Sunteți pe pagina 1din 369

Diabetul zaharat

Definiţie

• Sindrom heterogen caracterizat printr-o tulburare


complexă în reglarea metabolismului energetic al
organismului, care afectează deopotrivă utilizarea
glucidelor, lipidelor şi proteinelor, precum şi celelalte
metabolisme; aceste alterări sunt datorate insuficienţei
absolute sau relative de insulină. Modificările biochimice pe
care aceste tulburări le antrenează conduc la modificări
celulare funcţionale urmate de leziuni anatomice ireversibile
în numeroase ţesuturi şi organe.
Definiţie

• Nu este o “boală” în sensul tradiţional al termenului

• “Sindrom”
- alcătuit dintr-un grup heterogen de tulburări cu
etiologie şi patogenie diferite
- componentele sindromului au ca element comun
hiperglicemia
Etimologie

• “Diabeiu” (greaca veche) = “a se scurge ca printr-un sifon”


(aluzie la poliuria marcată a acestor pacienţi)

• Thomas Willis (medic, anatomist şi profesor la Oxford)


- 1674 - a adăugat cuvântul “mellitus” (ca mierea)

Diabetes mellitus
(Diabet zaharat)
Presentation of the new
IDF DIABETES
ATLAS
WORLD DIABETES DAY
Numărul de persoane cu diabet zaharat în 2017 și în 2045

IDF Diabetes Atlas Eighth Edition 2017


Prevalența diabetului zaharat
Prevalența diabetului zaharat pe regiuni în
populația cu vârste cuprinse între 20 și 79 ani

Mota M et al. Studiul PREDATORR. Prezentare la Congresul SRDNBM, Mai 2014


Pancreasul endocrin - noţiuni de anatomie şi
fiziologie

Insulele Langerhans

• 800.000 – 1.500.000
• 1 – 2 % din masa
pancreatică totală
• Celule: A, B, C, D
Hormonii secretaţi în celulele insulelor
Langerhans

Tipul Hormonul Efect pe metabolismul glucidic


celular produs
A Glucagon Hiperglicemiant prin glicogenoliză

B Insulină Hipoglicemiant prin mec. multiple


Peptidul C Efecte metab. incomplet cunoscute
Amilină Hiperglicemiant
C(PP) Polipeptid Influenţă pe motilitatea gastrică şi
pancreatic absorbţia principiilor nutritive
D Somatostatin Hiperglicemiant, inhibă secreţia
insulinei
Insulina – structură, sinteză, secreţie
Secreţia insulinei
Secreţia insulinei
• bazală → insulinemia plasmatică = 10-12 μU/ml
• stimulată → insulinemia plasmatică → 50-75 μU/ml
Secreţia insulinei

• Pulsatorie

• Bifazică
Receptorul de insulină
Controlul hormonal al glicemiei
Insulina Hormoni de contrareglare
Efect net: scăderea glicemiei Efect net: creşterea glicemiei

↑ înlăturării glucozei din sânge ↓ înlăturării glucozei din sânge


-↑ intrării glucozei în celule -↓ intrării glucozei în celule
-↑ glicogenezei -↓ glicogenezei
↓ eliberării glucozei din ↑ eliberării glucozei din
depozite depozite
-↓ glicogenolizei -↑ glicogenolizei
-↓ gluconeogenezei -↑ gluconeogenezei
-↓ lipolizei şi cetogenezei -↑ lipolizei şi cetogenezei
-↓ catabolismului proteic -↑ catabolismului proteic
Clasificarea DZ (OMS,1998)
• DZ tip 1 - autoimun
- idiopatic

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet imun
- sindroame genetice rare

• Diabetul gestaţional
Diabetul zaharat tip 1

• Poate apare la orice vârstă, dar mai frecvent sub 30 ani


• Deşi există o predispoziţie genetică, majoritatea
pacienţilor nu au antecedente familiale de DZ
• Debut relativ abrupt, cu simptome evidente şi tendinţă la
cetoacidoză
• De obicei, pacienţii sunt slabi
• Rezultă în urma distrugerii celulelor β-pancreatice
• Insulina plasmatică este foarte redusă sau absentă
• Anticorpi circulanţi: antiinsulină, anticelule β, anti-GAD
• Pacienţii sunt “dependenţi” de insulină
Etiopatogenia DZ 1 autoimun

• Predispoziţie genetică
• Factor de mediu (viral, toxic, alimentar)
• Activare autoimună → insulită
• Scăderea capacităţii β-secretoare; afectarea fazei secretorii
iniţiale, dar insulinemia plasmatică este normală
• Diabet clinic manifest; insulinemie plasmatică scăzută,
hiperglicemie, apar simptomele
• Apariţia complicaţiilor
Diabetul zaharat tip 2

• Apare, de obicei, după vârsta de 40 ani


• 80% din cazuri: obezi
• Perioadă prediagnostică lungă
• Simptomatologie de debut ştearsă sau absentă, fără
tendinţă la cetoacidoză
• Asocierea a două defecte celulare: rezistenţa la insulină
şi deficienţa funcţiei β-celulare
• Cel puţin iniţial, capacitatea secretorie β-pancreatică
este relativ păstrată, răspunzând bine la dietă şi ADO;
ulterior, unii vor necesita insulinoterapie
Etiopatogenia DZ 2

• Factori genetici – transmitere poligenică


• Rezistenţă crescută la acţiunea insulinei
Posibilele defecte cauzatoare de insulinorezistenţă
La nivel de prereceptor
• Insulină anormală
• Degradarea crescută a insulinei
• Prezenţa în sânge a antagoniştilor hormonali
La nivel de receptor
• Scăderea numărului de receptori
• Receptori anormali
• Alterarea unor funcţii ale receptorului
(↓ activităţii tirozinkinazei, autofosforilarea receptorului)
La nivel postreceptor
• Alterări ale sistemului efectorilor (transportorii de glucoză)
• Defecte ale enzimelor i.c. implicate în metab. intermediare
Etiopatogenia DZ 2

• Factori genetici – transmitere poligenică


• Rezistenţă crescută la acţiunea insulinei
• Hiperinsulinism funcţional
• Deficienţă în secreţia insulinică → hiperglicemie persistentă
• Tulburări insulinosecretorii
- ↓ caracterului pulsator al insulinei
- dispariţia “fazei precoce” a răspunsului insulinic
- întârzierea secreţiei de insulină
Absenţa fazei precoce a secreţiei insulinei
la pacientul cu DZ 2
Etiopatogenia DZ 2

• Factori genetici – transmitere poligenică


• Rezistenţă crescută la acţiunea insulinei
• Hiperinsulinism funcţional
• Deficienţă în secreţia insulinică → hiperglicemie persistentă
• Tulburări insulinosecretorii
- ↓ caracterului pulsator al insulinei
- dispariţia “fazei precoce” a răspunsului insulinic
- întârzierea secreţiei de insulină
• Scăderea absolută a secreţiei insulinice →
→ DZ 2 insulinonecesitant
Fiziopatologia DZ 2

Rezistenţă Disfuncţie
la insulină DZ 2 β-celulară

Scăderea funcţiei
Concentraţia β-celulare
insulinei

Euglicemie
Normal STG ± obezitate Diagnosticul Progresia DZ 2
de DZ 2
Fiziopatologia DZ 2
Reducerea Efect scăzut al incretinelor
secreției de Lipoliză crescută
insulină
Insulă celule β

Secreție crescută de
glucagon Vas sangvin

Insulă celule α Reabsorbție


Hiper- crescută a
glicemie glucozei

Sinteză hepatică
crescută a
glucozei

Captare scăzută a
Disfuncția glucozei
neurotransmițătorilor

Adaptat după: DeFronzo RA. Diabetes 2009;58:773–95. Wolters Kluwer Health


Clasificarea DZ (OMS,1998)
• DZ tip 1 – autoimun (1A)
- idiopatic (1B)

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet imun
- sindroame genetice rare

• Diabetul gestaţional
Diagnosticul clinic al DZ

• Poliurie
• Polidipsie
• Polifagie
• Scădere ponderală
• Astenie
Caracteristicile generale ale DZ 1 şi 2
Particularitate Tipul 1 Tipul 2
Ereditate Concordanţă 30-50% Concordanţă 90%

Baza genetică Defect în programarea IR şi/sau insulino-


imunităţii deficienţă
Semne de Prezente Absente
autoimunitate
Debut Sub 40 de ani Peste 40 de ani
IMC Scăzut Crescut (80%)
Insulinemia Scăzută Crescută
plasmatică
Tendinţa la Marcată Absentă
cetoză
Tratament oral Ineficient Eficient
Criterii de diagnosticare a DZ
(diagnosticul paraclinic)

• Prezenţa simptomelor şi o glicemie întâmplătoare (în orice


moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• N.B. - glicozuria NU este un criteriu de dg.


- NU se recomandă ca dg. de DZ să se bazeze pe
glicemii efectuate pe glucometre
Criterii de diagnosticare a DZ
(diagnosticul paraclinic)

• Prezenţa simptomelor şi o glicemie întâmplătoare (în orice


moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• Criteriu nou – HbA1c ≥ 6,5%


Criterii de interpretare a glicemiei bazale

• 70-110 mg/dl – normal

• 110-125 mg/dl – glicemie bazală modificată

• ≥ 126 mg/dl – diabet zaharat probabil;


confirmarea se face după a doua dozare
Glucoza plasmatică versus glucoza din
sângele total

Glucoza din plasmă Glucoza din sângele total

126 mg/dl (7 mmol/l) 110 mg/dl (6,1 mmol/l)

200 mg/dl (11,1 mmol/l) 171 mg/dl (9,5 mmol/l)


Criterii de interpretare a TTGO
Glicemie în plasma venoasă
Diabet zaharat
- bazal ≥ 126 mg/dl (7 mmol/l)
- la 2 h după glucoză ≥ 200 mg/dl (11,1 mmol/l)

Scăderea toleranţei la
glucoză
< 126 mg/dl (7 mmol/l)
- bazal
≥ 140 mg/dl (7,8 mmol/l) şi
- la 2 h după glucoză
< 200 mg/dl (11,1 mmol/l)
Normal
- bazal < 110 mg/dl (7 mmol/l)
- la 2 h după glucoză < 140 mg/dl (7,8 mmol/l)
Diabetul gestațional

• Risc crescut pentru macrosomie fetală, HTA de sarcină, pre-


eclampsie, distocie de umăr
• Fereastra de diagnostic: săpt. 24-28 de sarcină
• Factori de risc: IMC ≥ 30 kg/m2, DG sau macrosomie în cursul
sarcinilor anterioare, istoric familial de DZ, apartenență la
grupuri etnice cu risc
• Gravidele care prezintă factori de risc pot necesita efectuarea
TTGO cu 75 g glucoză pulbere
• Multipli algoritmi de diagnostic
• OMS, 2018: două categorii distincte – diabetul gestațional
(DG) și DZ în cursul sarcinii
Criterii de diagnostic pentru diabetul gestațional
și DZ în cursul sarcinii (OMS, 2018)

Diabetul gestațional (DG) DZ în cursul sarcinii


Unul sau mai multe din următoarele Unul sau mai multe din următoarele
criterii: criterii:
• glicemia à jeun = 92-125 mg/dL • glicemia à jeun ≥ 126 mg/dL (7
(5,1-6,9 mmol/l) mmol/l)
• glicemia la 1 oră în cadrul TTGO • glicemia la 2 ore în cadrul TTGO
cu 75 g glucoză pulbere ≥ 180 cu 75 g glucoză pulbere ≥ 200
mg/dL (10 mmol/l) mg/dL (11,1 mmol/l)
• glicemia la 2 ore în cadrul TTGO • glicemia întâmplătoare ≥ 200
cu 75 g glucoză pulbere = 153-199 mg/dL (11,1 mmol/l) în prezența
mg/dL (8,5-11 mmol/l) simptomatologiei sugestive

DZ în cursul sarcinii: hiperglicemia este mai severă și nu se remite după


naștere
Modalităţi de debut şi de diagnostic ale DZ

• Pacient simptomatic
- simptomele clasice de diabet
- simptome ale complicaţiilor - acute
- cronice

• Pacient asimptomatic
- bilanţ al stării de sănătate
- depistare activă la subiecţi cu risc
Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici cu ajutorul glicemiei bazale (1)

• Toţi subiecţii cu vârsta ≥ 45 ani

• Glicemia à jeun se va repeta la intervale de minimum 3 ani

• Testarea se va face la vârste sub 45 ani şi se va repeta la


intervale mai scurte la toți subiecții cu IMC ≥ 25 kg/m2 (IMC
≥ 23 kg/m2 la asiatici) care mai prezintă și alți factori de risc
Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici cu ajutorul glicemiei bazale (2)
Subiecți cu factori de risc:
- sedentarii
- persoanele cu rude de gradul I cu DZ
- grupurile etnice cu risc crescut
- hipertensivii (≥ 140/90 mmHg sau sub trat. antihipertensiv)
- dislipidemicii (HDL < 35 mg/dl şi/sau TG > 250 mg/dl)
- femeile care au născut copii cu greutatea peste 4,5 kg
- femeile care au avut diabet gestaţional
- femeile cu ovar polichistic
- persoanele cu HbA1c ≥ 5,7%, GBM sau STG la testări ant.
- alte condiții clinice asociate cu insulinorezistență (obezitate
severă, acanthosis nigricans)
- antecedente de BCV
Tratamentul diabetului zaharat
Tratamentul diabetului zaharat

• DZ este o boală cronică

• Obiectivul principal: menţinerea parametrilor clinici şi


biochimici specifici cât mai aproape de normal

• Tratamentul trebuie privit în perspectiva speranţei de


viaţă
Prevenţia primară a DZ tip 1
• Promovarea alimentării copilului la sân
• Evitarea bolilor infecţioase cu potenţial diabetogen
• Evitarea substanţelor toxice pancreatotrope
• Măsuri farmacologice

Prevenţia primară a DZ tip 2


• Controlul greutăţii
• Promovarea activităţii fizice
• Diete bogate în fibre şi sărace în grăsimi
• Măsuri farmacologice
Prevenţia secundară – prevenirea apariţiei
complicaţiilor
• Diagnostic precoce
• Controlul glicemiei (HbA1c)
• Tratamentul factorilor de risc vascular (obezitate,
dislipidemie, hipertensiune)
• Evitarea fumatului
• Detectarea complicaţiilor cronice în stadiul subclinic

