Sunteți pe pagina 1din 196

Diabetul zaharat

Definiţie

• Sindrom heterogen caracterizat printr-o printr o tulburare


complexă în reglarea metabolismului energetic al
organismului, care afectează deopotrivă utilizarea
glucidelor, lipidelor şi proteinelor, precum şi celelalte
metabolisme; aceste alterări sunt datorate insuficienţei
absolute sau relative de insulină. Modificările biochimice pe
care aceste tulburări le antrenează conduc la modificări
celulare funcţionale urmate de leziuni anatomice ireversibile
în numeroase ţesuturi şi organe.
Definiţie

• Nu este o “boală” în sensul tradiţional al termenului

• “Sindrom”
- alcătuit dintr-un ggrup
p heterogen
g de tulburări cu
etiologie şi patogenie diferite
- componentele
p sindromului au ca element comun
hiperglicemia
Etimologie
g

• “Diabeiu”
Diabeiu (greaca veche) = “a a se scurge ca printr-un sifon”
sifon
(aluzie la poliuria marcată a acestor pacienţi)

• Thomas Willis (medic, anatomist şi profesor la Oxford)


- a adăugat cuvântul “mellitus” (ca mierea)

Diabetes mellitus
(Diabet zaharat)
Presentation of the new
IDF DIABETES
ATLAS
WORLD DIABETES DAY
Numărul de persoane cu diabet zaharat în 2017 și în 2045

IDF Diabetes Atlas Eighth Edition 2017


Prevalența
e a e ța d
diabetului
abetu u zaharat
a a at
Prevalenţa DZ şi a pre-diabetului în România – 2014
În România: 11,6% persoane cu diabet zaharat

Diabet 
Prediabet nediagnosticat
18,4% 2,4%

Diabet 
Diabet  zaharat 
11,6% di
diagnosticat
ti t
Glicemie normală 9,2%
69,2%
,

Mota M et al. Studiul PREDATORR. Prezentare la Congresul SRDNBM, Mai 2014


Pancreasul endocrin - noţiuni de anatomie şi
fi i l i
fiziologie

Insulele Langerhans

• 800.000 – 1.500.000
• 1 – 2 % din masa
pancreatică totală
• Celule: A
A, B
B, C
C, D
Hormonii secretaţi în celulele insulelor
L
Langerhans
h

Tipul
p Hormonul Efect p
pe metabolismul glucidic
g
celular produs
A Glucagon Hiperglicemiant prin glicogenoliză

B Insulină Hipoglicemiant prin mec. multiple


Peptidul C Efecte metab. incomplet cunoscute
Amilină Hiperglicemiant
C(PP) P li
Polipeptid
tid I fl
Influenţă
ţă pe motilitatea
tilit t gastrică
t i ă şii
pancreatic absorbţia principiilor nutritive
D Somatostatin Hiperglicemiant
Hiperglicemiant, inhibă secreţia
insulinei
Insulina – structură, sinteză, secreţie
ţ
Secreţia insulinei
Secreţia insulinei
• bazală  insulinemia plasmatică = 10-12 μU/ml
• stimulată  insulinemia plasmatică  50-75 μU/ml
Controlul hormonal al glicemiei
Insulina Hormoni de contrareglare
Efect net: scăderea glicemiei Efect net: creşterea glicemiei

 înlăturării glucozei din sânge  înlăturării glucozei din sânge


- intrării
i t ă ii glucozei
l i îîn celule
l l - intrării
i t ă ii glucozei
l i îîn celule
l l
- glicogenezei - glicogenezei
 eliberării glucozei din  eliberării glucozei din
depozite depozite
- glicogenolizei - glicogenolizei
- gluconeogenezei - gluconeogenezei
- lipolizei şi cetogenezei - lipolizei şi cetogenezei
- catabolismului proteic - catabolismului proteic
Clasificarea DZ (OMS,1998)
• DZ tip 1 - autoimun
- idiopatic

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet im
imun
n
- sindroame genetice rare

• Diabetul
Di b t l gestaţional
t ţi l
Diabetul zaharat tip 1

• Poate apare la orice vârstă, dar mai frecvent sub 30 ani


• Deşi există o predispoziţie genetică, majoritatea
pacienţilor nu au antecedente familiale de DZ
• Debut relativ abrupt,
abrupt cu simptome evidente şi tendinţă la
cetoacidoză
• De obicei,, p
pacienţii
ţ sunt slabi
• Rezultă în urma distrugerii celulelor -pancreatice
• Insulina plasmatică este foarte redusă sau absentă
• Anticorpi circulanţi: antiinsulină, anticelule , anti-GAD
• Pacienţii sunt “dependenţi” de insulină
Etiopatogenia
t opatoge a DZ 1 autoimun
auto u

• Predispoziţie genetică
• Factor de mediu (viral, toxic, alimentar)
• Activare
Acti are a toim nă  insulită
autoimună ins lită
• Scăderea capacităţii β-secretoare; afectarea fazei secretorii
iniţiale dar insulinemia plasmatică este normală
iniţiale,
• Diabet clinic manifest; insulinemie plasmatică scăzută,
hiperglicemie apar simptomele
hiperglicemie,
• Apariţia complicaţiilor
Diabetul zaharat tip 2

• Apare, de obicei, după vârsta de 40 ani


• 80% din cazuri: obezi
• Perioadă prediagnostică lungă
• Si t
Simptomatologie
t l i de d debut
d b t ştearsă
t ă sau absentă,
b tă fără
fă ă
tendinţă la cetoacidoză
• Asocierea a două defecte celulare: rezistenţa la insulină
şi deficienţa funcţiei -celulare
• Cel puţin iniţial, capacitatea secretorie -pancreatică
este relativ păstrată, răspunzând bine la dietă şi ADO;
ulterior, unii vor necesita insulinoterapie
Etiopatogenia
p g DZ 2

• Factori genetici – transmitere poligenică

• Rezistenţă crescută la acţiunea insulinei

• Hiperinsulinism funcţional

• Deficienţă în secreţia insulinică  hiperglicemie persistentă

ţ insulinice 
• Scăderea absolută a secreţiei

 DZ 2 insulinonecesitant
Clasificarea DZ (OMS,1998)
• DZ tip 1 – autoimun (1A)
- idiopatic (1B)

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet im
imun
n
- sindroame genetice rare

• Diabetul
Di b t l gestaţional
t ţi l
Diagnosticul
ag ost cu clinic
c ca al DZ

• Poliurie
P li i
• Polidipsie
p
• Polifagie
• Scădere ponderală
• Astenie
Caracteristicile generale ale DZ 1 şi 2
Particularitate Tipul 1 Tipul 2
Ereditate Concordanţă 30-50% Concordanţă 90%

Baza genetică Defect în programarea IR şi/sau insulino-


imunităţii deficienţă
Semne de Prezente Absente
autoimunitate
Debut Sub 40 de ani Peste 40 de ani
IMC Scăzut Crescut (80%)
Insulinemia Scăzută Crescută
plasmatică
Tendinţa la Marcată Absentă
cetoză
Tratament oral Ineficient Eficient
Criterii de diagnosticare a DZ
(di
(diagnosticul
ti l paraclinic)
li i )

• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)


sau
• Prezenţa simptomelor şi o glicemie întâmplătoare (în
orice moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1
(11 1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• N.B.
N B - glicozuria NU este un criteriu de dg
dg.
- NU se recomandă ca dg. de DZ să se bazeze pe
glicemii efectuate pe glucometre
- HbA1c NU se foloseşte
f l t pentru
t diagnosticul
di ti l DZ
Criterii de diagnosticare a DZ
(di
(diagnosticul
ti l paraclinic)
li i )

• Prezenţa simptomelor şi o glicemie întâmplătoare (în orice


moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• Criteriu nou – HbA1c ≥ 6,5%


Glucoza p
plasmatică versus glucoza
g din
sângele total

Glucoza din plasmă Glucoza din sângele total

126 mg/dl (7 mmol/l) 110 mg/dl (6,1


(6 1 mmol/l)

200 mg/dl
g (11,1
( , mmol/l)) 171 mg/dl
g (9,5
( , mmol/l))
Criterii de interpretare a glicemiei bazale

• 70-110 mg/dl – normal

• 110-125 mg/dl – glicemie bazală modificată

• ≥ 126 mg/dl – diabet zaharat probabil;


confirmarea se face după a doua dozare
Criterii de interpretare a TTGO
Glicemie în plasma venoasă
Diabet zaharat
- bazal ≥ 126 mg/dl
/dl (7 mmol/l)
l/l)
- la 2 h după glucoză ≥ 200 mg/dl (11,1 mmol/l)

