greacă, zeiţa Gaia este pământul, iar zeul Uranus este cerul, în
religia vechilor egipteni, locurile sunt inversate, zeiţa Nut fiind cerul, iar zeul Geb
pământul. În mitologia celtică, zeiţa-mamă, Danu este una din principalele zeiţe
din acest panteon, deci are o importanţă foarte mare, mai ales că poporul de zei
celtici poartă numele „Tuatha de Danann” adică „triburile zeiţei-mamă Danu”.
Zeul şarlatan este zeul care intervine în creaţia demiurgului, de obicei cu intenţii
malefice, din cauza invidiei, urii, răutăţii lui înnăscute sau din naivitate şi lipsa
conştiinţei că ar putea provoca rău. Fiindcă lumea la începuturile ei se
caracterizează prin puritate primordială şi perfecţiune, acest zeu este responsabil
pentru aducerea relelor, suferinţelor şi a morţii. El degradează opera ideală a zeului
creator şi provoacă procesul de degradare progresivă a lumii. Exemplu pentru acest
tip de zeu este Ahriman (mitologia persană) sau Sulmus (mitologia mongolă). De
asemenea, rolul zeului şarlatan poate fi preluat de demoni, duhuri rele sau
spiriduşi.

134