Prevenţia terţiară
• Tratamentul activ al complicaţiilor cronice
• Evitarea complicării complicaţiilor
Criteriile unui bun control metabolic

• Glicemia preprandială: 80-110 (130) mg/dl


• Glicemia postprandială: 100-145 (180) mg/dl
• HbA1c: < 7% (selectiv 6,5 %, chiar 8% la pacienții cu risc)
• Colesterol total: < 200 (180) mg/dl
• LDL-colesterol: < 100 (70) mg/dl
• HDL-colesterol > 40 mg/dl (B), 50 mg/dl (F)
• Trigliceride a jeun: < 150 mg/dl
• TA < 140/90 mmHg (selectiv 130/80 mmHg)
• IMC < 25 kg/m2 (B), < 24 kg/m2 (F)
Metode de tratament

• Tratamentul dietetic

• Exerciţiul fizic

• Tratamentul medicamentos (insulină şi/sau ADO)

• Educaţia specifică
Tratamentul dietetic

• Locul dietoterapiei în tratamentul DZ

• Obiectivele tratamentului nutriţional:


- menţinerea glicemiei la un nivel cât mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea şi tratarea complicaţiilor acute şi cronice
- creşterea calităţii vieţii printr-o alimentaţie adecvată
Recomandările nutriţionale generale pentru
pacientul diabetic

• Calorii
• Glucide: 55-60 % din aportul caloric
• Fibre alimentare: 30-40 g/zi
• Lipide: sub 30 % din calorii
• Colesterol: < 300 mg/zi
• Proteine: 12-15 % din aportul caloric
• Sodiu: < 6 g NaCl / zi; la hipertensivi < 3 g NaCl / zi
• Alcoolul
• Edulcorantele
• Vitamine şi minerale
Etapele alcătuirii unei diete

• Precizarea caracteristicilor generale ale dietei


• Calculul aportului caloric
• Distribuţia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
• Distribuirea glucidelor pe numărul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
• Alegerea alimentelor
• Pregătirea corectă a alimentelor (reguli de gastrotehnie)
Curba glicemică în funcţie de indexul glicemic
Factori care influenţează indexul glicemic

• Concentraţia în glucide a alimentelor


• Conţinutul de proteine şi lipide al alimentelor
• Conţinutul în fibre alimentare
• Prezenţa de amidon greu digerabil
• Mărimea particulelor de amidon
• Forma fizică a hranei
• Conţinutul hidric al alimentelor
• Temperatura alimentelor
• Prezenţa inhibitorilor enzimatici naturali, a fitaţilor şi taninelor
• Gradul de prelucrare mecanică prin masticaţie
Exemple de index glicemic
138% Glucoză
126% Miere
100% Glucoză 100% Pâine albă
90-99% Pâine integrală, piure de
cartofi, biscuiţi
80-89% Piure de cartofi, morcovi 80-89% Cartofi, banane
70-79% Pâine integrală, orez, cartofi 70-79% Chips-uri
60-69% Pâine albă, banane 60-69% Macaroane, spaghete fierte
15 minute
50-59% Spaghete fierte 5 minute, 50-59% Mere, portocale, mazăre
chips-uri
40-49% Mazăre, portocale 40-49% Spaghete fierte 5 minute,
lapte
30-39% Lapte, mere 30-39% Fructoză
20-29% Fasole păstăi, fructoză
10-19% Arahide, soia 10-19% Arahide, soia
Efortul fizic terapeutic - beneficii

• Scade glicemia şi HbA1c


• Ameliorează profilul lipidic
- ↓ TG
- ↓ LDL-colesterolul
- ↑ HDL-colesterolul
• Ameliorează HTA uşoară şi moderată
• Adjuvant al dietei pentru scăderea ponderală
• Ameliorează factorii de risc cardio-vascular
• Creşte tonusul psihic şi calitatea vieţii
Efortul fizic terapeutic - riscuri

• Hipoglicemie
• Hiperglicemie după eforturi fizice foarte intense
• Hiperglicemie şi cetoză la pacienţii insulino-deficienţi
• Precipitarea şi exacerbarea bolilor cardio-vasculare (angină
pectorală, infarct de miocard, aritmii, moarte subită)
• Agravarea complicaţiilor cronice ale DZ
- retinopatie proliferativă: hemoragii vitreene, deslipiri de retină
- nefropatie: ↑ proteinuria
- neuropatie periferică: leziuni ale articulaţiilor şi ale ţes. moi
- neuropatie vegetativă: scade răspunsul cardio-vascular la
efort, hipotensiune ortostatică
Tratamentul insulinic

• Istoric

Nicolae Paulescu
1869 - 1931
F.F.G. Banting

C.H. Best
J.B. Collip J.R. MacLeod
Leonard Thompson
Principalele etape în dezvoltarea
insulinoterapiei

• Descoperirea insulinei (1921)


• Insuline "clasice" (convenţionale) (1922)
• Insuline cu acţiune prelungită (1936)
• Insuline NPH (1950)
• Insuline înalt purificate (monocomponent) (1978)
• Insuline umane (1982)
• Analogi de insulină (1996)
Clasificarea insulinelor

• După provenienţă - animale


- de tip uman

• După durata de acţiune


- cu durată scurtă de acţiune
- cu acţiune intermediară
- cu durată lungă de acţiune
- insuline premixate

Christian Hagedorn
Insulinemia plasmatică la persoane cu diabet
zaharat tip 1 şi subiecţi sănătoşi

N=8 Subiecţi sănătoşi N=24 DZ1


480 Insulină umană regular
Analog rapid de insulină
400

320
pmol/L
240

160

80

0
07:00 12:00 18:00 24:00 06:00 h
Momentul zilei
Disocierea insulinelor

Insulină umană regular


Vârf de acţiune
2-4 hr

Analog rapid de insulină


Vârf de acţiune
1 hr
Insulina LISPRO Humalog®

S S
A-chain 21

1
S
S

S S
1
B28 B29 30
LYS PRO
B-chain
Analogii rapizi de insulină

Glulisine
Analogii de insulină cu acţiune lungă

Insulina glargine
(Lantus)

Insulina detemir
(Levemir)

Insulina degludec
(Tresiba)
Diferenţa insulină intermediară/Analog lung de
insulină
Insulină sc

4.0 24
NPH
20
3.0

µmol/Kg/min
mg/Kg/min

16

2.0 12
Analog lung de insulină
8
1.0
4

0 0

0 4 8 12 16 20 24
Timp (ore)
Preparate de insulină

• Cu acţiune scurtă
- Actrapid HM
- Humulin R
- Insuman Rapid
• Cu acţiune intermediară
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal
• Cu acţiune lungă
- Monotard HM
- Humulin L
Analogi de insulină

• Analogi de insulină cu acţiune rapidă


(insuline ultrarapide)
- Insulina aspart (NovoRapid, FiAsp)
- Insulina lispro (Humalog 100, Humalog 200)
- Insulina glulisine (Apidra)
• Analogi de insulină cu acţiune lungă
- Insulina Glargine 100 U/ml (Lantus, Abasaglar)
- Insulina Glargine 300 U/ml (Toujeo)
- Insulina Detemir (Levemir)
- Insulina Degludec (Tresiba)
• Insuline premixate
- Mixtard 10 – 50 HM (Mixtard 30 HM)
- Humulin M1 – 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50

• Analogi premixaţi
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Profil de acţiune

140
120 Acţiune rapidă (lispro, aspart, glulisine)
Nivelul insulinei (µU/ml)

100
80 Durată scurtă (Regular)
60 Intermediare (NPH)
40 Acţiune lungă
20 (glargine, levemir)
0
0 2 4 6 8 10 12 14 16
Ore
Scheme de insulinoterapie

• Convenţională

• Intensificată
Scheme de insulinoterapie

• Convenţională
- număr redus de injecții
- automonitorizare minimă sau absentă
- regim de viață cu flexibilitate minimă
- doze ”fixe” de insulină
• Intensivă
- regim insulinic bazal-bolus (injecții multiple)
- automonitorizare intensivă
- regim flexibil de viață
- adaptarea permanentă a dozelor de insulină la nece-
sitățile zilnice
Insulinoterapia intensificată

• Insuline prandiale
• Insuline bazale
Administrarea insulinei

• Căile de administrare

• Dispozitivele de administrare

• Autocontrolul şi ajustarea dozelor

• Pompa de insulină

• Indicaţiile insulinoterapiei
Indicaţiile insulinoterapiei
în diabetul zaharat tip 2

• Menţinerea dezechilibrului glicemic în ciuda dozelor


maxime de agenţi orali combinaţi
• Hiperglicemie cu cetonemie şi cetonurie
• Decompensarea generată de evenimente intercurente
• Managementul perioperator
• Sarcina şi lactaţia
• Hepatopatii şi/sau nefropatii
• Alergia sau alte reacţii adverse serioase la ADO
• Hiperglicemii importante în momentul prezentării
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Cauze de creştere ponderală
la diabeticii trataţi cu insulină

• Creşterea apetitului

• Reducerea termogenezei indusă de insulină

• Retenţia de calorii care înainte se pierdeau prin glicozurie

• Consum caloric excesiv ca răspuns la hipoglicemie sau la


frica de hipoglicemie
Consecinţele creşterii ponderale la diabetici

Creştere Agravarea
ponderală insulinorezistenţei

Creşterea necesarului de insulină


pentru a menţine controlul glicemic
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Reacţii induse de anticorpii antiinsulină

Răspunsul imun la insulina exogenă este determinat de:


- insulina administrată
- imunogenicitate: bovină > porcină > umană
- contaminanţi: peptide insulare, proinsulină, glucagon,
polipeptid pancreatic, somatostatin
- conservanţi, protamină
- derivaţi de insulină, generaţi în cursul procesului de
extragere chimică sau formaţi spontan

- persoana care o primeşte (determinare genetică)


- titru redus de anticorpi la persoanele cu HLA B8/DR3
Reacţii induse de anticorpii antiinsulină

• Reacţii alergice la insulină

• Insulinorezistenţă imunologică

• Hipoglicemii determinate de anticorpii antiinsulină


Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Lipoatrofia insulinică

• Pierderea de grăsime subcutanată la locul de injectare

• Lipoatrofia apare la persoanele cu niveluri ridicate de


anticorpi circulanţi antiinsulină
Lipohipertrofia insulinică

• Acumulare de grăsime la locul de injectare a insulinei


• Efectul lipogenic al insulinei determină acumulare de
trigliceride şi hipertrofie adipocitară în zonele expuse în
mod repetat la concentraţii mari de insulină
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Abcesele la locul injecţiei

• Foarte rare la diabetici

• Conservanţi: fenol, metilhidroxibenzoat

• Dezinfectantele cu care se sterilizau seringile de sticlă:


metilsalicilat, dietilftalat
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Edemul insulinic

• Pacienţii la care s-a instituit recent insulinoterapia pot


dezvolta edeme periferice în primele săptămâni de
tratament
• Determinate de retenţia de sodiu care se asociază
insulinoterapiei intensive

• Tranzitor

• Tratament:
- limitarea aportului de sodiu
- diuretice
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Hiperglicemiile matinale

• Subinsulinizarea

• Fenomenul Somogyi

• Fenomenul de zori (Dawn phenomenon)


Tratamentul cu preparate non-insulinice

• Medicamente care cresc secreţia pancreatică de insulină


- sulfonilureice
- reglatori prandiali ai glicemiei
• Medicamente care scad rezistenţa la insulină
- biguanide
- tiazolidindione
• Medicamente care scad absorbţia intestinală de glucoză
- inhibitori de alfa-glucozidază
• Incretinele
• Inhibitorii de SGLT2
Medicamente care cresc secreţia pancreatică
de insulină (secretagoge)
Canalul KATP cu cele două componente: receptorul
sulfonilureic (SUR 1) şi canalul rectificator de K (Kir 6.2)

Ansamblul
canalului

Componenta SUR Componenta Kir 6.2


Închiderea canalului KATP prin
legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1
Preparatele sulfonilureice

Agentul sulfonilureic Preparate comerciale Doza maximă


Generaţia I
- tolbutamid Tolbutamid; 500 mg 3000 mg
- clorpropamid Diabinese; 250 mg 500 mg
Generaţia a II-a
- glibenclamid Glibenclamid; 5 mg 15 mg
Maninil; 1,75; 3,5 mg 10,5 mg

- glipizid Glucotrol; 5 şi 10 mg 10 mg
- gliclazid Diaprel MR; 60 mg 120 mg
- gliquidona Glurenorm; 30 mg 90 mg
Generaţia a III-a
- glimepiride Amaryl; 1, 2, 3 şi 4 mg 6 mg
Sulfonilureicele
• Efecte secundare:
- Hipoglicemia
- Creșterea în greutate
- Reacții alergice
- Împiedică precondiționarea ischemică → creșterea riscului de
IMA?
• Alte contraindicații:
- DZ tip 1 sau alte forme de DZ cu cetoacidoză
- Sarcina și alăptarea
- Dezechilibrul glicemic marcat
- Insuficiență hepatică, renală (RFG < 30 ml/min)
- Intervenții chirurgicale majore
Reglatorii prandiali ai glicemiei

• Acelaşi mecanism de acţiune ca al sulfonilureicelor

• Durată scurtă de acţiune

• Risc hipoglicemiant redus

• “O masă o doză, nici o masă nici o doză”

• Preparate: - Repaglinida (NovoNorm; Reneos: 0,5 - 1 - 2 mg)

- Nateglinida (Starlix)
Medicamente care scad rezistenţa la insulină
Biguanidele
• Mecanism de acţiune
- Reduc insulinorezistența (mai ales prin reducerea PHG)
- Ameliorează captarea periferică a glucozei
- Favorizează activitatea GLUT 4 și glicoliza anaerobă, inhibă
statusul proinflamator și protrombotic, reduc lipoliza etc.
- Posibilă ameliorare a RCV și a riscului neoplazic

• Preparate:
- fenformin
- metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp
= 500 mg, 850 mg, 1000 mg; doza max. = 3000 mg)
- buformin: Silubin Retard (1 cp = 100 mg; doza max. = 300 mg)
Biguanidele