Scăderea toleranţei la
glucoză
< 126 mg/dl (7 mmol/l)
- bazal
b l
≥ 140 mg/dl (7,8 mmol/l) şi
- la 2 h după glucoză
< 200 mg/dl (11,1 mmol/l)
Normal
- bazal < 110 mg/dl (7 mmol/l)
- la 2 h după glucoză < 140 mg/dl (7,8 mmol/l)
Modalităţi de debut şi de diagnostic ale DZ

• Pacient simptomatic
- simptomele clasice de diabet
p
- simptome ale complicaţiilor
p ţ - acute
- cronice

• Pacient asimptomatic
- bilanţ al stării de sănătate
- depistare activă la subiecţi cu risc
Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici
i t ti i cu ajutorul
j t l glicemiei
li i i bazale
b l (1)

• Toţi subiecţii cu vârsta ≥ 45 ani

• Glicemia à jeun se va repeta la intervale de minimum 3 ani

• Testarea se va face la vârste sub 45 ani şi se va repeta la


intervale mai scurte la toți subiecții cu IMC ≥ 25 kg/m2 (IMC
≥ 23 kg/m2 la asiatici) care mai prezintă și alți factori de risc
Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici cu ajutorul glicemiei bazale (2)
Subiecți cu factori de risc:
- sedentarii
- persoanele cu rude de gradul I cu DZ
- grupurile etnice cu risc crescut
- hipertensivii (≥ 140/90 mmHg sau sub trat. antihipertensiv)
- dislipidemicii (HDL < 35 mg/dl şi/sau TG > 250 mg/dl)
- femeile
f il care au născut
ă t copiiii cu greutatea
t t peste
t 4,5
4 5 kg
k
- femeile care au avut diabet gestaţional
- femeile cu ovar polichistic
- persoanele cu HbA1c ≥ 5,7%, GBM sau STG la testări ant.
- aalte
te co
condiții
d ț cclinice
ce asoc
asociate
ate cu insulinorezistență
su o e ste ță (obe
(obezitate
tate
severă, acanthosis nigricans)
- antecedente de BCV
Complicaţiile
Co p caţ e DZ

• Acute
- infecţiile
- comele - hiperglicemice - cetoacidozică
- hiperosmolară
- lactacidemică
- hipoglicemică
• Cronice
- microangiopatice
- macroangiopatice
- neuropatice
Infecţiile

• Frecvente la diabeticul dezechilibrat

• Predispoziţia către infecţii explicată prin modificări legate


de hiperglicemie:
-  mobilizării şi chemotactismului leucocitar
-  capacităţii fagocitare a polimorfonuclearelor
-  capacităţii bactericide a polimorfonuclearelor
-  funcţiilor monocitare
• Infecţii puternic asociate diabetului (quasi-specifice),
severe dar foarte rare:
severe,
- mucormicozele
- otita externă malignă
- pielonefrita emfizematoasă
- colecistita emfizematoasă
• Infecţii postterapeutice:
- abcese insulinice, infecţii asociate transplantului renal,
dializei peritoneale, hemodializei
• Infecţii nespecifice asociate DZ:
- infecţii urinare: cistite, pielonefrite, abcese renale/perirenale
- infecţii
i f ţii respiratorii
i t ii
- infecţii cutanate, mucoase, ale ţesutului celular s.c.
- altele: fasceita necrozantă,, gangrena
g g Fournier a organelor
g
genitale
Hipoglicemiile

• Definiţie – scăderea valorilor glicemiei sub 70 mg/dl în


plasma venoasă (sub 60 mg/dl în sângele venos total)

• Triada Whipple:
- simptome
i t sugestive
ti pentru
t hi
hipoglicemie
li i după
d ă postt
prelungit sau exercițiu fizic
- documentarea unei valori glicemice scăzute
- corecția simptomelor după corecția valorilor glicemice

• Cauze
C - exces ded insulină
i li ă sau de
d ADO secretagoge
t
- scăderea aportului glucidic
- efort fizic excesiv
- consumul de alcool
Hipoglicemiile - fiziopatologie

• Mecanismele de apărare împotriva hipoglicemiei


- scăderea
ăd secreţiei
ţi i de
d insulină
i li ă
- creşterea secreţiei pancreatice de glucagon
- stimulare simpatică   secreţiei de catecolamine
- creşterea secreţiei de cortizol şi h. de creştere

• L
La pacientul
i t l diabetic
di b ti
- scăderea secreției de insulină nu e un mecanism activ
- afectarea secreției de glucagon la DZ 1 cu o perioadă
lungă de evoluție
- diminuarea secreției de catecolamine prin neuropatie
vegetativă
Hipoglicemiile – manifestări clinice

• Semne periferice (de „alarmă adrenergică”)


- tremurături
t ăt i ale
l extremităților,
t itățil t
transpirații,
i ții paloare,
l
tahicardie, palpitații, anxietate, foame, parestezii distale
• Semne centrale (de neuroglicopenie)
- tulburări de atenție, concentrare, memorie, coordonare,
comportament; oboseală, somnolență; tulburări de vorbire;
tulburări de vedere; parestezii peribucale; cefalee; contracturi
musculare localizate/generalizate; comă profundă, agitată
• Atenție:
ț
- idiosincrazia manifestărilor hipoglicemice
- alterarea contrareglării adrenergice prin neuropatie
vegetativă
t ti ă
Hipoglicemiile

• Clasificare
– uşoare: recunoscute t șii corectate
t t de
d către
ăt pacient,
i t nu
afectează capacitatea de muncă și inserția în mediu
– medii (moderate): afectează capacitatea de muncă și
inserția în mediu
– severe: totalitatea hipoglicemiilor care necesită intervenția
î urgență
în ță a uneii alte
lt persoane (tratament
(t t t injectabil);
i j t bil) includ,
i l d
dar nu se limitează la comele hipoglicemice

• Cazuri particulare
- hipoglicemiile neconştientizate
- hipoglicemiile
hi li iil nocturne
Complicaţiile
Co p caţ e hipoglicemiilor
pog ce o

• Accident vascular cerebral

• Infarct de miocard

• Tulburări funcţionale cerebrale minore

• Encefalopatia posthipoglicemică

• Hemoragii retiniene masive

• Decerebrare
Tratamentul hipoglicemiilor

• Tratament p
preventiv – educaţia
ţ p pacientului diabetic

• Tratament curativ
- hipoglicemiile uşoare şi medii
- glucide rapid + lent absorbabile

- hipoglicemiile severe
- glucoză i.v.
iv
- glucagon
-gglucide rapid
p + lent absorbabile
Cetoacidoza diabetică - date generale

• Definiţie – triada - hiperglicemie


- cetoză
- acidoză

• F>B
• Vârsta medie 43 ani
• 20 % episoade multiple
• 20 % apar la diabetici nou diagnosticaţi
Fiziopatologia cetoacidozei diabetice
Insuficienţă absolută sau relativă
Lipoliză de insulină

Hiperproducţie de Proteoliză
corpi cetonici Accelerarea glicogenolizei şi
neoglucogenezei
Eliberarea de alanină
şi alţi aminoacizi
Acidoză metabolică
Hiperglicemie şi
glicozurie
Pierdere de apă, K+ PO-4, Creşterea ureei
baze tampon
Poliurie osmotică Hiperosmolaritate

Deshidratare Sete

Colaps Aritmie Polidipsie

COMĂ
Cauzele cetoacidozei diabetice

• Insulinodeficienţa absolută
- întreruperea insulinoterapiei
- cetoacidoză inaugurală (20%)

• Insulinodeficienţa relativă
- afecţiuni intercurente
- endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia
- iatrogen
i t ( ti i i simpatomimetice)
(corticoizi, i t i ti )
- sarcină
- stress
Tablou
ab ou clinic
c c

• Facies – vultuos
• Temp. cutanată 
• Semne neuromusculare – hipotonie moderată
moderată, diminuarea ROT
• Semne de deshidratare cutaneo-mucoasă
• Semne cardiovasculare – tahicardie; TA e de obicei normală
• Semne respiratorii – halenă acetonemică, dispnee Küssmaul
• Semne digestive – grețuri, vărsături, dureri abdominale
• Starea de conştienţă – de obicei păstrată
Diagnostic paraclinic

• Hiperglicemie:
p g 350 – 1200 mg%
g

• Hipercetonurie: > 30 mEq/l


T t
Tratamentul
t l cetozei
t i incipiente
i i i t

• Creşterea dozelor de insulină


• Hidratare
Hid t corespunzătoare
ăt
• Băuturi reci îndulcite cu zahăr sau glucoză,
în cantităţi mici şi la intervale scurte
• Sucuri de fructe, supe de legume, ceai cu zahăr, compot
• Scăderea grăsimilor din alimentaţie
Tratamentul cetoacidozei avansate şi severe

• Combaterea tulburărilor hidroelectrolitice


• Combaterea tulburărilor metabolice (hiperglicemia)
• Combaterea tulburărilor acido-bazice
• C b t
Combaterea ttulburărilor
lb ă il h hemodinamice
di i
• Combaterea factorului infecţios
• Măsuri nespecifice
- oxigenoterapie
- sondaj vezical
- sondă de aspiraţie gastrică
- heparină 5000 u/8h
- tratament etiologic
Mortalitatea
o ta tatea în C
CAD se
severă

• < 0,5% în comele “simple”

• 5 – 15% în comele “complicate”

• 45% când este abolită starea de conştienţă


Coma
Co a hiperosmolară
pe os o a ă

• Definiţie
Absenţa cetoacidozei la un diabetic care are o
osmolaritate plasmatică hiperglicemică sau mixtă
(hiperglicemică şi hipernatremică) > 350 mOsm/l

• O
Osmolaritatea
l it t = (Na
(N + + 10) x 2 + glicemia
li i /18 + ureea /6
(mosm/l)

• Frecvenţă
- 10% din comele diabetice hiperglicemice
Criterii de diagnostic

• Osmolaritate plasmatică > 350 mOsm/l


• Glicemie > 600 mg/dl
• pH > 7,25
• HCO3 > 15 mEq/l
• Semne de deshidratare masivă
Complicaţiile cronice ale DZ
Complicaţiile
Co p caţ e c cronice
o ce aale
e DZ

• Microangiopatice
g p
• Macroangiopatice
• Neuropatice
• Gangrena diabetică
• Alte complicaţii - hepatopatia dismetabolică
- cardiomiopatia
di i ti di
diabetică
b ti ă
- parodontopatia
- complicaţii osteo-tendino-articulare
- osteoartropatia diabetică (piciorul Charcot)
- afectarea cutanată
În momentul diagnosticului DZ 2 un procent mare
din persoane au deja complicaţii cronice sau
asocieri morbide
80

70

60

50

40

30

20

10

0
Obezit. HTA DZP BCV Retinop diab Nefrop.diab.
Retinop.diab N f di b Neurop.diab.

N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first
three years. Diabetologia 2003; 46(Suppl.2): A282.
Clasificarea neuropatiei diabetice

• Neuropatia subclinică

• Neuropatia clinică

• Periferică
• Vegetativă (autonomă)
Neuropatia
p subclinică

• Teste de electrodiagnostic anormale


- viteză de conducere nervoasă scăzută

• Testare cantitativă senzorială anormală


- vibratorie, tactilă, termică
Neuropatia periferică

• Polineuropatia distală simetrică


• Neuropatia diabetică acută
• Neuropatia diabetică hiposenzitivă
• Neuropatia motorie proximală a membrelor inferioare
• Mononeuropatiile
• Neuropatiile truncale
Polineuropatia distală simetrică

• Cea mai frecventă


• T lb ă i d
Tulburări de sensibilitate
ibilit t (hi
(hiperestezie
t i sau hi
hiposensibilitate)
ibilit t )
• Membrele inferioare
• Evoluţie centripetă
• Disestezie
• “Anestezie dureroasă”
• Agravare nocturnă
• Semne de disfuncţie vegetativă
• Piele uscată / aspect pseudo-inflamator
• Sensibilitatea vibratorie / proprioceptivă
• At fi şii hi
Atrofie hipotonie
t i musculară l ă
Neuropatia
eu opat a diabetică
d abet că acută

• Rară,
R ă dar
d caracteristică
t i ti ă DZ
• Instalare acută
• Dureri intense în membrele inferioare
• “Caşexie neuropată”
• Insomnie
• Depresie
• Impotenţă
Neuropatia
eu opat a diabetică
d abet că hiposenzitivă
pose t ă

• Lipsesc acuzele subiective


• Scădere / dispariţie a sensibilităţii dureroasă, termică,
vibratorie
• Alterare variabilă a funcţiilor vegetative
• VCN 
• Risc  de leziuni cutanate
• Evaluare cantitativă: determinarea pragului de electropercepţie
Neuropatia motorie proximală a membrelor
inferioare

• Rară

• Amiotrofii

• “Poliradiculopatia diabetică”

• Instalare acută / subacută

• “Topirea
“T i muşchilor”
hil ”
Mononeuropatiile

• Cel mai frecvent:

nerviiii cranieni
i i

• Cubital

• Sciatic popliteu extern


Neuropatiile truncale

• Rare

• Instalare acută sau progresivă

• Durere abdominală sau truncală unilaterală

• T3 - T12
Tratamentul
ata e tu neuropatiei
eu opat e pe
periferice
e ce

• Echilibrare metabolică riguroasă


g
• AINS, analgezice opioide cu acţiune centrală
• Tranchilizante minore
• Carbamazepina, Gabapentin
• Antidepresive triciclice
• TENS,S electroacupunctura
• Capsaicina
• Vitaminoterapia benfotiamina
Vitaminoterapia, benfotiamina, acidul alfa
alfa-lipoic
lipoic
• Ionizări ale membrelor inferioare cu Xilină 1% şi vit. B1
• Balneofizioterapia (mofete, băi carbogazoase, ionizări)
Neuropatia vegetativă

• Neuropatia
N i cardio-vasculară
di l ă
• Neuropatia digestivă
• Neuropatia vezicală
• Tulburările sexuale
• Neuropatia pupilară
• Tulburările cutanate
• Hipoglicemiile neconştientizate
Neuropatia cardio-vasculară
Manifestările cardiovasculare ale neuropatiei

Cardiace Vasculare
Tahicardie cu ritm stabil Hipotensiune ortostatică
Infarct miocardic nedureros Tulburări circulatorii cerebrale

 intervalului QTc (>400 ms) Tulburări circulatorii ale


extremităţilor
Tulburări de ritm Edeme ale membrelor
inferioare
Moarte subită Fenomenul non-dipping
Accidente anestezice
Tratamentul
ata e tu hipotensiunii
pote s u ortostatice
o tostat ce

• Stoparea
p medicaţiei
ţ care exacerbează hipotensiunea
p
• Trecere treptată din clino în ortostatism
• Ciorapi elastici
• Creşterea moderată a aportului de sare
• Simpatomimetice (etilefrin - Effortil)
• Mineralocorticoizi (9--fluorohidrocortizon
( f – 400 μg/zi)
/ )
• Antiinflamatorii nesteroidiene
• Derivaţii de ergotamină (DH-ergotoxină
(DH ergotoxină – 7 pic
pic. de 3 X / zi)
• Agonişti ai receptorilor 1 - Midodrin – 2,5-10 mg/zi
• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o
Neuropatia
eu opat a digestivă
d gest ă

• Disfuncţia
ţ esofagiană
g ((tulburări de motilitate))

• Disfuncţia gastrică: control glicemic dificil, plenitudine post-


prandială, sațietate precoce, anorexie, intoleranță digestivă
totală în formele severe (gastropareza diabetică)

• Disfuncţia intestinală: constipație neuropată, diaree neuropată


(accentuată nocturn, episoade de remisie/agravare, scaune
apoase, fără fenomene de malabsorbție), rar incontinență fecală

• Disfuncţia
Di f ţi veziculei
i l i biliare
bili (hi
(hipomotilitate,
tilit t litiază
liti ă biliară)
bili ă)
Tratamentul
ata e tu neuropatiei
eu opat e autonome
auto o e digestive
d gest e

• Gastropareza:
p control g
glicemic riguros
g ((inclusiv p
pe termen
scurt), prokinetice

• Diareea neuropată: loperamid, eritromicină, clonidină

• Constipația neuropată: aport ↑ de fibre,


fibre prokinetice,
prokinetice lactuloză

• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

Atenție: este necesară investigarea altor etiologii ale


manifestărilor digestive (diagnostic de excludere)
Neuropatia
eu opat a digestivă
d gest ă