• Efecte secundare:
- Efecte digestive (grețuri, vărsături, dureri abdominale, tulburări
de tranzit, balonări, anorexie)
- Acidoza lactică (doar când nu sunt respectate contraindicațiile)
• Contraindicații:
- Insuficiență hepatică
- Insuficiență renală (RFG < 45/30 ml/min)
- Insuficiență cardiacă (FE < 45%)
- Insuficiență respiratorie
- Investigații cu substanțe de contrast iodate (temporar)
- Anestezia generală (temporar)
- Altele: deficitul de Vitamina B12, hipersensibilitatea, hipoxia etc.
Tiazolidindionele (glitazonele)

• Mecanism de acţiune: PPAR γ (peroxisome proliferator


activated receptors)
• Reduc IR (mai ales cea periferică)
• Determină redistribuția adipozității centrale, cu adipogeneză
periferică (adipocite mici, insulinosensibile)

• Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia)
Tiazolidindionele
• Efecte secundare:
- Creștere ponderală
- Retenție hidro-salină
- Agravarea ICC
- Hepatotoxicitate (efect discutabil la TZD noi)
- Creșterea riscului de fractură de șold
• Contraindicații:
- DZ tip 1
- Sarcină și lactație
- Afecțiuni hepatice active (transaminaze peste 2-3 x v.n.)
- APP de ICC, SCA
- RCV peste 15% la calculul prin soft-ul UKPDS
Medicamente care scad absorbţia intestinală
de glucoză

Inhibitorii de alfa-glucozidază

• Mecanism de acţiune: inhibarea α-glucozidazei intestinale


(dizaharidază) → reducerea și întârzierea absorbției intestinale
a glucozei → ameliorarea hiperglicemiei postprandiale

• Preparate
- acarboza (Glucobay, 1 cp = 50; 100 mg; doza maximă = 300
mg)
- miglitolul
Inhibitorii de α-glucozidază

• Efecte secundare:
- Diaree
- Dureri abdominale
- Flatulență

• Contraindicații:
- Sarcină și lactație
- Afecțiuni gastrointestinale (boala Crohn, RCUH)
- BCR avansată
Incretinele
Secreţia de insulină după administrarea de glucoză
oral / intravenos

oral 200
intravenos 
90

∆ INSULINĂ (mU/L)
∆ GLUCOZĂ (mg/dl)

  150 
70 
  
50 
   100
 
30
 
    
10  50 

  

-10 
 
-30 0
 
0 15 30 45 60 75 90 0 15 30 45 60 75 90
TIME (min) TIME (min)

McIntyre N. Lancet 1964; 2: 20-21


Efectul incretinic

“Ingestia de glucoză determină un răspuns insulinic mai


pronunţat decât glucoza administrată intravenos, indicând
prezenţa unor substanţe secretate de tractul
gastrointestinal care stimulează eliberarea de insulină
printr-un mecanism glucodependent.”

Creutzfeldt. Diabetologia 1985; 28: 565


Definiţia incretinelor

“Gut-derived factors that increase


glucose-stimulated insulin secretion”

In cret in
● ●

Intestine Secretion Insulin

Creutzfeldt. Diabetologia 1985; 28: 565


Efectul incretinic la persoanele sănătoase
şi la pacienţii cu diabet zaharat tip 2
Persoane sănătoase Pacienţi cu DZ tip 2

Oral
IV Oral
Insulină (mU/l)

Insulină (mU/l)
IV

Timp (min) Timp (min)


Incretinele
GLP-1: Glucagon-Like Peptide 1
H A E G T F T S D V S S Y L E G Q A
A
R K L A I F K
G G V W E

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide
A
Y E G T F I S D Y S I A M D K I H
Q
D N K K G K A L L W N V F D Q
W Q
K T Q
H N I

Drucker D. Diabetes Care 2003; 26: 2929


GIP
“Gastric inhibitory polypeptide”
“Glucose-mediated insulinotropic polypeptide”

GM: 4984

Eliberare: duoden, jejun, ileonul proximal

Acţiuni:
- inhibarea secreţiei gastrice acide
- stimularea secreţiei de insulină
- acţiuni insulin-like asupra metabolismului lipidic
GLP-1
“Glucagon-like peptide-1”

GM: aprox. 4000

Eliberare: intestinul subţire distal, colon

Acţiuni:
- stimularea secreţiei de insulină
- inhibarea golirii gastrice
- acţiuni insulin-like extrapancreatice
- inhibarea apetitului
GLP-1

Alimente… • stimulează secreţia insulinică


indusă de glucoză

• inhibă secreţia de glucagon

• inhibă golirea gastrică

Celulele L → GLP-1 • inhibă apetitul

• ameliorează insulinosensibilitatea

În studii experimentale…

• creşte masa β-celulară

Drucker DJ. Mol Endocrinol 2003; 17:161-171


Metabolism glucidic normal

Glucide alimentare
digestie
absorbţie

GIP + + GLP-1

Celula β

↑ secreţia de insulină → euglicemie


Diabet zaharat tip 2

Glucide alimentare

GIP ↓ GLP-1

Celula β

Secreţie ↓ de insulină → hiperglicemie


GIP vs. GLP-1

GIP GLP-1
42 aa 30-31 aa
Celulele K → duoden Celulele L → ileon +
colon
↑ Secreţia de insulină ↑ Secreţia de insulină
Efect minim asupra golirii gastrice ↓ Golirea gastrică
Efect nesemnificativ asupra ↓ Secreţia de glucagon
secreţiei de glucagon
Efect nesemnificativ asupra ↓ Apetitul şi greutatea
saţietăţii şi greutăţii corporale corporală
↑ Masa β-celulară ↑ Masa β-celulară
Drucker D. Diabetes Care 2003; 26: 2929
Efectul administrării de GLP-1
în diabetul zaharat tip 2

Glucoză (mg/dl)
300 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 16

Glucose (mmol/l)
250
200 12
Glucoză 150 * 8
100 GLP-1 * *
* * 4
50 Placebo *
p<0.0001 *
0 0
0 60 120 180 240
40 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 250
Insulină (mU/l)

Insulin (pmol/l)
30 200
150
Insulină 20
* * * 100
10 * * * * * 50
p<0.0001
0 0
0 60 120 180 240
20 GLP-1 i.v. (1.2 pmol.kg-1.min-1)
Glucagon (pmol/l)

15

Glucagon 10

5 * * * * p=0.0009
0
0 60 120 180 240
Timp (min)
Nauck M et al. Diabetologia 1993; 36: 741–744
GLP-1

Masă
Meal
Eliberare
Intestinal de
GLP-1
GLP -1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

GLP-1
inactiv
inactive

.
Rothenberg P et al. Diabetes 2000; 49 (suppl.1): A39
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1

• Inhibitori de DPP-4

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
Exenatida (Byetta)

• Gila monster (Heloderma suspectum)


• Aprobat de FDA (2005) şi de EMEA (2006) pt. trat. DZ 2
• Capăt C-terminal bogat în reziduuri de prolină
• Acţiune de 10 ori mai intensă decât a GLP-1 nativ
• T1/2 mai lung
GLP-1 şi Exenatida

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402


Exenatida (Byetta, Bydureon)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice
metformin + TZD
• Byetta
– Doza iniţială: 5 µg x 2/zi
– Adm. sc cu (până la) 60 min. înaintea meselor principale
– După o lună, doza se poate creşte la 10 µg x 2/zi

• Bydureon – administrare o dată pe săptămână


Agonişti de receptor GLP-1
Agoniştii de receptor GLP-1

• Cu durată scurtă de acțiune: bazați pe molecula de exendin-


4 (omologie de 50-60% cu GLP-1 uman)
- Exenatide (Byetta) – 2 inj./zi
- Lixisenatide (Lyxumia) – 1 inj./zi
• Cu durată lungă de acțiune: cu excepția exenatidei LAR,
bazați pe molecula de GLP-1 uman (omologie de peste 80%)
- Exenatide LAR (Bydureon) – 1 inj./săpt.
- Liraglutide (Victoza) – 1 inj./zi
- Dulaglutide (Trulicity) – 1 inj./săpt.
- Albiglutide (Eperzan) – 1 inj./săpt.
- Semaglutide (Ozempic) – 1 inj./săpt.
- Semaglutide p.o. (Rybelsus) – 1 cp/zi (aprobat de FDA)
Soluţii farmacologice

• Agonişti de receptor GLP-1

• Inhibitori de DPP-IV

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
GLP-1

Masă
Meal
Eliberare
Intestinal de
GLP-1
GLP -1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

Inhibitor de
DPP-4 GLP-1
inactiv
inactive

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39


Inhibitori de DPP-4

• Sitagliptina (Januvia)
- inhibitor competitiv, reversibil şi înalt selectiv al DPP-4
- aprobată de FDA (2006) şi de ANM (2007) pt. trat. DZ 2

• Saxagliptina (Onglyza)
- 1 cp = 5 mg; doza = 1 cp/zi

• Vildagliptina (Galvus)
- se leagă de DPP-4 → complex inactiv
- 1 cp = 50 mg; doza = 1 cp x 2 /zi
Sitagliptina (Januvia)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice

• Doza recomandată: 100 mg/zi (doză unică), indiferent de


orarul meselor
Efecte non-glicemice ale incretinelor

• Analogii de GLP-1
- scădere în greutate progresivă şi dependentă de doză
- uşoară reducere a LDL-colesterolului
- ameliorare a funcţiei ventriculare la pacienţii post-IM

• Inhibitorii de DPP-4
- efecte neutre asupra greutăţii
- uşoară reducere a TG şi o creştere a HDL-colesterolului
Efecte adverse ale incretinelor

• Analogii de GLP-1
- greţuri şi vărsături (50% dintre pacienţi)
- dependente de doză
- se ameliorează pe parcursul tratamentului
- diaree
- hipoglicemii uşoare şi moderate (când se asociază cu SU)

• Inhibitorii de DPP-4
- cefalee
- susceptibilitate ↑ pentru infecţii de căi aeriene superioare
Inhibitorii SGLT-2
Filtrarea glomerulară

Arteriola aferentă

H2O
Glucoza

Na+, Cl-, K+, HCO3-

Amino
acizi
Creatinina
Uree

Capsula Bowman

Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Arteriola aferentă Glucoza


Na+ Cl-,
K+,
H2O Amino
HCO3-
acizi

Tub contort proximal


Capsula Bowman
Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Majoritatea glucozei
este reabsorbită de
către SGLT2 (90%)

Tub contort proximal

Glucoza
Excreție a
Glucoză restantă este
glucozei
reabsorbită de
minimă până
către SGLT1
Filtrarea glucozei la absentă
(10%)
Inhibitorii SGLT2: O abordare inovativă, insulin-independentă,
de eliminare a excesului de glucoză
Reabsorbție
Reduced glucose SGLT2
scăzută a glucozei
reabsorption
Inhibitor SGLT2

Proximal
Tub tubule
contort
proximal

Inhibitor Excreție urinară


Increased urinary
SGLT2 crescută a glucozei
excretion of excess
SGLT2 în (∼ 70g/day,
exces (~70
glucose g/zi,
Glucose
Filtrarea corespunzător
corresponding280to
glucozei kcal/zi*)
280 kcal/day*)

Inhibitorii SGLT2 inhibă în mod selectiv SGLT2


la nivelul tubului contort proximal

≈ 70g/zi
glucoza
Inhibitorii SGLT2: O abordare inovativă, insulin-
independentă, de eliminare a excesului de glucoză

Scăderi semnificative ale HbA1c

ELIMINARE Pierderea a ≈280 kcal/zi Scădere ponderală


≈ 70g/zi
glucoza

Creşterea volumului
urinar cu ≈ 375ml/zi Scăderea tensiunii arteriale
Inhibitori de SGLT2

• Beneficii
- scăderea HbA1c
- scădere ponderală
- scăderea TA
reducerea riscului de evenimente CV (inclusiv reducerea
numărului spitalizărilor pentru ICC)
• Efecte adverse
- risc crescut pentru infecții urinare și genitale?
- risc de deshidratare și hipovolemie?
- risc de cetoacidoză euglicemică
- risc de amputații periferice (canagliflozina)
- risc de gangrenă Fournier?
Inhibitori de SGLT2

• Empagliflozina (Jardiance)
- 1 cp = 10 sau 25 mg; doza = 1 cp/zi

• Dapagliflozina (Forxiga)
- 1 cp = 10 mg; doza = 1 cp/zi

• Canagliflozina
- 1 cp = 100 sau 300 mg; doza = 1 cp/zi
Preparate combinate
• Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg
Glucovance 2,5 mg/500 mg, 5 mg/500 mg
• Preparate combinate pioglitazonă + metformin
Competact 15 mg/850 mg
• Preparate combinate inhibitori DPP-4 + metformin
Janumet (sitagliptină + metformin) 50 mg/1000 mg
Komboglyze (saxagliptină + metformin) 2,5 mg/1000 mg
• Preparate combinate saxagliptină + dapagliflozină
Qtern 5 mg/10 mg
• Preparate injectabile în combinație fixă titrabilă
Suliqua (insulină glargine + lixisenatidă)
Algoritmul de tratament în DZ tip 2

Se pot utiliza:
• Dietă şi exerciţiu fizic

• Monoterapie cu antihiperglicemiante orale

• Asocieri de antihiperglicemiante orale

• Asocieri de antihiperglicemiante orale și preparate non-


insulinice injectabile

• Asocieri de insulină ± antihiperglicemiante orale ± preparate


non-insulinice injectabile
Individualizarea terapiei în DZ tip 2

Tinte mai ambitioase Tinte mai putin ambitioase


Atitudine pacienti
Pacienti motivati Pacienti mai putin motivati

Scazut Crescut
Durata bolii
Scurta Lunga
Speranta de viata
Lunga Scurta
Comorbiditati
Absente
Severe
Complicatii CV
Absente Severe
Resurse
Disponibile Absente

Adaptat dupa: Ismail-Beigi, et al. Ann Intern Med 2011;154:554–9; Inzucchi SE, et al. Diabetes Care 2012;35:1364–79.