• Disfuncţia esofagiană

• Disfuncţia gastrică

• Disfuncţia intestinală

• Disfuncţia veziculei biliare


Neuropatia vezicală
• Hipotonie ureterală
• Pareza vezicală
• “vezica neurogenă”

Tulburările sexuale
B – impotenţă - tulburări de erecţie
- ejaculare retrogradă
F – tulburări menstruale
Neuropatia pupilară
• Asimptomatică
• Măsurarea reflexului pupilar la lumină

T lb ă il cutanate
Tulburările t t
• Anhidroză distală
• Hipersudoraţie compensatorie în ½ superioară a corpului

Hipoglicemiile neconştientizate
• Absenţa semnelor de “avertizare”
avertizare a hipoglicemiilor
Macroangiopatia
g p diabetică

Ateroscleroza – date generale


g

• Arterioscleroza
At i l
• Ateroscleroza
• Athero (terci) + sclerosis (induraţie)
• Istoric
• Localizare
Fi i
Fiziopatologia
t l i aterosclerozei
t l i

• Ipoteza “răspunsului la injurie” (R


(R. Ross)
Leziunile
e u e ateaterosclerotice
osc e ot ce

• Striurile lipidice

• Placa de aterom fibroasă

• Placa de aterom complicată


Diagnosticul clinic al aterosclerozei

• Faza preclinică, asimptomatică


- diagnostic de suspiciune
- modificări metabolice ((hipercolesterolemia)
p )
- factori de risc (fumat, HTA, DZ etc.)

• Faza clinică
- obstrucţie > 60
60--70% din lumenul arterial
- ischemie în diverse teritorii - coronarian
- cerebral
- membrele inferioare
- renal
- mezenteric
- particularităţile ATS la diabetici
Diagnosticul paraclinic al aterosclerozei

• Ecg
• Ecg de efort
• Scintigrafia cu taliu
• Ecocardiografia
• Angiografia
• Ecografia intravasculară
Microangiopatia diabetică

• Nefropatia diabetică

• Retinopatia diabetică
Nefropatia diabetică – date epidemiologice

• 50 % dintre pacienţii aflaţi în programele de supleere


renală au drept
p cauză a insuficienţeiţ renale diabetul

• După 20 de ani  30 % dintre pacienţii cu DZ 2 dezvoltă


nefropatie

• 20% dintre cei cu nefropatie ajung la insuficienţă renală


terminală
Eliminarea urinară de proteine

Prin consens:

• Normoalbuminurie < 30 mg/24 ore

• Microalbuminurie – 30
30-300
300 mg/24 ore

• Macroalbuminurie > 300 mg/24


g ore
Stadializarea
Stad a a ea nefropatiei
e opat e ddiabetice
abet ce

• Stadiul I – Hiperfuncţie şi hipertrofie renală

• Stadiul II – Silenţios,
Silenţios normoalbuminuric

• Stadiul III – Nefropatia


p diabetică incipientă
p

• Stadiul IV – Nefropatia diabetică patentă (clinic manifestă)

• Stadiul V – Insuficienţa renală cronică terminală


Evoluţia
ţ în timp a filtratului glomerular
g şi
ş a
eliminării urinare de albumină
Diagnostic clinic

• Semne de HTA
• Semne de sindrom nefrotic, IRC
• Prezenţa altor complicaţii ale diabetului: retinopatie,
macroangiopatie,
g p , neuropatie
p
•  numărului de hipoglicemii nejustificate şi 
necesarului de insulină
Caracteristicile clinice ale diabeticilor
hipertensivi

• p
presiunii p
pulsului arterial

• Hipotensiunea ortostatică

• Hipertensiunea nocturnă
Diagnostic paraclinic

• Rata filtrării glomerulare

• Eliminarea urinară de proteine


p

• Biopsia renală
S
Screening
i pentru
t nefropatia
f ti diabetică
di b ti ă

• Microalbuminuria se evaluează la
diagnosticarea DZ şi apoi anual

• Creatinina serică trebuie dozată anual


Eliminarea
a ea u
urinară
a ă de proteine
p ote e

normoalbuminurie microalbuminurie macroalbuminurie

Rata de excreţie
a albuminei < 30 30-300  300
(mg/24 ore)

Raportul
albumină/creati-
nină (mg/g)
Bărbaţi < 20 20-200  200

F
Femei
i < 30 30-300  300
Factori de risc pentru progresia
nefropatiei diabetice

• HTA

• Albuminuria

• Controlul glicemic insuficient

• Fumatul

• Consumul
C l crescutt de
d proteine
t i

• Dislipidemia
Metode terapeutice
p

• Menţinerea unui control glicemic optim pe termen lung


• Tratamentul precoce al hipertensiunii arteriale
• Tratamentul dietetic
• Reducerea lipidelor serice
• Prevenirea şi tratamentul comorbidităţilor existente
• Tratamentul anemiei renale
• Profilaxia şi tratamentul bolii osoase renale
Retinopatia
et opat a diabetică
d abet că – date ge
generale
e ae

• RD – unul din primele semne de afectare vasculară

• Prima cauză de cecitate – 20-74 ani

• Prevalenţa – corelată cu durata de evoluţie a DZ

• > 20 ani de DZ – toţi pac.cu DZ 1


> 60% pac. cu DZ 2
Fiziopatologia
p g retinopatiei
p diabetice

• Alterarea compoziţiei membranei bazale



plasmă  edem
- extravazare - p
- hematii  hemoragii
- lipoproteine  exsudate dure

•  Pericitelor
-pproliferarea
o e a ea ce cel. e
endoteliale
dote a e
-  tonicităţii peretelui capilar  ectazii capilare 
 microanevrisme
Proliferarea cel. endoteliale + microanevrismele

Încetinire curent sanguin

 adezivitatea plachetară

Ocluzie capilară

Hipoxie retiniană

Stimularea angiogenezei

Vase de neoformaţie
Leziunile din RD (1)

• Dilataţia capilarelor
• Microanevrismele
Mi i l
• Hemoragiile intraretiniene
• Exsudatele
E d t l ddure
• Exsudatele moi
• Anomalii
A lii iintravasculare
t l iintraretiniene
t ti i
• Anomalii venoase
• Neovascularizaţia
N l i ţi retiniană
ti i ă
Leziunile din RD (2)

• Hemoragiile preretiniene

• Hemoragiile vitreene

• Dezlipirea de retină

• Rubeoza iriană. Glaucomul neovascular

• Maculopatia diabetică
Clasificarea retinopatiei
p diabetice

• Retinopatie diabetică neproliferativă


- uşoară

- severă (preproliferativă)
(p p )

• Retinopatie diabetică proliferativă


Diagnosticul
g retinopatiei
p diabetice

• Examenul FO
- oftalmoscopia directă
- biomicroscopia FO
- oftalmoscopia indirectă
• Angiografia cu fluoresceină
• Fluorometria vitreană
• Ecografia oculară
• Electroretinograma
• Teste de discriminare cromatică
• Adaptometria
Screening-ul
g retinopatiei diabetice

• Acuitatea
A it t vizuală
i lă poate
t fi normală
lă chiar
hi înî prezenţa
ţ unor
leziuni avansate ale retinei  necesar screening
periodic p
p pentru toate p
persoanele cu diabet

• Examenul oftalmologic se va face la depistarea


diabetului şi apoi anual

• Pacienţii cu retinopatie diabetică vor fi evaluaţi mai des


în funcţie de indicaţiile medicului oftalmolog
Frecvenţa examinărilor în funcţie de stadiul RD

Anomalii retiniene Urmărire la

Normal + rare microanevrisme Anual


RDNP uşoară 9 luni
RDNP moderată 6 luni
RDNP severă 4 luni
EMCS 2-4
2 4 luni
RDP 2-3 luni
Tratamentul medicamentos al RD

• Echilibrarea metabolică a DZ
• Evitarea hipoglicemiilor
• Vitamine A
A, E
• Extractul de ginkgo biloba
• Dobesilat de calciu
• Aspirina
• Tratamentul
T t t l HTA
• IECA, Sartani, Sandostatin
Tratamentul chirurgical al RD

• Tratamentul laser
- panfotocoagularea laser
- tratamentul laser focal

• Vitrectomia
Vit t i posterioară
t i ă

• Crioterapia
Alte
te a
afectări
ectă ocu
oculare
a e în d
diabetul
abetu zaharat
a a at

• Cataractă
• Glaucom
• Infecţii
• Neuropatii de nervi oculomotori
•  adaptării la întuneric
•  discriminării
di i i ă ii cromatice
ti
Piciorul diabetic - date epidemiologice

• 25% dintre bolnavii cu DZ internaţi sunt spitalizaţi pentru


complicaţii la nivelul piciorului

• 50-70% dintre amputaţiile netraumatice sunt la pacienţii


cu DZ

• Neuropatia diabetică este a doua cauză


cauză, pe plan
mondial, de durere neuropată, după lumbago
Fiziopatologia
p g piciorului
p diabetic

Principalele
p modificări sunt
determinate de:
– neuropatie
– arteriopatie
Diagnostic
ag ost c diferenţial
d e e ţa -s simptome
pto e

Arteriopatia diabetică
Claudicaţie intermitentă
Durere de repaus
Durere spontană, brusc instalată

Neuropatia diabetică
Durerii de
d repaus, nocturne
Arsuri
Parestezii
Diagnostic
ag ost c diferenţial
d e e ţ a – se
semne
ecclinice
ce

Arteriopatia
p diabetică Absenţaţ p
pulsului, p
picior rece
Paloare la ridicarea membrului inf.
Roşeaţă la trecerea în ortostatism
Cianoză
Modificări trofice

Neuropatia diabetică Piele atrofică


Calus
Unghii distrofice
Deformări osoase
Picior cald
R d
Reducerea/absenţa
/ b ţ sensibilităţii
ibilităţii
Absenţa reflexelor
Arteriopatia diabetică
E l
Evaluare E h -Doppler
Echo-
Echo D l
Angiografie

Management Medicaţie
Exerciţii fizice
Trimitere la specialist

Neuropatia diabetică
Evaluare Monofilament
Sensibilitate vibratorie
Reflexe osteo
osteo--tendinoase

Management Controlul durerii


Trimitere la specialist
Examinare picior

Examen vascular periferic E


Examen neurologic
l i

• palpare puls arterial • ROT


• examinare circulaţie venoasă • testare sensibilitate
• culoare tegumente
g - tactilă
• T° tegumente - termică
- dureroasă
- vibratorie
Prevenţia piciorului diabetic

Educaţia pacientului pentru îngrijirea piciorului


– Examinarea
E i piciorului
i i l i zilnic
il i
– Îngrijirea pielii şi unghiilor
– Încălţăminte
ţ adecvată

Renunţarea la fumat

Identificarea deformărilor osoase

Evaluarea / ameliorarea controlului:


– Glicemiei
– TA
– Factorilor de risc cardiovascular
Important
p de reţinut
ţ în managementul
g piciorului
p
diabetic

• Claudicaţia intermitentă din angiopatie poate lipsi sau


poate fi estompată datorită neuropatiei

• Paradoxal, la începutul tratamentului hipoglicemiant


durerile se pot intensifica
Piciorul diabetic - concluzii

Inspecţia piciorului se va efectua la fiecare vizită iar examinarea


completă
p anual

Testarea sensibilităţii periferice la bolnavul cu diabet se face


anual

Se recomandă un control agresiv al glicemiei pentru a reduce


riscul apariţiei piciorului diabetic

Pacientul trebuie învăţat să-şi examineze piciorul si să-l


îngrijească

Se va trimite pacientul la chirurg, ortoped, dermatolog la


apariţia unei răni, infecţii, onicomicoze
Complicaţiile cutanate ale diabetului zaharat

• Dermatoze datorate diabetului zaharat şi complicaţiilor sale


- manifestări cutanate ale neuropatiei diabetice
- manifestări
if tă i cutanate
t t ale
l angiopatiei
i ti i di
diabetice
b ti
- infecţiile cutanate

• Dermatoze datorate tratamentului specific diabetului zaharat

• Dermatoze asociate cu diabetul zaharat


Manifestări cutanate ale neuropatiei
p diabetice

• Tegumentul uscat
• Pierderea părului la nivelul gambelor
• Hiperhidroza
Hi hid
• Durilloamele şi hiperkeratoza plantară
• Hematoamele subungheale
• Venectaziile
• Edemul neuropat
• U
Ulcerele
ce e e neuropate
eu opa e
Manifestări cutanate ale angiopatiei
g diabetice

• Dermopatia diabetică

• Necrobioza lipoidică

• Rubeoza facială

• Ulcerele arteriopate
Infecţiile
ecţ e cuta
cutanate
ate

• Tinea pedis
p
• Onicomicoza
• Onicodistrofia
• Alte infecţii micotice cutanate
• Foliculite
• Furunculoze
• Fasceita necrozantă
Dermatoze datorate tratamentului specific
diabetului zaharat

• Lipodistrofia insulinică
• Alergia la insulină
• Reacţiile la ADO - eritem polimorf
- necroliză epidermică toxică
• Reacţiile
R ţiil lilichenoide
h id
• Infecţii cutanate la locurile de injectare (S. aureus)
Dermatoze asociate cu diabetul zaharat

• Buloza diabetică
• Scleredemul
• Acanthosis nigricans
g
• Xantoamele eruptive
• Vitiligo
• Granulomul inelar
• Carotenodermia
Evaluarea iniţială

Obiective
• evaluarea statusului bolii şi a factorilor de risc pentru
complicaţiile diabetului
• informarea pacientului despre natura şi severitatea bolii
• educaţia pacientului în legătura cu dieta adecvată,
exerciţiul fizic, medicaţie, automonitorizarea glicemiei
• sstabilirea
ab ea u unuiu pplan
a terapeutic
e apeu c
• stabilirea unui plan de monitorizare

Metode
- anamneză
- examen clinic complet
- investigaţii paraclinice
Examen
a e cclinic
c

• Greutate si înălţime,
ţ , IMC (Kg/m²),
( g ), circumferinţa
ţ abdominală
• TA
• Frecvenţa
ţ cardiacă
• Palparea tiroidei
• Examinarea cordului
• Examinarea piciorului
• Examinarea pielii
• Examinarea neurologică (reflexe, sensibilitatea vibratorie,
tactilă, termică, dureroasă)
Investigaţii
est gaţ paparaclinice
ac ce

• Glicemia bazală şşi la 2 ore p


postprandial
p
• Colesterol total, LDL-colesterol, HDL-colesterol
• Trigliceride
• A id uric
Acid i
• Uree, creatinină serică, clearence-ul de creatinină
• Examenul de urină
• Microalbuminuria
• EKG
• Examen FO
• Radiografia toracică
• Ecografie abdominală
• Oscilometrie
Monitorizare
Evaluarea
E l iiniţială
iţi lă
Prima vizită Educaţia pacientului: informaţii asupra bolii
şi stilului de viaţă

Urmărirea rezultatelor automonitorizării


La fiecare glicemiei (dacă aceasta s-a făcut)
Măsurarea TA
consultaţie Măsurarea greutăţii / IMC şi a CA
Inspecţia piciorului
Determinarea HbA1c pentru evaluarea
La 3 luni controlului glicemic

Examen FO
Anual Depistarea microalbuminuriei
Profil lipidic
Evaluarea riscului pentru picior diabetic,
testarea sensibilităţii
Tratamentul
ata e tu ddiabetului
abetu u zaharat
a a at

• DZ este o boală cronică

• Obiectivul principal: menţinerea parametrilor clinici şi


biochimici specifici
p cât mai aproape
p p de normal

• Tratamentul trebuie privit în perspectiva speranţei de


viaţă
Criteriile
C te e u unui
u bu
bun control
co t o metabolic
etabo c

• Glicemia preprandială: 80
80-110
110 (130) mg/dl
• Glicemia postprandială: 100-145 (180) mg/dl
• HbA1c: < 7% (selectiv 6
6,5
5%%, chiar 8% la pacienții cu risc)
• Colesterol total: < 200 (180) mg/dl
• LDL-colesterol: < 100 (70) mg/dl
• HDL-colesterol > 40 mg/dl (B), 50 mg/dl (F)
• Trigliceride a jeun: < 150 mg/dl
• TA < 140/90 mmHg (selectiv 130/80 mmHg)
• IMC < 25 kg/m2 (B), < 24 kg/m2 (F)
I
Importanţa
t ţ controlului
t l l i glicemic
li i

Obiectivul principal al terapiei în DZ 2 este de

a obţine valori ale glicemiei cât mai aproape

de valorile normale
normale, în scopul de a preveni şi

încetini apariţia
p ţ complicaţiilor
p ţ macro ş
şi

microvasculare
Hemoglobina
g glicozilată
g

• “Standardul de aur” pentru monitorizarea glicemiei

• Reflectă o medie a valorilor glicemiei pe o perioadă


anterioară de 2-3 luni

• Se exprimă ca procent din totalul Hb (normal 4


4-6%)
6%)