Inzucchi SE et al. Diabetes Care 2015;38:140–9


ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018
Complicaţiile DZ

• Acute
- infecţiile
- comele - hiperglicemice - cetoacidozică
- hiperosmolară
- lactacidemică
- hipoglicemică
• Cronice
- microangiopatice
- macroangiopatice
- neuropatice
Infecţiile

• Frecvente la diabeticul dezechilibrat

• Predispoziţia către infecţii explicată prin modificări legate


de hiperglicemie:
- ↓ mobilizării şi chemotactismului leucocitar
- ↓ capacităţii fagocitare a polimorfonuclearelor
- ↓ capacităţii bactericide a polimorfonuclearelor
- ↓ funcţiilor monocitare
• Infecţii puternic asociate diabetului (quasi-specifice),
severe, dar foarte rare:
- mucormicozele
- otita externă malignă
- pielonefrita emfizematoasă
- colecistita emfizematoasă
• Infecţii postterapeutice:
- abcese insulinice, infecţii asociate transplantului renal,
dializei peritoneale, hemodializei
• Infecţii nespecifice asociate DZ:
- infecţii urinare: cistite, pielonefrite, abcese renale/perirenale
- infecţii respiratorii
- infecţii cutanate, mucoase, ale ţesutului celular s.c.
- altele: fasceita necrozantă, gangrena Fournier a organelor
genitale
Hipoglicemiile

• Definiţie – scăderea valorilor glicemiei sub 70 mg/dl în


plasma venoasă (sub 60 mg/dl în sângele venos total)

• Triada Whipple:
- simptome sugestive pentru hipoglicemie după post
prelungit sau exercițiu fizic
- documentarea unei valori glicemice scăzute
- corecția simptomelor după corecția valorilor glicemice

• Cauze - exces de insulină sau de ADO secretagoge


- scăderea aportului glucidic
- efort fizic excesiv
- consumul de alcool
Hipoglicemiile - fiziopatologie

• Mecanismele de apărare împotriva hipoglicemiei


- scăderea secreţiei de insulină
- creşterea secreţiei pancreatice de glucagon
- stimulare simpatică → ↑ secreţiei de catecolamine
- creşterea secreţiei de cortizol şi h. de creştere

• La pacientul diabetic
- scăderea secreției de insulină nu e un mecanism activ
- afectarea secreției de glucagon la DZ 1 cu o perioadă
lungă de evoluție
- diminuarea secreției de catecolamine prin neuropatie
vegetativă
Hipoglicemiile – manifestări clinice

• Semne periferice (de „alarmă adrenergică”)


- tremurături ale extremităților, transpirații, paloare,
tahicardie, palpitații, anxietate, foame, parestezii distale
• Semne centrale (de neuroglicopenie)
- tulburări de atenție, concentrare, memorie, coordonare,
comportament; oboseală, somnolență; tulburări de vorbire;
tulburări de vedere; parestezii peribucale; cefalee; contracturi
musculare localizate/generalizate; comă profundă, agitată
• Atenție:
- idiosincrazia manifestărilor hipoglicemice
- alterarea contrareglării adrenergice prin neuropatie
vegetativă
Hipoglicemiile

• Clasificare
– uşoare: recunoscute și corectate de către pacient, nu
afectează capacitatea de muncă și inserția în mediu
– medii (moderate): afectează capacitatea de muncă și
inserția în mediu
– severe: totalitatea hipoglicemiilor care necesită intervenția
în urgență a unei alte persoane (tratament injectabil); includ,
dar nu se limitează la comele hipoglicemice

• Cazuri particulare
- hipoglicemiile neconştientizate
- hipoglicemiile nocturne
Complicaţiile hipoglicemiilor

• Accident vascular cerebral

• Infarct de miocard

• Tulburări funcţionale cerebrale minore

• Encefalopatia posthipoglicemică

• Hemoragii retiniene masive

• Decerebrare
Tratamentul hipoglicemiilor

• Tratament preventiv – educaţia pacientului diabetic

• Tratament curativ
- hipoglicemiile uşoare şi medii
- glucide rapid + lent absorbabile („regula lui 15”)

- hipoglicemiile severe
- glucoză i.v.: SG 33%, apoi soluții SG 20%, 10%, 5%
(„baia de glucoză a creierului”)
- glucagon: 1-2 mg i.m., i.v. sau s.c.
- glucide rapid + lent absorbabile
Cetoacidoza diabetică - date generale

• Definiţie – triada - hiperglicemie


- cetoză
- acidoză

• F>B
• Vârsta medie 43 ani
• 20 % episoade multiple
• 20 % apar la diabetici nou diagnosticaţi
Triada cetoacidozei diabetice

Acidoză
metabolică
Hiperglicemie
• acidoza lactică
• diabet zaharat
• acidoza uremică
• coma hiperosmolară
• acidoza hipercloremică
• STG
• acidoza drog-indusă
• hiperglicemia de stress
Cetoacidoza
diabetică

Cetoză
• cetoza alcoolică
• cetoza de foame
Fiziopatologia cetoacidozei diabetice
Insuficienţă absolută sau relativă
Lipoliză de insulină

Hiperproducţie de Proteoliză
corpi cetonici Accelerarea glicogenolizei şi
neoglucogenezei
Eliberarea de alanină
şi alţi aminoacizi
Acidoză metabolică
Hiperglicemie şi
glicozurie
Pierdere de apă, K+ PO-4, Creşterea ureei
baze tampon
Poliurie osmotică Hiperosmolaritate

Deshidratare Sete

Colaps Aritmie Polidipsie

COMĂ
Cauzele cetoacidozei diabetice

• Insulinodeficienţa absolută
- întreruperea insulinoterapiei
- cetoacidoză inaugurală (20%)

• Insulinodeficienţa relativă
- afecţiuni intercurente
- endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia
- iatrogen (corticoizi, simpatomimetice)
- sarcină
- stress
Tablou clinic

• Debut insidios

• Perioadă prodromală

• Factor precipitant
Tablou clinic

• Starea de conştienţă – de obicei păstrată


• Semne de deshidratare cutaneo-mucoasă
• Semne cardiovasculare – tahicardie; TA e de obicei normală
• Semne respiratorii – halenă acetonemică, dispnee Küssmaul
• Semne digestive – grețuri, vărsături, dureri abdominale
• Semne neuromusculare – hipotonie moderată, diminuarea ROT
• Temp. cutanată ↓
• Facies – vultuos
Diagnostic paraclinic
• Hiperglicemie: 350 – 1200 mg%

• Hipercetonurie: > 30 mEq/l

• Tulburări hidroelectrolitice
Deficite hidroelectrolitice medii:
- apa 5-10 l
- baze tampon 800-1000 mEq
-K 300-600 mEq
- Na 400-600 mEq
- Mg 50-75 mEq
- Ca 1000-1500 mEq
-P 75-150 mEq
Diagnostic paraclinic

• Tulburări acido-bazice: RA, pH


• Uree
• Lipide, TG
• GA
• Acid lactic ↑
• Acid piruvic ↑
• ECG
• Rx toracică
• Hemoculturi, uroculturi
Stadii evolutive
ASTRUP pH (n = 7,35-7,45)
BE (n = ± 2 mEq/l
RA (n = 24-27 mEq/l)

CAD pH BE RA
Cetoza incipientă normal -2 → -5 21 – 24 mEq/l
mEq/l
Cetoacidoza 7,31-7,35 -5 → -10 16 –20 mEq/l
moderată mEq/l
Cetoacidoza 7,30-7,21 -10→ -15 11-15 mEq/l
avansată mEq/l
Cetoacidoza severă ≤ 7,20 Peste –15 ≤10 mEq/l
(coma diabetică) mEq/l
Tratament

• Combaterea tulburărilor hidroelectrolitice


• Combaterea tulburărilor metabolice (hiperglicemia)
• Combaterea tulburărilor acido-bazice
• Combaterea tulburărilor hemodinamice
• Combaterea factorului infecţios
• Măsuri nespecifice
- oxigenoterapie
- sondaj vezical
- sondă de aspiraţie gastrică
- heparină 5000 u/8h
- tratament etiologic
Combaterea tulburărilor hidroelectrolitice
• SF: 0–1 h: 1000-1500 ml
1–4 h: 1000 ml/h

• SG 5%, 10% când glicemia scade sub 250-300mg%;


tamponare cu insulină rapidă 1:2 sau 1:3

• KCl 10%
- diureză prezentă
- 1g KCl= 13,5 mEq K= 10 ml sol KCl 10%
- K > 5 mEq/l: nu se administrează
- K 4-5 mEq/l: 20 mEq/h
- K 3-4 mEq/l: 30-40 mEq/h
- K < 3 mEq/l: 40-60 mEq/h
Combaterea tulburărilor metabolice

• Insulină rapidă – i.v. 5-10 ui/oră (0,1 ui/kgcorp/oră)

• Ideal glicemia ↓ cu 70-100 mg/dl/oră (10% din valoarea inițială)

• Riscurile scăderii glicemice bruște (fără rehidratare corectă):


- prăbușirea TA
- hipopotasemie
- edem cerebral (teoria „osmolilor idiogeni” ai neuronului)
- hipoglicemie
Combaterea tulburărilor acido-bazice

• pH < 7,1
• Bicarbonat de Na 14 g ‰
• THAM
• Alcalinizare lentă
-pH < 6,9: 84 mEq/l (500 ml NaHCO3 14 ‰)
-pH 6,9-7: 42 mEq/l (250 ml NaHCO3 14 ‰)
-pH > 7-7,1: se întrerupe administrarea
• Riscurile alcalinizării rapide
Combaterea tulburărilor acido-bazice

• Riscurile alcalinizării rapide:


- corectarea acidozei → introducerea K+ în celulă →
hipopotasemie → risc aritmogen
- viteze de difuziune diferite ale CO2 și H2CO3 prin BHE
→ acidoză paradoxală a LCR → edem cerebral
- deplasarea la stânga a curbei de disociere a oxiHb →
favorizarea glicolizei anaerobe → apariția acidozei lactice
- apariția alcalozei metabolice
Combaterea tulburărilor hemodinamice

• HHC 100-200 mg

• Sol. macromoleculare – Dextran

• Plasmă
Combaterea factorului infecţios

• Ab cu spectru larg

Ulterior

Alimentaţie orală
Adm. s.c. a insulinei
Săruri de K, Mg, vitamine grup B 1-2 săptămâni
Mortalitatea în CAD severă

• < 0,5% în comele “simple”

• 5 – 15% în comele “complicate”

• 45% când este abolită starea de conştienţă


Starea (coma) hiperglicemică hiperosmolară

• Definiţie
Absenţa cetoacidozei la un diabetic care are o
osmolaritate plasmatică hiperglicemică sau mixtă
(hiperglicemică şi hipernatremică) > 350 mOsm/l

• Osmolaritatea = (Na+ + K +) x 2 + glicemia/18 + ureea/6


(mosm/l)

• Frecvenţă
- 10% din complicațiile acute hiperglicemice ale DZ
Criterii de diagnostic

• Osmolaritate plasmatică > 350 mOsm/l


• Glicemie > 600 mg/dl
• pH > 7,25
• HCO3 > 15 mEq/l
• Semne de deshidratare masivă
Fiziopatologie
Tablou clinic

• Teren
• Factor predispozant
- ASC → alterare sistem osmoreglare
• Debut
• Etapa premonitorie
• Factor declanşant
- deshidratare hipertonă - pierderi cutanate şi pulmonare
- pierderi digestive
- pierderi renale
- hiperglicemie marcată
• Etapa de comă hiperosmolară manifestă

- deshidratare intensă
- starea de conştienţă
- semne neurologice
- semne cardiovasculare
- semne renale: poliurie → oligurie + hematurie + albuminurie
- temperatură ↑
Tablou biologic

• Hiperosmolaritatea
- Osm (mOsm/l) = (Na+ + 10) x 2 + glicemia /18 + ureea /6
- osmoli idiogeni
• Hiperglicemia
- secreţie inadecvată de insulină
- rezistenţă la insulină
• Echilibrul acidobazic
- gaura anionică < 12 mEq/l
- (Na+ + K+) – (Cl- + HCO3- + 16)
• Metabolismul azotat
• Metabolismul hidroelectrolitic
Metabolismul apei
- deshidratare globală cu hipertonie
- deshidratare predominent intracelulară
- rar colaps

Metabolismul sodiului
- Na ↑
- natriuria ↓ ( < 20 mEq/24h )

Metabolismul potasiului
- deficit: ∼ 400 - 1000 mEq
- prin - poliurie osmotică
- hiperaldosteronism
Alte investigaţii

• Rx toracică
• Ecografie abdominală
• CT
• RMN
• ECG
Diagnostic pozitiv

• Hiperosmolaritatea plasmatică
• Hiperglicemie
• Semnele unei deshidratări profunde
• Semne neurologice
• Absenţa respiraţiei Kussmaul
• Absenţa mirosului acetonemic al respiraţiei
• Absenţa CC urinari
Diagnostic diferenţial

• Coma diabetică cetoacidozică


Lipsesc: - respiraţia Kussmaul
- mirosul de acetonă al expirului
- CC urinari

• Coma lactacidemică

• Comele cerebrale primitive


Complicaţii

• Complicaţii legate de deshidratare


- tromboze venoase
arteriale
- CID
- hTA severă → colaps
- necroză tubulară → IRA
• Complicaţii legate de tulburările electrolitice
- hipopotasemia
- hipernatremia
• Complicaţii nervoase
- hemoragii cerebrale
- edemul cerebral
Tratament

• Reechilibrare hidroelectrolitică
- soluţii utilizate
- cantitate
- ritm de administrare - monitorizare debit urinar
- PVC
• Dacă TA ↓: SF, HHC, sol. macromoleculare, sânge, plasmă
• Insulinoterapia
• Soluţii de potasiu
• Heparina
• Antibiotice
• Tratamentul factorilor precipitanţi
• Dializa extrarenală
Acidoza lactică
Cauze
• Administrarea de metformin (atunci când nu sunt respectate
contraindicaţiile); pentru a dovedi implicarea metforminului se
va doza metforminemia
• În afară de administrarea de metformin:
– Situaţii în care oxigenarea tisulară este insuficientă (stări
de şoc, anemie severă, intoxicaţie cu oxid de carbon, tumori
maligne)
– Cauze hepatice (insuficienţa hepatică severă în cursul unei
hepatite acute, ciroză în stadiul terminal, ficat de şoc)
Acidoza lactică la pacienţii cu DZ

Tablou clinic

• Semne premonitorii: astenie marcată, crampe musculare,


dureri difuze
• Alterarea stării de conştienţă (obnubilare → comă
profundă), agitaţie, polipnee
• Semnele de deshidratare lipsesc sau sunt minore
• Respiraţie acidotică (Kussmaul)
• Miros de acetonă absent
Tablou biochimic

• pH < 7,25
• Deficit anionic > 15 mEq/l
• Acid lactic > 7 mEq/l (normal: 0,7-1,2 mEq/l)
• Acid piruvic < 0,5 mEq/l
• K şi Na normale sau crescute
• Glicemia ↑ moderat (de obicei < 400 mg/dl)
Tratamentul acidozei lactice

• Îndepărtarea cauzei declanşante


• Corectarea acidozei: soluţii alcaline izotone, bicarbonat de
sodiu, THAM
• Oxigenoterapia
• Combaterea colapsului: soluţii macromoleculare, HHC
• Dicloroacetatul (↑ utilizarea lactatului şi oxidarea piruvatului)
• Hemodializa sau dializa peritoneală
• Mortalitate > 50 %
Complicaţiile cronice ale DZ

• Microangiopatice
• Macroangiopatice
• Neuropatice
• Gangrena diabetică
• Alte complicaţii - hepatopatia dismetabolică
- cardiomiopatia diabetică
- parodontopatia
- complicaţii osteo-tendino-articulare
- osteoartropatia diabetică (piciorul Charcot)
- afectarea cutanată
Mecanisme de apariţie a complicaţiilor cronice

• Hiperglicemia cronică
- glicozilarea proteinelor - neenzimatică
- enzimatică
- activarea căii poliol
- activarea sistemului protein-kinazei C
• Stress-ul oxidativ
• Modificări hemoreologice şi hemostatice
• Modificări lipidice
• Factorul genetic
Glicozilarea neenzimatică a proteinelor
• Proporţională cu - conc. glucozei din sg.
- durata menţinerii ei
• Glicozilarea proteinelor - structurale (vase, nervi, ficat, piele)
- plasmatice
• Glicozilarea lipoproteinelor - ↓ catabolismul LDL
- ↑ catabolismul HDL
• Proteinele glicate – mai susceptibile la stress-ul oxidativ
• ↓ sinteza proteoglicanilor purtători de sarcini electrice →
efecte negative asupra fen. de atracţie/respingere
intermoleculară
Hemoglobina glicată

• Evaluează controlul pe termen lung al diabetului (4-6 săpt.)


• ”memorie diabetică de lungă durată”
• Subfracţiuni: A1a, A1b, A1c
• Valori normale: Hb A1 = 8%
HbA1c = 4-6%
• Determinarea Hb A1c - cromatografic
- colorimetric
- radioimunologic
Corelaţii între valorile Hb A1c şi glicemie

A1c (%) Media glicemiilor

6 135 mg/dl (7,5 mmol/l)


7 170 mg/dl (9,5 mmol/l)
8 205 mg/dl (11,5 mmol/l)
9 240 mg/dl (13,5 mmol/l)
10 275 mg/dl (15,5 mmol/l)
11 310 mg/dl (17,5 mmol/l)
12 345 mg/dl ( 19,5 mmol/l)
Glicozilarea enzimatică a proteinelor

• Glicozilarea proteoglicanilor (vase, nervi, MBG)


• Glicozilarea colagenului
- piele: îngroşare, tulburări trofice cutanate
- gingii: parodontopatie
- muşchi şi tendoane: cheiro-artropatie
↓ mobilităţii articulare
- inimă: cardiomiopatie
- nervi
- cristalin
- ficat
Calea poliol

Glucoza extracelulară

↑ glucoza intracelulară

aldoz-reductază

sorbitol ↑ osmolaritatea intracelulară

dehidrogenază ↓ mioinozitolul intracelular

fructoză ↓ potenţialul redox intracelular


Clasificarea neuropatiei diabetice

• Neuropatia subclinică

• Neuropatia clinică

• Periferică
• Vegetativă (autonomă)
Neuropatia subclinică

• Teste de electrodiagnostic anormale


- viteză de conducere nervoasă scăzută
- amplitudine scăzută a potenţialului de acţiune evocat
• Testare cantitativă senzorială anormală
- vibratorie, tactilă, termică
• Teste ale funcţiei autonome anormale
- aritmie sinusală scăzută (rata variaţiei frecvenţei cardiace)
- funcţie sudomotorie scăzută
- latenţă pupilară crescută
Neuropatia periferică

• Polineuropatia distală simetrică


• Neuropatia diabetică acută
• Neuropatia diabetică hiposenzitivă
• Neuropatia motorie proximală a membrelor inferioare
• Mononeuropatiile
• Neuropatiile truncale
Polineuropatia distală simetrică

• Cea mai frecventă


• Tulburări de sensibilitate (hiperestezie sau hiposensibilitate)
• Membrele inferioare
• Evoluţie centripetă
• Disestezie
• “Anestezie dureroasă”
• Agravare nocturnă
• Semne de disfuncţie vegetativă
• Piele uscată / aspect pseudo-inflamator
• Sensibilitatea vibratorie / proprioceptivă
• Atrofie şi hipotonie musculară
Neuropatia diabetică acută

• Rară, dar caracteristică DZ


• Instalare acută
• Dureri intense în membrele inferioare
• “Caşexie neuropată”
• Insomnie
• Depresie
• Impotenţă
Neuropatia diabetică hiposenzitivă

• Lipsesc acuzele subiective


• Scădere / dispariţie a sensibilităţii dureroasă, termică,
vibratorie
• Alterare variabilă a funcţiilor vegetative
• VCN ↓
• Risc ↑ de leziuni cutanate
• Evaluare cantitativă: determinarea pragului de electropercepţie
Neuropatia motorie proximală a membrelor
inferioare

• Rară

• Amiotrofii

• “Poliradiculopatia diabetică”

• Instalare acută / subacută

• “Topirea muşchilor”
Mononeuropatiile

• Cel mai frecvent:

nervii cranieni

• Cubital

• Sciatic popliteu extern


Neuropatiile truncale

• Rare

• Instalare acută sau progresivă

• Durere abdominală sau truncală unilaterală

• T3 - T12
Tratamentul neuropatiei periferice

• Echilibrare metabolică riguroasă


• AINS, analgezice opioide cu acţiune centrală
• Tranchilizante minore
• Carbamazepina, Gabapentin, Pregabalin, Duloxetin
• Antidepresive triciclice
• TENS, electroacupunctura
• Capsaicina
• Vitaminoterapia, benfotiamina, acidul alfa-lipoic
• Ionizări ale membrelor inferioare cu Xilină 1% şi vit. B1
• Balneofizioterapia (mofete, băi carbogazoase, ionizări)
Neuropatia vegetativă

• Neuropatia cardio-vasculară
• Neuropatia digestivă
• Neuropatia vezicală
• Tulburările sexuale
• Neuropatia pupilară
• Tulburările cutanate
• Hipoglicemiile neconştientizate
Neuropatia cardio-vasculară
Manifestările cardiovasculare ale neuropatiei

Cardiace Vasculare
Tahicardie cu ritm stabil Hipotensiune ortostatică
Infarct miocardic nedureros Tulburări circulatorii cerebrale

↑ intervalului QTc (>400 ms) Tulburări circulatorii ale


extremităţilor
Tulburări de ritm Edeme ale membrelor
inferioare
Moarte subită Fenomenul non-dipping
Accidente anestezice
Tratamentul hipotensiunii ortostatice

• Stoparea medicaţiei care exacerbează hipotensiunea


• Trecere treptată din clino în ortostatism
• Ciorapi elastici
• Creşterea moderată a aportului de sare
• Simpatomimetice (etilefrin - Effortil)
• Mineralocorticoizi (9-α-fluorohidrocortizon – 400 μg/zi)
• Antiinflamatorii nesteroidiene
• Derivaţii de ergotamină (DH-ergotoxină – 7 pic. de 3 X / zi)
• Agonişti ai receptorilor α1 - Midodrin – 2,5-10 mg/zi
• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o
Neuropatia digestivă

• Disfuncţia esofagiană (tulburări de motilitate)

• Disfuncţia gastrică: control glicemic dificil, plenitudine post-


prandială, sațietate precoce, anorexie, intoleranță digestivă
totală în formele severe (gastropareza diabetică)

• Disfuncţia intestinală: constipație neuropată, diaree neuropată


(accentuată nocturn, episoade de remisie/agravare, scaune
apoase, fără fenomene de malabsorbție), rar incontinență fecală

• Disfuncţia veziculei biliare (hipomotilitate, litiază biliară)


Tratamentul neuropatiei autonome digestive

• Gastropareza: control glicemic riguros (inclusiv pe termen


scurt), prokinetice

• Diareea neuropată: loperamid, eritromicină, clonidină

• Constipația neuropată: aport ↑ de fibre, prokinetice, lactuloză

• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

Atenție: este necesară investigarea altor etiologii ale


manifestărilor digestive (diagnostic de excludere)
Neuropatia vezicală
• Hipotonie ureterală
• Pareza vezicală
• “vezica neurogenă”

Tulburările sexuale
B – impotenţă - tulburări de erecţie
- ejaculare retrogradă
F – tulburări menstruale
Neuropatia pupilară
• Asimptomatică
• Măsurarea reflexului pupilar la lumină

Tulburările cutanate
• Anhidroză distală
• Hipersudoraţie compensatorie în ½ superioară a corpului

Hipoglicemiile neconştientizate
• Absenţa semnelor de “avertizare” a hipoglicemiilor
Gangrena diabetică
Fiziopatologie

• Factorul neuropat
- afectarea sensibilităţii nociceptoare
- afectarea nervoasă simpatică → tulb. fcţ. vasculare →
→ hipoxia tisulară
↓ troficităţii ţesuturilor

• Factorul vascular - microangiopatia diabetică


- macroangiopatia diabetică

• Factorul infecţios
Forme clinice

• Gangrena arteriopată
• Gangrena neuropată
• Gangrena mixtă

• Gangrena umedă
• Gangrena uscată
Tratamentul gangrenei diabetice

• Profilactic – educaţia pacientului


• Echilibrarea corespunzătoare a diabetului
• Pentoxifilin
• Sulodexid
• Dispozitive ortopedice
• Radioterapie antiinflamatorie
• Tratament chirurgical
- debridări, excizii
- amputaţii
- chirurgie vasculară
- repermeabilizare vasculară
- by-pass cu grefă venoasă autologă
Macroangiopatia diabetică

Ateroscleroza – date generale

• Arterioscleroza
• Ateroscleroza
• Athero (terci) + sclerosis (induraţie)
• Istoric
• Localizare
Fiziopatologia aterosclerozei

• Ipoteza “răspunsului la injurie” (R. Ross)


Leziunile aterosclerotice

• Striurile lipidice

• Placa de aterom fibroasă

• Placa de aterom complicată


Diagnosticul clinic al aterosclerozei

• Faza preclinică, asimptomatică


- diagnostic de suspiciune
- modificări metabolice (hipercolesterolemia)
- factori de risc (fumat, HTA, DZ etc.)

• Faza clinică
- obstrucţie > 60-70% din lumenul arterial
- ischemie în diverse teritorii - coronarian
- cerebral
- membrele inferioare
- renal
- mezenteric
- particularităţile ATS la diabetici
Particularitățile aterosclerozei la pacientul diabetic

• Apariție precoce
• Evoluție mai rapidă, inclusiv spre stadii avansate
• Risc egal de apariție la cele două sexe
• Frecvent multicentrică
• Frecvent cu localizare mai distală
• Simptomatologia dureroasă: uneori atipică sau absentă
• Complicații clinice mai frecvente
• Complicațiile și prognosticul post-IMA, AVC, AOMI etc.: mai
frecvente, extensie mai mare, risc crescut de morbiditate și
mortalitate
Diagnosticul paraclinic al aterosclerozei

• Ecg
• Ecg de efort
• Scintigrafia cu taliu
• Ecocardiografia
• Angiografia
• Ecografia intravasculară
Principalele forme clinice de macroangiopatie
diabetică

• Macroangiopatia coronariană

• Boala arterelor cerebrale

• Arteriopatia membrelor inferioare


Nefropatia diabetică
Etiopatogenia nefropatiei diabetice

I. Predispoziţia genetică

II. Factori hemodinamici

III. Factori metabolici


I. Predispoziţia genetică

Argumente:

- > 20-25 ani de diabet  doar 1/3 dezvoltă ND

- nu corelează întotdeauna cu controlul metabolic

- agregare familială
II. Tulburări hemodinamice în patogeneza ND

1. Creşterea presiunii intraglomerulare


2. Hipertensiunea arterială sistemică

1. Creşterea presiunii intraglomerulare

• ↑ FPR
• modificarea tonusului arteriolelor glomerulare
2. Hipertensiunea arterială sistemică

• ↑ TA  ↑ rezist. arteriolei aferente

• La diabetici, autoreglarea este afectată


III. Factorii metabolici în patogeneza ND

1. Hiperglicemia

2. Stressul oxidativ

3. SRA

4. Citokinele

5. Mesagerii intracelulari
Istoria naturală a ND

• În DZ 1: - evoluţia ND: bine definită


- Mogensen: 5 stadii

• În DZ 2: - evoluţia ND: mai puţin bine caracterizată


• Momentul debutului ?
• Alţi factori (HTA, vârsta etc.)
• Mortalitate cardiovasculară crescută
Stadializarea ND

 DZ 1: Mogensen, 1983 – clasificare în 5 stadii


(revizuită în 1999 şi în 2000)
Stadiul I – hiperfuncţie şi hipertrofie renală

• Apare de la diagnosticarea DZ
• Reversibil cu un bun control glicemic
• ↑ cu 20-50 % a RFG (>150 ml/min/1,73 m2)
• Microalbuminurie tranzitorie în dezechilibru glicemic, efort
fizic excesiv, dietă hiperproteică
• Modificări structurale: ↑ dimensiunilor rinichilor şi a
glomerulilor
• TA normală
Stadiul II – silenţios, normoalbuminuric

• Apare în primii 5 ani de la diagnosticarea DZ


• 30-50 % trec în stadiul III după 5-7 ani de la debutul
bolii
• PBR: îngroşarea MB glomerulare
expansiune mezangială
• RFG se menţine crescută (cu 20-50 %)
• REUA normală
• TA normală
Stadiul III – Nefropatia diabetică incipientă

• Apare după 6-15 ani de la debutul DZ


• Progresie oprită sau încetinită prin controlul glicemiei şi al
TA
• Microalbuminurie persistentă (30-300 mg/24 ore) –
predicţie pentru apariţia proteinuriei
• RFG este ↑, dar ↓ cu 3-5 ml/min/an
• TA normală sau uşor ↑ (↑ cu 3 mm Hg/an)
Stadiul IV – nefropatia diabetică patentă sau
clinic manifestă