• Se corelează bine cu valorile glicemiei

• Obiectiv realistic - Valoarea cea mai scăzută a HbA1c


obţinută fără reacţii adverse inacceptabile
Corelaţii
Co e aţ între
t e valorile
a o e Hbb A1c ş
şi glicemie
g ce e

A1c (%) Media glicemiilor

6 135 mg/dl (7,5


(7 5 mmol/l)
7 170 mg/dl (9,5 mmol/l)
8 205 mg/dl (11,5
(11 5 mmol/l)
9 240 mg/dl (13,5 mmol/l)
10 275 mg/dl (15,5
(15 5 mmol/l)
11 310 mg/dl (17,5 mmol/l)
12 345 mg/dl ( 19,5
19 5 mmol/l)
Avantajele
a taje e HbA
b 1c

• Evaluare obiectivă a controlului glicemic

• Se corelează cu riscul de apariţie a complicaţiilor

• Nu poate fi manipulată de pacient

• Neinfluenţată
ţ de modificările recente ale g
glicemiei ca
urmare a ingestiei de alimente
Automonitorizarea glicemiei
g

• C
Creşte
t complianţa
li ţ la
l ttratament
t t şii are efect
f t favorabil
f bil
asupra schimbării stilului de viaţă
• Frec
Frecvenţa
enţa se stabileşte în ffuncţie
ncţie de pacient
pacient, stadi
stadiull bolii
bolii,
riscul evenimentelor hipoglicemice
• Ajută la individualizarea tratamentului şi adaptarea
măsurilor nefarmacologice
• Dezavantaje
– cost crescut
– disconfort fizic
Metode
etode de tratament
t ata e t

• Tratamentul dietetic

• Exerciţiul fizic

• Tratamentul medicamentos (insulină şi/sau ADO)

• Educaţia specifică
Tratamentul
ata e tu ddietetic
etet c

• Locul dietoterapiei
p în tratamentul DZ

• Obiectivele tratamentului nutriţional:


- menţinerea glicemiei la un nivel cât mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea şi tratarea complicaţiilor acute şi cronice
- creşterea calităţii vieţii printr-o alimentaţie adecvată
Recomandările nutriţionale generale pentru
pacientul
i t l diabetic
di b ti

• Calorii
• Glucide: 55-60 % din aportul caloric
• Fibre alimentare: 30-40 g/zi
g
• Lipide: sub 30 % din calorii
• Colesterol: < 300 mg/zi
• Proteine: 12-15 % din aportul caloric
• Sodiu: < 6 g NaCl / zi; la hipertensivi < 3
g NaCl / zi
• Alcoolul
• Edulcorantele
• Vitamine şi minerale
Etapele
tape e a
alcătuirii
cătu uneiu e diete
d ete

• Precizarea caracteristicilor ggenerale ale dietei


• Calculul aportului caloric
• Distribuţia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine ((1/2 / animale, 1/2/ vegetale))
• Distribuirea glucidelor pe numărul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
• Alegerea alimentelor
• Pregătirea corectă a alimentelor (reguli de gastrotehnie)
Factori care influenţează indexul glicemic

• Concentraţia în glucide a alimentelor


• Conţinutul de proteine şi lipide al alimentelor
• Conţinutul în fibre alimentare
• P
Prezenţa
ţ de
d amidon
id greu di digerabil
bil
• Mărimea particulelor de amidon
• Forma fizică a hranei
• Conţinutul hidric al alimentelor
• Temperatura
p alimentelor
• Prezenţa inhibitorilor enzimatici naturali, a fitaţilor şi taninelor
• Gradul de prelucrare mecanică prin masticaţie
Exemple de index glicemic
138% Glucoză
126% Miere
100% Gl
Glucozăă 100% Pâi
Pâine albă lbă
90-99% Pâine integrală, piure de
cartofi, biscuiţi
80 89% Piure
80-89% Pi de
d cartofi,
t fi morcovii 80 89% Cartofi,
80-89% C t fi b banane
70-79% Pâine integrală, orez, cartofi 70-79% Chips-uri
60-69% Pâine albă, banane 60-69% Macaroane, spaghete fierte
15 minute
50-59% Spaghete fierte 5 minute, 50-59% Mere, portocale, mazăre
chips-uri
40-49% Mazăre, portocale 40-49% Spaghete fierte 5 minute,
lapte
30-39% Lapte, mere 30-39% Fructoză
20-29% Fasole păstăi, fructoză
10-19% Arahide, soia 10-19% Arahide, soia
Efortul fizic terapeutic - beneficii

• Scade g
glicemia şşi HbA1c
• Ameliorează profilul lipidic
-  TG
-  LDL-colesterolul
-  HDL-colesterolul
• Ameliorează HTA uşoară şi moderată
• Adjuvant al dietei pentru scăderea ponderală
• Ameliorează factorii de risc cardio-vascular
• Creşte tonusul psihic şi calitatea vieţii
Efortul
o tu fizic
c terapeutic
te apeut c - riscuri
scu

• Hipoglicemie
p g
• Hiperglicemie şi cetoză la pacienţii insulino-deficienţi
• Precipitarea şi exacerbarea bolilor cardio-vasculare (angină
pectorală,
t lă iinfarct
f t ded miocard,
i d aritmii,
it ii moarte t subită)
bită)
• Agravarea complicaţiilor cronice ale DZ
- retinopatie proliferativă: hemoragii vitreene
vitreene, deslipiri de retină
- nefropatie:  proteinuria
- neuropatie periferică: leziuni ale articulaţiilor şi ale ţes. moi
- neuropatie vegetativă: scade răspunsul cardio-vascular la
efort, hipotensiune ortostatică
Tratamentul
ata e tu insulinic
su c

• Istoric

Nicolae Paulescu
1869 - 1931
Clasificarea
C as ca ea insulinelor
su e o

• După
p pprovenienţă
ţ - animale
- de tip uman

• După durata de acţiune


- cu acţiune ultrarapidă (analogi)
( )
- cu durată scurtă de acţiune
- cu acţiune intermediară
- cu durată lungă de acţiune
- insuline premixate
Insulinemia plasmatică la persoane cu diabet
zaharat tip 1 şi subiecţi sănătoşi

N 8 Subiecţi
N=8 S bi ţi sănătoşi
ă ăt i N 24 DZ1
N=24
480 Insulină umană regular
Analog rapid de insulină
400

320
pmol/L
240

160

80

0
07:00 12:00 18:00 24:00 06:00 h
Momentul zilei
Insulina LISPRO Humalog®

S S
A-chain 21

1
S
S

S S
1
B28 B29 30
LYS PRO
B-chain
Analogii rapizi de insulină

Glulisine
Analogii
a og de insulină
su ă cu acţiune
acţ u e lungă
u gă

Insulina glargine
(lantus)

Insulina detemir
(levemir)
Preparate de insulină
• Cu acţiune ultrarapidă (analogi de insulină):
- NovoRapid
- Humalog
- Apidra
• Cu acţiune scurtă:
- Actrapid HM
- Humulin R
- Insuman Rapid
• Cu acţiune intermediară:
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal
• Cu acţiune lungă:
- Monotard HM
- Humulin L
• Analogi de insulină cu acţiune lungă:
- Lantus
- Levemir
• Insuline premixate:
- Mixtard 10 – 50 HM ((Mixtard 30 HM))
- Humulin M1 – 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50
• Analogi
A l i premixaţi:
i ţi
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Scheme
Sc e e de insulinoterapie
su ote ap e

• Convenţională
ţ

• Intensificată
f
Insulinoterapia intensificată

• Insuline prandiale
• Insuline bazale
Administrarea insulinei

• Căile de administrare

• Dispozitivele de administrare

• Autocontrolul şi ajustarea dozelor

• Pompa
P d iinsulină
de li ă

• Indicaţiile insulinoterapiei
Efectele
ecte e secu
secundare
da e a
ale
e insulinoterapiei
su ote ap e

• Hipoglicemia
• Lipodistrofia
• Abcesele la locul injecţiei
• Alergia la insulină
• Producţia
ţ de anticorpip la ppreparatele
p insulinice
• Creşterea în greutate
• Edemul insulinic
• Neuropatia dureroasă
• Scăderea acuităţii vizuale
Hiperglicemiile
pe g ce e matinale
at a e

• Subinsulinizarea

• Fenomenul Somogyi

• Fenomenul de zori (Dawn phenomenon)