• Apare după 15-25 ani de la debutul DZ


• Proteinurie clinică (albuminurie > 300 mg/24 ore)
• FG ↓ progresiv (cu 8-12 ml/min/an)
• 3 substadii: - precoce (FG > 130 ml/min)
- intermediar (FG < 100 ml/min)
- avansat (FG < 70 ml/min)
• HTA (↑ cu 5 mm Hg/an)
Stadiul V – insuficienţa renală cronică
terminală

• Apare după 25-30 ani de evoluţie a DZ


• Proteinuria variabilă
• Eliminarea de uree urinară < 10 g/24 ore
• FG < 10 ml/min
• TA constant ↑
• Morfopatologic: ocluzii ale glomerulilor şi leziuni
importante ale acestora
Evoluţia în timp a filtratului glomerular şi a
eliminării urinare de albumină
Clasificarea şi prognosticul bolii cronice de
rinichi

Categorii de risc: Verde = scăzut; Galben =moderat crescut;


Portocaliu = crescut; Roşu = foarte crescut
Diagnostic clinic

• Semne de HTA
• Semne de sindrom nefrotic, IRC
• Prezenţa altor complicaţii ale diabetului: retinopatie,
macroangiopatie, neuropatie
• ↑ numărului de hipoglicemii nejustificate şi ↓
necesarului de insulină
Caracteristicile clinice ale diabeticilor
hipertensivi

• ↑ presiunii pulsului arterial

• Hipotensiunea ortostatică

• Hipertensiunea nocturnă
Diagnostic paraclinic

• Rata filtrării glomerulare


• Eliminarea urinară de proteine
• Sumarul de urină
• Urocultura
• Ureea, creatinina şi acidul uric
• Hemoleucograma
• Proteinograma
• Determinarea lipidelor serice
• Hiperpotasemia şi acidoza metabolică
• Ecografia abdominală - ↑ dimensiunilor rinichilor
- rinichi inegali, cu contur boselat
• Biopsia renală
Eliminarea urinară de proteine

Rata de excreţie Raport


Categoria
a albuminei albumină:creatinină
(-albuminurie)
mg/24 ore mg/mmol mg/g

A1 (normo-) < 30 <3 < 30

A2 (micro-) 30 - 300 3 - 30 30 - 300

A3 (macro-) > 300 > 30 > 300


Screening-ul pentru microalbuminurie

• Se recomandă a se face anual, începând de la:


- pubertate sau după 5 ani de la debutul DZ 1
- diagnosticarea DZ 2

• Min. 3 determinări în decurs de 3-6 luni


- microalbuminurie persistentă – 2 din 3 determinări
între 30-300 mg/24 ore
Argumente pentru boala renală non-diabetică

• Debutul proteinuriei < 10 ani sau > 20 ani de la dg. DZ 1


• Debutul acut al afectării renale
• RFG n. sau ↓ în momentul apariţiei microalbuminuriei
• Cantitate mare de albumină în urină de la debut
• Cantitate mare de globuline în urină
• În DZ 1: absenţa retinopatiei diabetice
• Sediment urinar activ, cu hematii şi cilindri celulari
• Evidenţe clinice sau biochimice ale unei afecţiuni sistemice
Metode terapeutice

• Menţinerea unui control glicemic optim pe termen lung


• Tratamentul precoce al hipertensiunii arteriale
• Tratamentul dietetic
• Reducerea lipidelor serice
• Prevenirea şi tratamentul comorbidităţilor existente
• Tratamentul anemiei renale
• Profilaxia şi tratamentul bolii osoase renale
Tratamentul nefarmacologic al HTA la pacienţii
cu ND

• Activitatea fizică
• Scăderea ponderală
• Dieta hiposodată
• Dieta hipoproteică
• Alcoolul
• Cafeaua
• Renunţarea la fumat
Tratamentul medicamentos al HTA la
pacienţii cu ND

• Inhibitorii ECA
• Blocantele de receptor de AT II
• Diureticele
• Blocantele canalelor de calciu
• Betablocantele
• Blocantele α-adrenergice
Tratamentul tulburărilor metabolismului
lipidic din ND

• Metode de tratament - dieta


- activitate fizică
- tratament medicamentos
Alte tratamente

• Tratamentul anemiei renale


• Profilaxia şi tratamentul bolii osoase renale
• Noi direcţii terapeutice
- Inhibitorii glicozilării
- Inhibitorii sistemului protein-kinazei C
- Analogii de somatostatină cu acţiune prelungită
- Antagoniştii receptorilor pentru STH
- Blocarea receptorilor dopaminergici
• Hemodializa
• Dializa peritoneală
• Transplantul renal
Retinopatia diabetică – date generale

• RD – unul din primele semne de afectare vasculară

• Prima cauză de cecitate – 20-74 ani

• Prevalenţa – corelată cu durata de evoluţie a DZ

• > 20 ani de DZ – toţi pac.cu DZ1


> 60% pac. cu DZ2
Fiziopatologia RD

• Factori genetici
- HLA - DR3, DR4 - frecvent
- B5 – rar
• Factori metabolici
- hiperglicemia - glicarea proteinelor
- calea poliol
- stressul oxidativ

• 3 etape: - ocluzia capilară


- dilataţii vasculare cu extravazare (“leakage”)
- formarea neovaselor
• Modificarea MB
- îngroşare
- alterarea compoziţiei

- extravazare - plasmă → edem
- hematii → hemoragii
- lipoproteine → exsudate dure

• ↓ Pericitelor
- proliferarea cel. endoteliale
- ↓ tonicităţii peretelui capilar → ectazii capilare →
→ microanevrisme
Proliferarea cel. endoteliale + microanevrismele

Încetinire curent sanguin

↑ adezivitatea plachetară

Ocluzie capilară

Hipoxie retiniană
↓ ↓
Stimularea angiogenezei Alterarea transmiterii sinaptice
↓ ↓
Vase de neoformaţie Acumulare de - AA excitatori
- radicali liberi

Perturbarea Ca şi Na (exotoxicitate)
• Factori de creştere vasculară
 FGF
 GH
 IGF-1
 HGF
 VEGF
 TNF
 EGF
 PDGF

• Neovascularizaţia - papilară
- retiniană
- la nivelul irisului (rubeoza iriană)
Leziunile din RD
• Dilataţia capilarelor
• Microanevrismele
• Hemoragiile intraretiniene
• Exsudatele dure
• Exsudatele moi
• Anomalii intravasculare intraretiniene
• Anomalii venoase
• Neovascularizaţia retiniană
• Hemoragiile preretiniene, hemoragiile vitreene
• Dezlipirea de retină
• Rubeoza iriană, Glaucomul neovascular
• Maculopatia diabetică
Clasificarea RD

• RD neproliferativă
- uşoară

- severă

• RD proliferativă
Edemul macular
• Focal
• Difuz
• Clinic semnificativ

Boala oculară diabetică avansată

• Glaucomul neovascular
• Dezlipirea de retină tracţională
• Hemoftalmusul persistent
Diagnosticul RD
• Examenul FO
- oftalmoscopia directă
- biomicroscopia FO
- oftalmoscopia indirectă
- stereofotografii retiniene
• Angiografia cu fluoresceină
• Angiografia iriană
• Fluorometria vitreană
• Tomografia în coerenţă optică
• Ecografia oculară
• Electroretinograma
• Teste de discriminare cromatică
• Adaptometria
Screeningul RD

Vârsta la care s-a Momentul primului Controale ulterioare


diagnosticat DZ control (în absenţa RD)
0 - 10 ani La pubertate Anual

10 - 30 ani La 5 ani de la Anual


debutul DZ
> 31 ani În momentul Anual
diagnosticării DZ
DZ în sarcină şi DZ Ideal, Trimestrial
gestaţional preconcepţional
Frecvenţa examinărilor în funcţie de stadiul RD

Anomalii retiniene Urmărire la

Normal + rare microanevrisme Anual


RDNP uşoară 9 luni
RDNP moderată 6 luni
RDNP severă 4 luni
EMCS 2-4 luni
RDP 2-3 luni
Tratamentul medicamentos al RD

• Echilibrarea metabolică a DZ
• Evitarea hipoglicemiilor
• Tratamentul HTA
• Medicație antiproliferativă (anti-VEGF): aflibercept,
bevacizumab, ranibizumab
• De valoare redusă:
− Vitamine A, E
− Extractul de ginkgo biloba
− Sorbinil
− Dobesilat de calciu
− Aspirina
− IECA, Sartani, Sandostatin
Tratamentul chirurgical al RD

• Tratamentul laser
- panfotocoagularea laser
- tratamentul laser focal

• Vitrectomia posterioară

• Crioterapia
Alte afectări oculare în diabetul zaharat

• Cataractă
• Glaucom
• Infecţii
• Neuropatii de nervi oculomotori
• ↓ adaptării la întuneric
• ↓ discriminării cromatice
Piciorul diabetic
Etiopatogeneza leziunilor în piciorul diabetic

• Factori predispozanți

• Factori precipitanți

• Factori de perpetuare
Etiopatogeneza leziunilor în piciorul diabetic

• Factori predispozanți
a. Factori care reduc rezistența țesuturilor la agresiune
- macroangiopatia
- microangiopatia
- neuropatia autonomă

b. Factori care cresc probabilitatea agresiunii


- neuropatia motorie
- neuropatia senzitivă
- reducerea mobilității articulare
- alte complicații ale diabetului zaharat
Etiopatogeneza leziunilor în piciorul diabetic

• Factori precipitanți
- leziunile tegumentare
- traumatismele

• Factori de perpetuare
- cicatrizarea întârziată
- infecția
- întârzierea diagnosticului și tratamentului
Piciorul diabetic
Fiziopatologie

• Factorul neuropat
- afectarea sensibilităţii nociceptoare
- tulburări de tonus și troficitate musculară → deplasarea
reliefurilor osoase → remodelarea arhitecturii osoase
- afectarea nervoasă simpatică → tulburări funcţionale
vasculare → hipoxie tisulară (↓ troficităţii ţesuturilor), flux
intraosos crescut (↓ densității osoase)

• Factorul vascular - microangiopatia diabetică


- macroangiopatia diabetică

• Factorul infecţios
Fiziopatologia piciorului diabetic neuropat

Neuropatie
diabetică

Neuropatie Neuropatie Neuropatie


autonomă senzitivă motorie

Modificări ale
Scăderea Osteo- mersului
secreţiei artropatia
sudoripare Charcot Atrofia musculaturii
Pierderea sensibilităţii piciorului
termice şi dureroase
Fiziopatologia piciorului diabetic
Factori de risc pentru ulcerațiile piciorului

• Amputații în antecedente
• Ulcerații ale piciorului în antecedente
• Neuropatia periferică
• Deformări ale piciorului
• Boala arterială periferică
• Tulburări ale acuității vizuale
• Nefropatia diabetică (mai ales în stadiul de dializă)
• Control glicemic precar
• Fumatul
Forme clinice

În funcție de etiologia predominantă:


• Piciorul arteriopat
• Piciorul neuropat
• Piciorul mixt (neuro-ischemic)

Gangrenele diabetice:
• Gangrena umedă
• Gangrena uscată
Piciorul diabetic

Piciorul neuropat Piciorul neuroischemic


Cald
Rece
Puls prezent
Puls absent
Clinic Reţea venoasă vizibilă
Tegumente atrofice
pe faţa dorsală
Paloare în poziţie elevată,
Tegumente normal
colorate eritroză în poziţie declivă

Calozităţi Claudicaţie
Ulceraţii nedureroase, Ulceraţii dureroase
Complicaţii în punctele de presiune Gangrene digitale
Picior Charcot Durere în repaus
Edem neuropat Gangrenă extinsă
Clasificarea Texas University a gravității leziunilor

GRADUL
STADIUL
0 I II III
A Leziuni pre-
Leziuni superficiale Ulcerații care Ulcerații care
Fără sau post-
care nu interesează penetrează penetrează
infecție ulcerative
tendoane, capsule tendoane sau oase sau
sau complet
sau oase capsule articulații
ischemie epitelizate

B Infecție Infecție Infecție


Infecție prezentă
Infecție prezentă prezentă prezentă

C Ischemie Ischemie Ischemie


Ischemie prezentă
Ischemie prezentă prezentă prezentă

D Infecție și Infecție și Infecție și


Infecție și ischemie
Infecție + ischemie
prezente
ischemie ischemie
ischemie prezente prezente prezente
Tratamentul piciorului diabetic

• Profilactic – educaţia pacientului


• Echilibrarea corespunzătoare a diabetului
• Pentoxifilin, sulodexid, alprostadil (PGE1), cilostazol (inhibitor
de fosfodiesterază 3)
• Descărcarea de presiune (inclusiv dispozitive ortopedice)
• Radioterapie antiinflamatorie (limite în utilizare!)
• Tratament chirurgical
- debridări, excizii
- amputaţii
- chirurgie vasculară
- repermeabilizare vasculară
- by-pass cu grefă venoasă autologă
Osteoartropatia diabetică (“piciorul
neuropatic”, piciorul cubic Charcot)

• Deformare a piciorului ca urmare a afectării oaselor şi


articulaţiilor tibio-tarsiene → tulburări de statică osoasă
• Atrofii ale muşchilor interosoşi
• Tulburări trofice cutanate

• 1% din toţi diabeticii


• Cauza - neuropatia diabetică (somatică şi vegetativă)
- tulburări microvasculare care afectează: oase,
muşchi, capsule articulare, ţesut subcutanat, piele
• Debut: insidios sau relativ brusc
• Semne inflamatorii
• Permeabilitatea vaselor mari păstrată
• Absenţa ROT
• Diminuare severă a tuturor tipurilor de sensibilitate
• În timp: prăbuşirea bolţii plantare
crearea de zone de presiune crescută
ulcere trofice
• Examenul radiologic
- osteoporoză, uneori cu aspect geodic
- fracturi patologice nedureroase (cap MT, falange)
- uneori remaniere osoasă anarhică
- periostoză
- osificarea părţilor moi

• Evoluţie:
- dacă se evită apariţia ulcerelor → stabilizare a
procesului patologic
Complicațiile cutanate ale
diabetului zaharat
Complicaţiile cutanate ale diabetului zaharat

• Dermatoze datorate diabetului zaharat şi complicaţiilor sale


- manifestări cutanate ale neuropatiei diabetice
- manifestări cutanate ale angiopatiei diabetice
- infecţiile cutanate

• Dermatoze datorate tratamentului specific diabetului zaharat

• Dermatoze asociate cu diabetul zaharat


Manifestări cutanate ale neuropatiei diabetice

• Tegumentul uscat
• Pierderea părului la nivelul gambelor
• Hiperhidroza
• Durilloamele şi hiperkeratoza plantară
• Hematoamele subungheale
• Venectaziile
• Edemul neuropat
• Ulcerele neuropate
Manifestări cutanate ale angiopatiei diabetice

• Dermopatia diabetică

• Necrobioza lipoidică

• Rubeoza facială

• Ulcerele arteriopate
Infecţiile cutanate

• Tinea pedis
• Onicomicoza
• Onicodistrofia
• Alte infecţii micotice cutanate
• Foliculite
• Furunculoze
• Fasceita necrozantă
Dermatoze datorate tratamentului specific
diabetului zaharat

• Lipodistrofia insulinică
• Alergia la insulină
• Reacţiile la ADO - eritem polimorf
- necroliză epidermică toxică
• Reacţiile lichenoide
• Infecţii cutanate la locurile de injectare (S. aureus)
Dermatoze asociate cu diabetul zaharat

• Buloza diabetică
• Scleredemul
• Acanthosis nigricans
• Xantoamele eruptive
• Vitiligo
• Granulomul inelar
• Carotenodermia
Dislipidemiile
Definirea termenilor

• Dislipidemii

• Hiperlipidemii

• Valorile normale
- colesterol seric total < 190 mg/dl (< 5 mmol/l)
- trigliceride serice < 180 mg/dl (< 2 mmol/l)
- colesterol - HDL > 40 mg/dl (> 1 mmol/l)
- colesterol - LDL < 115 mg/dl (< 3 mmol/l)

• Obiectivele terapeutice
Importanţa dislipidemiilor

• Impactul epidemiologic
- boli populaţionale
- în România: 81% din populaţia între 18 şi 79 ani

• Impactul biologic: risc cardio-vascular


risc de pancreatită acută

• Impactul economic
Lipoproteinele

• Asocieri moleculare dintre diferite componente lipidice


sanguine (TG, colesterol, fosfolipide, AG) şi proteinele
circulante
• Constituite din:
- partea transportată: AG esterificaţi sub formă de TG şi
esteri de colesterol
- transportorul: apoproteine
• Rolul apoproteinelor:
- structural
- funcţional: legarea de receptori
activarea sau inhibarea unor enzime
(LPL, LCAT)
Clase majore lipoproteice

• Chilomicronii – 90% TG

• VLDL – 60% TG, 12% colesterol

• IDL – forme tranzitorii; 30% colesterol, 40% TG

• LDL – 60% colesterol


- fenotip A
- fenotip B
- fenotip intermediar

• HDL
Clasificarea dislipidemiilor (Frederickson)

• Tipul I – chilomicronemie bazală


• Tipul IIa – hiper - LDL
• Tipul IIb – hiper - LDL şi hiper - VLDL
• Tipul III – cu IDL în condiţii bazale
• Tipul IV – hiper VLDL
• Tipul V – chilomicronemie bazală + hiper - VLDL

• Tipul VI – hiper - HDL


Clasificarea dislipidemiilor
(Asociaţia Europeană de ateroscleroză)

Forma de dislipidemie Colesterol Trigliceride


Hipercolesterolemie
- de graniţă 190-249 < 180
- moderată 250-300 < 180
- severă > 300 < 180
Hipertrigliceridemie
- moderată < 190 180-400
- severă < 190 > 400
Hiperlipidemie mixtă
- moderată 190-300 180-400
- severă > 300 > 400
Etiopatogenia dislipidemiilor

• Factori genetici
- defect cromozomial monogenic (ex. HLP tip IIa)
- defect cromozomial poligenic

• Factori câştigaţi
- excesele alimentare
- abuzul de alcool
- fumatul
- sedentarismul
- stress-ul
- obezitatea
- diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic
- unele medicamente: corticoizii, contraceptivele orale
Mecanisme patogenetice

• Creşterea sintezei sau producţiei lipoproteice


- dietă hipercalorică, hiperlipidică, hipercolesterolică,
bogată în glucide simple → ↑ fluxul de AGL spre ficat →
→ ↑ VLDL → ↑ IDL şi LDL

• Diminuarea catabolismului lipoproteic


- ↓ activităţii LPL → hiperchilomicronemie şi/sau ↑ VLDL
- absenţa receptorilor LDL sau ↓ activităţii lor → ↑ LDL
- anomalii ale Apo E → IDL nu mai sunt recunoscute de
receptorii LDL → hiperlipidemia mixtă severă

• Combinarea mai multor factori şi mecanisme de


producere
Tablou clinic

• Xantoame – de tip eruptiv, tendinos, tuberos, palmar


• Xantelasma
• Arc cornean
• Lipemia retinalis
• Dureri abdominale, manifestări de pancreatită
• Manifestări ale ATS cerebrale, coronariene şi periferice
• Simptome osteo-articulare (rar)
Investigaţii paraclinice

• Aprecierea aspectului plasmei sau serului după 24 de


ore de la recoltare şi păstrare la frigider (+ 40C)
• Dozarea colesterolului total şi a TG
• Dozarea HDL-colesterolului
• Calculul LDL-colesterolului (formula lui Friedwald):
LDL-col = colesterol total – HDL-col – TG/5 (mg/dl)
LDL-col = colesterol total – HDL-col – TG/2,2 (mmol/l)
Condiţie: TG < 400 mg/dl
• Alte metode (electroforeza, ultracentrifugarea, dozarea
apoproteinelor)
Depistarea dislipidemiilor

• Ideal: screening sistematic la întreaga populaţie cu


vârsta > 20 ani

• Practic: la grupele cu risc crescut


Grupele cu risc crescut la care se recomandă
depistarea dislipidemiilor

1. Bolnavi cu boli cardio-vasculare aterosclerotice

2. Persoane cu factori de risc cardiovascular

3. Persoane cu arc cornean sau xantomatoză

4. Rudele de gradul I ale persoanelor de la punctele 1 şi 2


• Depistarea completă
- determinarea CT, TG, HDL-col
- recoltare dimineaţa, după 8-12 ore de post
- recomandată la persoane cu boli cardio - vasculare ATS
DZ
xantomatoză

• Depistarea parţială
- determinarea doar a colesterolului total
- recoltare în orice moment al zilei
- recomandată la persoanele care au şi alţi factori de risc
rudele de gradul I ale celor cu BCV ATS
alte persoane care se prezintă la consultaţie
Dislipidemiile aterogene

• Hipercolesterolemie de graniţă (190-249 mg/dl)

• Hipertrigliceridemie > 180 mg/dl

• Scăderea colesterolului HDL < 40 mg/dl la bărbaţi

< 50 mg/dl la femei

• Modificarea LDL care devin mici şi dense


Dislipidemiile secundare

• Hipercolesterolemii – hipotiroidie, colestază, sindrom


nefrotic, sarcină, medicaţie cu tiazide şi progesteron

• Hipertrigliceridemie – DZ necontrolat, sindrom nefrotic,


insuficienţă renală cronică, paraproteinemie

• Hiperlipidemie mixtă – DZ necontrolat, sindrom nefrotic,


medicaţie cu tiazide, corticosteroizi, progestageni
Complicaţii şi asocieri morbide

• Patologia cardio-vasculară aterosclerotică

• Pancreatita acută

• Diabetul zaharat

• Obezitatea

• Hipertensiunea arterială

• Sindromul X metabolic
Management-ul dislipidemiilor

• Stabilirea obiectivelor

• Optimizarea stilului de viaţă

- dieta hipolipidică

- exerciţiul fizic

• Tratamentul medicamentos
Principiile dietei hipolipidice

• Adaptarea aportului caloric în funcţie de necesităţi şi


greutatea corporală
• Reducerea aportului caloric provenit din lipide < 30%
• Scăderea lipidelor saturate la 1/3 din totalul lipidelor
• Lipidele mononesaturate şi cele polinesaturate (forma “cis”)
vor reprezenta baza aportului lipidic (câte 1/3)
• Scăderea aportului de colesterol < 300 mg/zi
• Creşterea aportului de glucide complexe (50-55%)
• Fibrele alimentare – 20-30 g/zi
• Glucidele simple – 10% din necesarul caloric
• Alcoolul va fi suspendat sau mult limitat
• Evitarea fumatului
• Dieta trebuie “negociată” cu pacientul
• Control la 3 luni
• Scade colesterolul cu 10-20%

Exerciţiul fizic

• Scade trigliceridele
• Creşte HDL-colesterolul
Tratamentul farmacologic al dislipidemiilor

• Rezine: colestiramina
• Derivații de acid nicotinic: acipimox, niacin + laropiprant
• Statine
• Fibrați
• Ezetimib
• Uleiul de pește și derivații săi
• Inhibitorii de PCSK9 (proprotein convertase subtilisin/kexin
tip 9): alirocumab, evolocumab
Tratamentul farmacologic al dislipidemiilor

• Rezine: colestiramina
• Derivații de acid nicotinic: acipimox, niacin + laropiprant
• Statine
• Fibrați
• Ezetimib
• Uleiul de pește și derivații săi
• Inhibitorii de PCSK9 (proprotein convertaza subtilisin/kexin
tip 9): alirocumab, evolocumab

Principiu terapeutic de bază în hipercolesterolemii:


evaluarea RCV
Tratamentul medicamentos

Rezinele (Colestiramina)

• Mecanism de acţiune
- blochează circuitul enterohepatic al acizilor biliari
- activează transformarea colesterolului în acizi biliari
- stimulează captarea LDL pe calea receptorilor LDL
• Efecte secundare - disconfort abdominal, constipaţie,
diaree, creşterea TG, ↓ absorbţiei altor medicamente
• Contraindicaţii - obstrucţie biliară completă, ulcer peptic,
sarcină
• Monitorizare - leucocite
Acidul nicotinic şi derivaţii (Acipimox)

• Mecanism de acţiune
- inhibă eliberarea AG din depozite
- ↓ sinteza şi secreţia de VLDL
• Efecte secundare - prurit, greţuri, congestia feţei, vărsături
• Contraindicaţii - insuficienţă hepatică, infarct miocardic
recent, cardiopatie congestivă, gută, sarcină, ulcer gastric
• Monitorizare - glicemie, teste funcţionale hepatice, acid uric
Ezetimib
• Mecanism de acţiune
- inhibă absorbția intestinală de colesterol
- adjuvant la tratamentul cu statină: reduce mortalitatea
post-SCA
• Indicaţii – adjuvant la terapia cu statine pentru scăderea
colesterolului

Uleiul de peşte
• Conţine AG polinesaturaţi omega 3
• Inhibă sinteza şi secreţia de VLDL
• Adjuvant în tratamentul de scădere a trigliceridelor
• Posibile efecte benefice post-IMA
Fibraţii

• Mecanism de acţiune
- PPAR → exprimarea genei LPL
exprimarea genei Apo A I şi Apo A II
diminuarea genei Apo C
→ activează LPL
stimulează catabolismul LDL şi VLDL
inhibă lipoliza TG din adipocite
↓ concentraţia LDL mici şi dense
↑ HDL de volum crescut
↓ hiperlipemia postprandială
↓ fibrinogenul → efect antitrombogen
• Efecte secundare - disconfort abdominal, greţuri, erupţii,
mialgii (miopatie), ↑ efectul anticoagulantelor

• Contraindicaţii - insuficienţă hepatică, renală, sindrom


nefrotic, sarcină, alăptare

• Monitorizare - teste funcţionale hepatice, creatin-kinaza

• Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil


Statinele

• Mecanism de acţiune
- inhibă HMG-CoA reductaza, deci sinteza colesterolului
- ↑ sinteza receptorilor LDL, deci catabolizarea acestuia
- ↓ procentul de LDL mici şi dense
- ↓ oxidabilitatea LDL
- ↓ fibrinogenul, Lp(a), PAI-1 → efecte favorabile pe
sistemul de coagulare-fibrinoliză

• Efecte secundare – flatulenţă, ↑ enzimelor hepatice şi


musculare, erupţii
• Contraindicaţii – boli hepatice active, sarcină, alăptare

• Monitorizare - teste funcţionale hepatice, creatin-kinaza

• Preparate - rosuvastatin, atorvastatin, simvastatin,


pravastatin, lovastatin, fluvastatin
Riscul cardiovascular în țările europene
• Europe low risk
- Andorra, Austria, Belgium, Cyprus, Denmark, Finland, France,
Germany, Greece, Iceland, Ireland, Israel, Italy, Luxembourg, Malta,
Monaco, The Netherlands, Norway, Portugal, San Marino, Slovenia,
Spain, Sweden, Switzerland, United Kingdom

• Europe high risk


- Albania, Algeria, Bosnia and Herzegovina, Croatia, Czech Republic
Egypt, Estonia, Hungary, Kosovo, Lebanon, Libya, Montenegro,
Morocco, Poland, Romania, Serbia, Slovakia, Syria, Tunisia, Turkey

• Very high risk (please note that the charts may underestimate risk
in these countries)
- Armenia, Azerbaijan, Belarus, Bulgaria, Georgia, Kazakhstan,
Kyrgyzstan, Latvia, Lithuania, FYR Macedonia, Moldova, Russian
Federation, Ukraine, Uzbekistan
Diagrama
SCORE:
Riscul pe 10 ani
de boală
cardiovasculară
fatală la
populațiile cu
risc crescut

ESC-EAS guidelines 2019


• Pentru calcularea riscului de boală cardiovasculară
totală (fatală + nonfatală) se înmulțește riscul de boală
cardiovasculară fatală cu 3 la bărbați și cu 4 la femei

• Diagrama SCORE se folosește doar la persoanele fără


boală cardiovasculară manifestă, diabet zaharat, boală
cronică de rinichi, hipercolesterolemie familială sau cu
niveluri foarte crescute de factori de risc, deoarece aceste
persoane au deja un risc crescut și necesită un
management intensiv
ESC-EAS guidelines 2019
ESC-EAS guidelines 2019
ESC-EAS guidelines 2019
ESC-EAS guidelines 2019
ESC-EAS guidelines 2019
Obezitatea
• Definiţie - obezitatea este o boală caracterizată prin
creşterea greutăţii corporale pe seama ţesutului adipos