Tratamentul cu preparate non-insulinice

• Medicamente care cresc secreţia pancreatică de insulină


- sulfonilureice
- reglatori prandiali ai glicemiei
• Medicamente care scad rezistenţa la insulină
- biguanide
- tiazolidindione
• Medicamente care scad absorbţia intestinală de glucoză
- inhibitori de alfa
alfa-glucozidază
glucozidază
• Incretinele
• Inhibitorii de SGLT2
Medicamente care cresc secreţia pancreatică
de insulină (secretagoge)
Canalul KATP cu cele două componente: receptorul
sulfonilureic ((SUR 1)) şşi canalul rectificator de K ((Kir 6.2))

Ansamblul
canalului

Componenta SUR Componenta Kir 6.2


Închiderea canalului KATP prin
legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1
Preparatele sulfonilureice

Agentul sulfonilureic Preparate comerciale Doza maximă


Generaţia I
- tolbutamid Tolbutamid; 500 mg 3000 mg
- clorpropamid Diabinese; 250 mg 500 mg
Generaţia a II-a
- glibenclamid Glibenclamid; 5 mg 15 mg
Maninil;; 1,75;
, ; 3,5
, mg
g 10,5
, mgg

- glipizid Glucotrol; 5 şi 10 mg 10 mg
- gliclazid Diaprel MR; 30 mg 90 mg
- gliquidona Glurenorm; 30 mg 90 mg
Generaţia a III-a
- glimepiride Amaryl; 1, 2, 3 şi 4 mg 6 mg
Sulfonilureicele
• Efecte secundare:
- Hipoglicemia
- Creșterea în greutate
- Reacții alergice
- Împiedică precondiționarea ischemică → creșterea riscului de
IMA?
• Alte contraindicații:
- DZ tip 1 sau alte forme de DZ cu cetoacidoză
- S i șii alăptarea
Sarcina lă t
- Dezechilibrul glicemic marcat
- Insuficiență hepatică,
hepatică renală (RFG < 30 ml/min)
- Intervenții chirurgicale majore
Reglatorii
g prandiali
p ai glicemiei
g

• Acelaşi
A l i mecanism
i d
de acţiune
ţi ca all sulfonilureicelor
lf il i l

• Durată scurtă de acţiune

• Risc hipoglicemic redus

• “O
O masă o doză
doză, nici o masă nici o doză”
doză

• Preparate: - Repaglinida (NovoNorm; 0,5 – 1 – 2 mg)

- Nateglinida (Starlix)
Medicamente care scad rezistenţa
ţ la insulină
Biguanidele
• Mecanism de acţiune
- Reduc insulinorezistența (mai ales prin reducerea PHG)
- Ameliorează captarea periferică a glucozei
- Favorizează activitatea GLUT 4 și glicoliza anaerobă, inhibă
statusul proinflamator și protrombotic, reduc lipoliza etc.
- Posibilă ameliorare a RCV și a riscului neoplazic

• Preparate:
- fenformin
- metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp
= 500 mg,
mg 850 mg,
mg 1000 mg; doza max.max = 3000 mg)
- buformin: Silubin Retard (1 cp = 100 mg; doza max. = 300 mg)
Biguanidele
g

• Efecte secundare:
- Efecte
f digestive (grețuri,
( vărsături, dureri abdominale, tulburări
de tranzit, balonări, anorexie)
- Acidoza lactică (doar când nu sunt respectate contraindicațiile)
• Contraindicații:
- Insuficiență
ț hepatică
p
- Insuficiență renală (RFG < 45/30 ml/min)
- Insuficiență cardiacă (FE < 45%)
- Insuficiență respiratorie
- Investigații cu substanțe de contrast iodate (temporar)
- Anestezia
A t i generală lă (temporar)
(t )
- Altele: deficitul de Vitamina B12, hipersensibilitatea, hipoxia etc.
Tiazolidindionele (glitazonele)

• Mecanism de acţiune: PPAR  (peroxisome proliferator


activated
ti t d receptors)
t )
• Reduc IR (mai ales cea periferică)
• Determină redistribuția adipozității centrale,
centrale cu adipogeneză
periferică (adipocite mici, insulinosensibile)

• Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia)
Tiazolidindionele
• Efecte secundare:
- Creștere ponderală
- Retenție hidro-salină
- Agravarea ICC
- Hepatotoxicitate (efect discutabil la TZD noi)
- Creșterea riscului de fractură de șold
• Contraindicații:
- DZ tip 1
- Sarcină și lactație
- Afecțiuni hepatice active (transaminaze peste 2-3 x v.n.)
- APP dde ICC
ICC, SCA
- RCV peste 15% la calculul prin soft-ul UKPDS
Medicamente care scad absorbţia intestinală
de glucoză

Inhibitorii de alfa
alfa-glucozidază
glucozidază

• Mecanism de acţiune: inhibarea α α-glucozidazei


glucozidazei intestinale
(dizaharidază) → reducerea și întârzierea absorbției intestinale
a glucozei → ameliorarea hiperglicemiei postprandiale

• Preparate
- acarboza (Glucobay,
(Glucobay 1 cp = 50; 100 mg; doza maximă = 300
mg)
- miglitolul
Inhibitorii de α-glucozidază
g

• Efecte secundare:
- Diaree
- Dureri abdominale
- Flatulență

• Contraindicații:
- Sarcină și lactație
- Afecțiuni gastrointestinale (boala Crohn, RCUH)
- BCR avansată
Locurile
L il de
d acţiune
ţi ale
l agenţilor
ţil
antihiperglicemianţi
Sulfonilureice şi Tiazolidindione
repaglinida
Stimulează secreţia de
insulină. Scad rezistenţa la
Repaglinida insulină
Se administrează în în ţesutul adipos şi
special
i l lla pacienţii
i ţii cu muşchi. Scad GNG
glicemii postprandiale
la nivelul ficatului.
crescute.
Inhibitori de  glucozidază Bi
Biguanide
id (metformin)
( tf i )
(acarboza)
Scad rezistenţa la insulină
ÎÎntârzie absorbţia intestinală în ţesutul muscular
muscular.
a carbohidraţilor. Scad GNG la niv. ficatului.
Incretinele
Secreţia de insulină după administrarea de glucoză
oral / intravenos

oral 200
intravenos 
90

LINĂ (mU//L)
dl)

 150 
OZĂ (mg/d

70  
  
50 
   100
30  

 GLUCO

 INSUL

    
10  50 

  

-10 
 
-30 0
 
0 15 30 45 60 75 90 0 15 30 45 60 75 90
TIME (min) TIME ((min))

McIntyre et al, 1964


Efectul incretinic

“Ingestia de glucoză determină un răspuns insulinic mai


pronunţat
p ţ decât g
glucoza administrată intravenos,, indicând
prezenţa unor substanţe secretate de tractul
gastrointestinal care stimulează eliberarea de insulină
printr-un mecanism glucodependent.”

Creutzfeldt. Diabetologia 1985; 28: 565


Definiţia incretinelor

“Gut-derived factors that increase


glucose stimulated insulin secretion”
glucose-stimulated secretion

I crett in
In ● i ●

Intestine Secretion Insulin

Creutzfeldt. Diabetologia 1985; 28: 565


Efectul incretinic la persoanele sănătoase
şi la pacienţii cu diabet zaharat tip 2
Persoane sănătoase Pacienţi cu DZ tip 2

Oral
IV Oral
U/l)

U/l)
IV
sulină (mU

ulină (mU
Insu
Ins

Timp (min) Timp (min)


Incretinele
GLP-1: Glucagon-Like Peptide 1
H A E G T F T S D V S S Y L E G Q A
A
R K L A I F K
G G V W E

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide
A
Y E G T F I S D Y S I A M D K I H
Q
D N K K G K A L L W N V F D Q
W Q
K T Q
H N I

Drucker D. Diabetes Care 2003; 26: 2929


GIP
“Gastric inhibitory polypeptide”
“Glucose-mediated insulinotropic polypeptide”

GM: 4984

Eliberare: duoden, jejun, ileonul proximal

Acţiuni:
- inhibarea secreţiei gastrice acide
- stimularea secreţiei de insulină
- acţiuni insulin-like asupra metabolismului lipidic
GLP-1
“Glucagon-like peptide-1”

GM: aprox. 4000

Eliberare: intestinul subţire distal, colon

Acţiuni:
A ţi i
- stimularea secreţiei de insulină
- inhibarea golirii gastrice
- acţiuni insulin-like extrapancreatice
- inhibarea apetitului
GLP 1
GLP-1
Glucoza
Glucoza
C l l L
Celula