• Etimologie - “obedo-obedere” (lat) = “a mânca în


exces”, “a mânca mult şi lacom”

• Prevalenţă - în lume > 250 milioane obezi


- în 2025 > 300 milioane obezi
Prevalenţa supraponderii şi a obezităţii în ţările
europene
Obezitatea
problemă majoră de sănătate publică

• Prevalenţă crescută la nivel populaţional

• Costuri directe şi indirecte ridicate implicate de


îngrijirea obezităţii

• Complicaţii multiple
Formule de calcul a greutăţii ideale

• Formula lui Broca: GI = I – 100

• Formula lui Lorentz: GI = (I – 100) – (I – 150)/4 (B)


GI = (I - 100) – (I – 150)/2 (F)

• Formula Societăţii Asigurărilor Metropolitane din New York:


GI = 50 + 0,75(I – 150) + (V – 20)/4 (B)
F: GI (B) X 0,9
Indici de apreciere a obezităţii

• Indicele de masă corporală:


IMC = G/I2 (n = 18,5 – 24,9 kg/m2)
• Indicele abdomino-fesier:
IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95)
• Indicele abdominal:
IA = CA / I (n < 0,5)
• Grosimea paniculului adipos în regiunea tricipitală:
n < 20 mm (B); n < 30 mm (F)
• CA: n < 94 cm (B); n < 80 cm (F)
Clasificarea greutăţii în funcţie de valorile IMC
(Kg/m2)

Subponderal < 18,5


Normal 18,5 - 24,9
Supraponderal 25 – 29,9
Obezitate gradul I 30 – 34,9

Obezitate gradul II 35 – 39,9


Obezitate gradul III ≥ 40
Clasificarea obezităţii în funcţie de distribuţia
ţesutului adipos
Tipul obezităţii Talia (cm) B Talia (cm) F

Abdominal ≥ 94 ≥ 80
Gluteo-femural < 94 < 80

Riscul cardiovascular în funcţie de talie şi sex


Risc scăzut Risc probabil Risc cert
Bărbaţi < 94 94 – 101 ≥ 102

Femei < 80 80 – 87 ≥ 88
Clasificarea obezităţii

• Criteriul etiopatogenic
- obezitate primară
- obezitate secundară

• Criteriul histologic
- obezitate hiperplazică
- obezitate hipertrofică
- obezitate mixtă

• Criteriul evolutiv
- obezitate dinamică (faza de acumulare)
- obezitate statică (de regulă când a atins maximul ponderal)
Schema generală de producere a obezităţii
Factori genetici Factori câştigaţi

Dezechilibru energetic:
Aportul energetic > cheltuiala energetică

Acumulare de trigliceride în adipocite

- Creştere în greutate: obezitate
- Acumulare selectivă intraabdominală
de ţesut adipos: obezitate abdominală
• Organismul normoponderal adult
EA = EC (MB + TM + TR + ADS)

• Organismul obez
EA = EC + ED

EA = energie de aport
EC = energie de consum
MB = energie consumată pentru nevoile bazale
TM = travaliu muscular
TR = energie de termoreglare
ADS = acţiunea dinamică specifică a alimentelor
Principalii factori de risc obezogen (1)
• Factori genetici – istoric familial de obezitate

• Subnutriţia mamei gestante, greutate mică la naştere a


fătului

• Stil de viaţă nesănătos – alimentaţie hipercalorică, alcool,


sedentarism, stress

• Factori psihologici, sociali şi culturali


- depresia, anxietatea → tulburări de comportament alimentar
- urbanizarea
- obiceiuri alimentare nesănătoase
- lipsa acţiunilor de educaţie şi prevenire la nivel populaţional
- mentalităţi greşite
Principalii factori de risc obezogen (2)

• Tulburări de comportament alimentar – gustări


interprandiale de alimente bogate caloric, bulimie, binge
eating, night eating, carbohydrate-craving

• Factori fiziologici – sarcină, lactaţie, menopauză

• Factori endocrini şi hipotalamici

• Medicamente

• Alţi factori – întreruperea fumatului în absenţa unei diete


corespunzătoare
Mortalitatea

• Riscul cel mai mic: IMC = 20 – 25 → 27 Kg/m2

• ↑ excesiv la IMC > 30 Kg/m2

• IMC scăzut → neoplasme

• IMC crescut → boli cardio-vasculare

• Durata medie de supravieţuire → cu 10 ani mai mică

• Efectul fluctuaţiilor greutăţii


Complicaţiile cardio-vasculare ale obezităţii

• Boala coronariană

• Insuficienţa cardiacă

• Aritmiile şi moartea subită

• Hipertensiunea arterială

• Varicele membrelor inferioare


Complicaţiile respiratorii ale obezităţii

• Hipoventilaţie → hipoxie şi hipercapnie → tulburări nervoase


centrale (somnolenţă, convulsii)
• Hipoxemia → poliglobulie secundară → ↑ volumul sanguin →
→ HTP → CPC → IVD → ICCG
• 1956, Burnwell – “Sdr. Pickwick” – obezitate marcată,
hipoventilaţie, somnolenţă, uneori convulsii, cianoză,
respiraţie periodică, policitemie secundară, HVD, CPC
decompensat
• Pneumopatii acute şi bronşite
• Dispnee, chiar în lipsa insuficienţei cardiace
• Sindromul apneei în timpul somnului
Complicaţiile digestive ale obezităţii
• Litiaza biliară
• Angiocolecistite
• Herniile – hiatală, inghinală, ombilicală
• Steatoza hepatică
• Hemoroizi
Tulburări endocrine
• Distrofie ovariană (ovare polichistice)
• Tulburări ale ciclului menstrual
• Hiperestrogenism şi hiperandrogenism la femei
• Hipogonadism la bărbaţi

Cancerele
• La B: prostată, colorectal
• La F: endometru, sân, căi biliare, col uterin, ovar
Complicaţiile metabolice ale obezităţii
• Diabetul zaharat
• Hiperlipidemia
• Hiperuricemia

Complicaţiile la nivelul aparatului locomotor
• Reumatism cronic degenerativ
• Osteoartrite de şold şi de genunchi
• Boli periarticulare – tendinite

Complicaţiile neurologice şi psihice


• Cefalee, vertij, astenie fizică
• Tulburări psihice
Complicaţiile chirurgicale ale obezităţii
• Risc chirurgical şi anestezic mai mare
• Risc de insuficienţă respiratorie, infecţii ale plăgilor,
dehiscenţa plăgilor, tromboflebite postoperatorii

Complicaţiile obstetricale ale obezităţii


• Eclampsie, varice, tromboflebite, infecţii urinare, diabet
gestaţional, mortalitate fetală crescută
• Distocii
• Retracţie uterină întârziată → hemoragii, şoc; endometrite,
accidente mamare, pielonefrite

Complicaţiile cutanate
• Infecţii microbiene şi fungice (intertrigo inghinal, axilar)
• Eczeme
Tratamentul obezităţii în funcţie de IMC

IMC (kg/m2) Co-morbidităţi Tratament


> 27 Da sau nu Educaţie privind schimbarea
stilului de viaţă
> 30 Nu Educaţie şi program de
modificare a obiceiurilor

> 30 Da Educaţie, program de modificare


a obiceiurilor şi medicamente

> 35 Da sau nu Dietă hipocalorică, medicamente

> 40 Da Toate cele enumerate anterior şi


metode chirurgicale
Principiile tratamentului dietetic în obezitate

• Glucide: 55-58% • 5 mese pe zi


• Proteine: 15-17% • Mic dejun: 20%
• Lipide: 27-28% • Gustare: 15%
• NaCl: < 6 g • Prânz: 30%
• Fibre alimentare: 20-30 g • Gustare: 15%
• Colesterol: < 300 mg • Cina: 20%
• Lichide: > 2 litri
Tipuri de diete utilizate în obezitate

• Dieta cu deficit de 500 kcal/zi

• Dieta cu deficit de 1000 kcal/zi

• Dieta hipocalorică standard de 1200-1300 kcal/zi

• Reducerea la jumătate din aportul caloric anterior

• Dietele foarte hipocalorice sau restrictive – sub 800 kcal/zi


Rolul efortului fizic în tratamentul obezităţii

• Creşte sensibilitatea ţesuturilor la insulină


• Determină scădere în greutate şi menţine
greutatea dorită
• Scade riscul cardiovascular
• Scade necesarul de agenţi farmacologici
• Creşte capacitatea de efort
• Creşte calitatea vieţii
Tratamentul medicamentos al obezităţii

Pe plan mondial:

• Orlistat (Xenical)

• Naltrexonă + bupropion (Mysimba)

• Liraglutid (3 mg/zi)

• Lorcaserină

• Fentermină + topiramat
Tratamentul medicamentos al obezităţii

• Orlistat (Xenical)

• Naltrexonă + bupropion (Mysimba)

• Liraglutid (3 mg/zi)

• Lorcaserină

• Fentermină + topiramat
Tratamentul medicamentos al obezităţii
Orlistat (Xenical)
• Inhibă selectiv lipaza gastrointestinală → ↓ absorbţia
grăsimilor cu 30% (TG şi colesterol)
• Acţiuni şi efecte
- reducerea greutăţii pe seama masei grase
- reducerea taliei şi a IMC
- reducerea RCV prin reducerea celorlalţi FR (↓ col total,
LDL, TG, ameliorarea toleranţei la glucoză, a TA)

• Reacţii adverse
- digestive (în condiţiile unui aport lipidic crescut)
- ↓ nivelului plasmatic al vitaminelor liposolubile

• Contraindicaţii – sindrom de malabsorbţie

• Posologie – 3 x 120 mg / zi la mesele principale


Tratamentul medicamentos al obezităţii
Mysimba (naltrexonă + bupropion)

• 8 mg naltrexona (antagonist opioid) + 90 mg bupropion


(inhibitor selectiv de recaptare a dopaminei și norepinefrinei)
• Indicații: IMC peste 30 kg/m2 sau IMC de 27-30 kg/m2 +
comorbidități ale obezității
• Contraindicații: HTA necontrolată, tulburări psihiatrice
(inclusiv de comportament alimentar), boli convulsivante,
tumori ale SNC, dependență de opioide, tratamente de
sevraj la alcool, BZD sau opioide, boli renale sau hepatice
severe, eșec după 16 săptămâni (pierdere ponderală sub
5% din greutatea inițială)
Tratamentul chirurgical al obezităţii

Indicaţii

• IMC ≥ 40 kg/m2

• IMC ≥ 35 kg/m2 cu comorbidităţi

• Vârsta între 18 şi 60 ani

• Eşecul tratamentului conservator aplicat cel puţin un an

• Pacient care va coopera pe termen lung după operaţie


Tratamentul chirurgical al obezităţii

Contraindicaţii

• IMC < 35 kg/m2


• Vârsta sub 18 ani sau peste 60 de ani
• Obezitate de cauză endocrină
• Dependenţa de droguri sau alcool
• Risc operator inacceptabil
• Boli asociate grave: hepatopatie, cardiopatie, patologie
digestivă
Tehnici chirurgicale

• Tehnici restrictive
- gastroplastia orizontală
- gastroplastia verticală
- bandingul gastric

• Tehnici de malabsorbţie
- by-pass-ul jejunoileal
- by-pass-ul bilio-intestinal
- by-pass-ul bilio-pancreatic
Hiperuricemiile
Definirea termenilor

• Hiperuricemia

• Artrita acută urică

• Artrita gutoasă cronică şi tofii gutoşi


(guta cronică tofacee)

• Nefropatia urică

• Litiaza renală urică


Epidemiologie

• Prevalenţa hiperuricemiilor - 2 – 18%


- în România 4,2% la adulţi

• Prevalenţa gutei - 0,13 – 0,37%


- 2 – 5% din totalul artropatiilor

• Sexotropism masculin

• Vârf de incidenţă - decada a 5-a de vârstă


Clasificarea hiperuricemiilor

• Primare
- Idiopatică (> 99%)
- Defecte metabolice specifice moştenite (<1%)
• Secundare
- Deficitul de glucozo-6-fosfatază (boala von Gierke)
- Hemolize cronice: anemii hemolitice, leucemii, limfoame
- Mecanisme renale
- insuficienţă renală familială progresivă
- insuficienţă renală cronică dobândită
- medicamente (diuretice, citostatice)
- produşi metabolici endogeni (lactat, corpi cetonici)
Tratamentul dietetic în hiperuricemii

• Dietă săracă în purine


• Tratamentul obezităţii
• Reducerea consumului de alcool
• Dietă lacto-fructo-zaharată
Tratamentul atacului acut de gută

• Colchicina

• AINS

• Glucocorticoizii (po sau intraarticular)

• NU hipouricemiante

• Profilaxia recurenţelor
Prevenirea formării depozitelor tisulare de uraţi
şi diminuarea sau dispariţia celor constituite

• Inhibitorii biosintezei acidului uric


- allopurinol, oxipurinol, tiopurinol

• Medicaţia uricoeliminatoare
- probenecidul
- benziodarona
- sulfinpirazona
• Indicaţiile uricofrenatoarelor
- litiaza renală certă sau colici nefretice ± eliminare de
calculi în antecedente
- uraturie > 700 mg/24 ore
- coexistenţa unor afecţiuni care contraindică aportul excesiv
de lichide (IR severă, sdr. nefrotic, HTA)

• Indicaţiile uricoeliminatoarelor
- uraturie < 700 mg/24 ore
- absenţa litiazei renale sau a colicilor renale în antecedente
- când hiperuricemia e datorată tratamentului diuretic al HTA
- cînd e posibilă cura de diureză şi alcalinizarea urinei
Sindromul metabolic
Definiţia sindromului metabolic (IDF, 2005)

Obezitate abdominală (CA ≥ 94 cm la B / ≥ 80 cm la F)

+
Oricare 2 din următoarele 4 elemente:

• TG ≥ 150 mg/dl
• HDL < 40 mg/dl la B şi < 50 mg/dl la F
• TAs ≥ 130 mm Hg sau TAd ≥ 85 mm Hg
• Glicemie a jeun ≥ 100 mg/dl

Propuneri recente: oricare 3 din cele 5 criterii de mai sus