Enterociit
Enteroc
Hipotalamus:
potalamus:
 Apetit
Apetitul
ul

GLP-1

Pancreas:
Pancreas:
Stomac:
Stomac:
 Insulin
Insulinaa
 Motilit
Motilitatea
atea
 Glucagon
Glucagonulul
GLP-1

Alimente… • stimulează secreţia insulinică


indusă de glucoză

• inhibă secreţia de glucagon

• inhibă
i hibă golirea
li gastrică
ti ă

Celulele L → GLP-1 • inhibă apetitul

• ameliorează insulinosensibilitatea

În
Î studii
t dii experimentale…
i t l

• creşte masa β-celulară

Drucker DJ. Mol Endocrinol 2003; 17:161-171


Metabolism glucidic normal

Glucide alimentare
digestie
absorbţie

GIP + + GLP 1
GLP-1

Celula 

↑ secreţia de insulină  euglicemie


Diabet zaharat tip 2

Glucide alimentare

GIP  GLP-1
GLP 1

Celula 

Secreţie ↓ de insulină  hiperglicemie


Efectul administrării de GLP-1
în diabetul zaharat tip 2

Glucoză (mg/dl)
300 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 16

Gluc
250
12

cose (mmol/l)
200
Glucoză 150 * 8
100 GLP-1 * *
* * 4
50 Placebo *
p<0.0001 *
0 0
0 60 120 180 240
40 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 250
ulină (mU/l)

Insulin (pm
30 200
150
Insulină 20
* * * 100
*

mol/l)
*
Insu

10 * * * 50
p<0.0001 0
0
0 60 120 180 240
20 GLP-1 i.v. (1.2 pmol.kg-1.min-1)
mol/l)

15
Glucagon (pm

Glucagon 10

5 * * * * p=0.0009
0
0 60 120 180 240
Timp (min)
Nauck M et al. Diabetologia 1993; 36: 741–744
GLP-1

Masă
Meal
Eliberare
Elib
Intestinalde
d
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

GLP-1
inactiv
inactive

.
Rothenberg P et al. Diabetes 2000; 49 (suppl.1): A39
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1


- Exenatida (Byetta)
- Liraglutida

• Inhibitori de DPP-4

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
Exenatida (Byetta)

• Gila monster (Heloderma


suspectum)
• Aprobat de FDA (2005) şi de
EMEA (2006) pt. trat. DZ 2
• Capăt C-terminal bogat în
reziduuri
id i d de prolină
li ă
• Acţiune de 10 ori mai intensă
d ât a GLP-1
decât GLP 1 nativ
ti
• T1/2 mai lung
GLP-1
GLP 1 şi Exenatida

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402


Exenatida (Byetta, Bydureon)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie
t i cu metformin,
tf i sulfonilureice
lf il i sau TZD
- terapie orală combinată: metformin + sulfonilureice
metformin
tf i + TZD
• Byetta
– Doza iniţială: 5 g
g x 2/zi
– Adm. sc cu (până la) 60 min. înaintea meselor principale
lună doza se poate creşte la 10 g x 2/zi
– După o lună,

• Bydureon – administrare o dată pe săptămână


Agonişti de receptor GLP-1
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1


- Exenatida (Byetta
(Byetta, Bydureon)
- Liraglutida

• Inhibitori de DPP-IV

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
GLP-1

Masă
Meal
Eliberare
Elib
Intestinalde
d
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

Inhibitor de
DPP-4
GLP-1
inactiv
inactive

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39


Inhibitori de DPP-4

• Sitagliptina (Januvia)
- inhibitor competitiv, reversibil şi înalt selectiv al DPP-4
- aprobată de FDA (2006) şi de ANM (2007) pt pt. trat
trat. DZ 2

• Saxagliptina (Onglyza)
Sitagliptina (Januvia)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice

• Doza recomandată: 100 mg/zi (doză unică), indiferent de


orarul meselor
Efecte adverse ale incretinelor

• Agoniștii de receptor de GLP-1


- greţuri şi vărsături (50% dintre pacienţi)
p
- dependente de doză
- se ameliorează pe parcursul tratamentului
- diaree
- hipoglicemii uşoare şi moderate (când se asociază cu SU)

• Inhibitorii de DPP-4 4
- cefalee
- susceptibilitate  pentru infecţii de căi aeriene superioare
Inhibitorii SGLT-2
Filtrarea
t a ea g
glomerulară
o e ua ă

Arteriola aferentă

H2O
Glucoza

Na+, Cl-, K+, HCO3-

Amino
acizi
Creatinina
Uree

Capsula Bowman

Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Arteriola aferentă Glucoza


Na+ Cl-,
K+,
H2O Amino
HCO3-
acizi

Tub contort proximal


Capsula Bowman
Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Majoritatea glucozei
este reabsorbită de
către SGLT2 (90%)

Tub contort proximal

Glucoza
Glucoză restantă este Excreție a
reabsorbită de glucozei
către SGLT1 minimă ppână
(10%) la absentă
Filtrarea glucozei
Inhibitorii SGLT2: O abordare inovativă, insulin-independentă,
de eliminare a excesului de glucoză
g
Reduced glucose
Reabsorbție SGLT2
reabsorption
scăzută a glucozei

Inhibitor SGLT2

Proximal tubule
Tub contort
proximal

Inhibitor
Excrețiedurinară
IIncreased urinary
i
SGLT2 crescută of
excretion a glucozei
excess
SGLT2 glucose ( 70
în exces(~70 g/zi,
g/day,
corespunzătorto280
corresponding
Filtrarea kcal/zi*)
Glucose 280 kcal/day*)
glucozei

Inhibitorii SGLT2 inhibă în mod selectiv SGLT2


la nivelul tubului contort proximal

≈ 70g/zi
glucoza
Inhibitorii SGLT2: O abordare inovativă, insulin-
independentă,
p , de eliminare a excesului de g
glucoză

Scăderi semnificative ale HbA1c

ELIMINARE
≈ 70g/zi
Pierderea a ≈280 kcal/zi Scădere ponderală
glucoza

Creşterea volumului
urinar cu ≈ 375ml/zi Scăderea tensiunii arteriale
Dapagliflozina
g

• Beneficii
- scăderea HbA1c
- scădere ponderală
- scăderea TA

• Efecte adverse
- risc crescut pentru infecții urinare și genitale?
- risc de deshidratare și hipovolemie?
- risc de agravare a BCR / inducere a IRA prin deshidratare
Algoritmul
go t u de tratament
t ata e t în DZ 2

• Dieta şi exerciţiul fizic

• Antidiabetice orale

• Asocieri de antidiabetice orale

• Insulină ± antidiabetice orale


Preparate combinate de ADO
• Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg
5 mg/500 mg

• Preparate combinate TZD + metformin


Competact 15 mg/850 mg

• Preparate combinate inhibitori DPP-4 + metformin


Janumet 50 mg/850 mg
50 mg/1000 mg
Komboglyze 22,5
5 mg/1000 mg
Individualizarea terapiei în DZ tip 2

Approach to the management


of hyperglycemia
Tinte mai ambitioase
Tinte mai ambitioase more
Tinte mai putin ambitioase
Tinte mai putin ambitioase HbA1c less
stringent 7% stringent
PATIENT / DISEASE FEATURES Atitudine pacienti
Risks potentially associated
Pacienti motivati Pacienti mai putin motivati
low high
with hypoglycemia and
other drug adverse effects

Scazut Disease duration Crescut


newly diagnosed long-standing
Durata bolii
Scurta Lunga Usually not
modifiable
Life expectancy
long
Speranta de viata short
Lunga Scurta
Comorbiditati
Absente Important comorbidities
absent Severe few / mild severe

Complicatii CV
Absente
b Established vascular S
Severe
complications absent
Resursefew / mild severe

Disponibile Absente

Patient attitude and


Ad t t d il B i i t l A I t expected t d154 hiffSE tt l Di bhighly
t 554t 9 I t efforts
treatment t C motivated,
motivated
2012 35 1364adherent,
adherent
Adaptat dupa: Ismail‐Beigi, et al. Ann Intern Med 2011;154:554–9; Inzucchi SE, et al. Diabetes Care 2012;35:1364–79.
I M d 2011 79 less motivated,
motivated non-adherent,
non adherent Potentially
P t ti ll
excellent self-care capacities poor self-care capacities modifiable

Resources and support


Readily available limited
system
ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018