B2S R15 Full PDF

3FBEUIJTNBOVBMDBSFGVMMZCFGPSFPQFSBUJOHUIJTWFIJDMF
08/&34."/6"-
YZF155
B2S-F8199-30
EAU46091
Read this manual carefully before operating this vehicle. This manual should stay with this vehicle if it is sold.
EAU46091
൘֯⭘䘉⭥অ䖖ԕࡽˈ䈧‫⭘֯࠶ݵ‬䘉ሿ᡻޼Ǆ䘉᡻޼享Ԉо⭥অ䖖а䎧Ǆ
EAU46091
Baca buku panduan dengan teliti sebelum mengendalikan motosikal ini. Buku panduan diberi bersama dengan
pembelian motosikal.
B2S
Introduction
EAU10103
Welcome to the Yamaha world of motorcycling!

As the owner of the YZF155, you are benefiting from Yamaha’s vast experience and newest technology regarding the de-
sign and manufacture of high-quality products, which have earned Yamaha a reputation for dependability.
Please take the time to read this manual thoroughly, so as to enjoy all advantages of your YZF155. The Owner’s Manual
does not only instruct you in how to operate, inspect and maintain your motorcycle, but also in how to safeguard yourself
and others from trouble and injury.
In addition, the many tips given in this manual will help keep your motorcycle in the best possible condition. If you have any
further questions, do not hesitate to contact your Yamaha dealer.
The Yamaha team wishes you many safe and pleasant rides. So, remember to put safety first!
Yamaha continually seeks advancements in product design and quality. Therefore, while this manual contains the most cur-
rent product information available at the time of printing, there may be minor discrepancies between your motorcycle and
this manual. If there is any question concerning this manual, please consult a Yamaha dealer.
EWA10032
WARNING
Please read this manual carefully and completely before operating this motorcycle.
Important manual information
EAU10134
Particularly important information is distinguished in this manual by the following notations:

This is the safety alert symbol. It is used to alert you to potential personal injury
hazards. Obey all safety messages that follow this symbol to avoid possible injury
or death.
A WARNING indicates a hazardous situation which, if not avoided, could result in

WARNING death or serious injury.
A NOTICE indicates special precautions that must be taken to avoid damage to the
NOTICE vehicle or other property.
TIP A TIP provides key information to make procedures easier or clearer.
*Product and specifications are subject to change without notice.

Important manual information
EAUV0012
YZF155
OWNER’S MANUAL
©2018 by Yamaha Motor Co., Ltd.
1st edition, June 2018
All rights reserved.
Any reprinting or unauthorized use
without the written permission of
Yamaha Motor Co., Ltd.
is expressly prohibited.
Printed in Malaysia
Table of contents
Location of important labels........... 1-1 For your safety – pre-operation Tires .............................................. 7-17
checks ...............................................5-1 Cast wheels .................................. 7-19
Safety information............................ 2-1 Adjusting the clutch lever
Further safe-riding points ............... 2-5 Operation and important riding free play..................................... 7-19
Helmets .......................................... 2-6 points .................................................6-1 Checking the front and rear
Starting the engine..........................6-1 brake pads ................................ 7-20
Description ....................................... 3-1 Shifting ............................................6-2 Checking the brake fluid level ...... 7-21
Left view ......................................... 3-1 Tips for reducing fuel Changing the brake fluid .............. 7-22
Right view....................................... 3-2 consumption................................6-3 Drive chain slack........................... 7-22
Controls and instruments ............... 3-3 Engine break-in ...............................6-3 Cleaning and lubricating the
Parking ............................................6-4 drive chain................................. 7-24
Instrument and control functions... 4-1 General note....................................6-5 Checking and lubricating the
Main switch/steering lock............... 4-1 cables........................................ 7-25
Keyhole shutter .............................. 4-2 Periodic maintenance and Checking and lubricating the
Indicator lights and warning adjustment ........................................7-1 throttle grip and cable end........ 7-25
lights............................................ 4-3 Owner’s tool kit ...............................7-1 Checking and lubricating the
Multi-function meter unit ................ 4-4 Periodic maintenance chart for brake and shift pedals............... 7-25
Handlebar switches...................... 4-11 the emission control system........7-2 Checking and lubricating the
Clutch lever .................................. 4-12 General maintenance and brake and clutch levers ............. 7-26
Shift pedal .................................... 4-13 lubrication chart...........................7-3 Checking and lubricating the
Brake lever.................................... 4-13 Removing and installing the sidestand................................... 7-27
Brake pedal .................................. 4-13 cowling and panels......................7-7 Lubricating the swingarm
Fuel tank cap................................ 4-14 Checking the spark plug .................7-9 pivots......................................... 7-27
Fuel............................................... 4-14 Engine oil and oil filter element .....7-10 Checking the front fork................. 7-27
Catalytic converter ....................... 4-15 Coolant..........................................7-13 Checking the steering................... 7-28
Seats ............................................ 4-16 Cleaning the air filter element .......7-14 Checking the wheel bearings ....... 7-28
Helmet holder ............................... 4-17 Adjusting the engine idling Battery .......................................... 7-29
Sidestand ..................................... 4-18 speed.........................................7-15 Replacing the fuses ...................... 7-30
Starting circuit cut-off system ...... 4-18 Adjusting the throttle grip Headlights..................................... 7-31
free play .....................................7-16 Auxiliary lights............................... 7-31
Valve clearance .............................7-17 Tail/brake light .............................. 7-31
Table of contents
Replacing a turn signal light
bulb ............................................7-32
Supporting the motorcycle............7-32
Front wheel....................................7-33
Rear wheel.....................................7-34
Troubleshooting ............................7-36
Troubleshooting charts .................7-37
Motorcycle care and storage ..........8-1

Matte color caution .........................8-1
Care .................................................8-1
Storage ............................................8-3
Specifications....................................9-1
Consumer information ...................10-1

Identification numbers...................10-1
Vehicle data recording ..................10-2
Index ................................................11-1
Location of important labels
EAU10385
1
Read and understand all of the labels on your vehicle. They contain important information for safe and proper operation of
your vehicle. Never remove any labels from your vehicle. If a label becomes difficult to read or comes off, a replacement
label is available from your Yamaha dealer.
1 2 3
1-1
Location of important labels
1
1 2
WARNING
Before you operate
this vehicle, read
the owner’s manual. 100kPa=1bar kPa, psi kPa, psi
LOAD LIMIT 225, 33 220, 36

Hook: 1Kg Seat Box: 1Kg
Front Box: 1Kg 225, 33 250, 36
1-2
Safety information
EAU1026B
t Never operate a scooter without conspicuous appears to be very
proper training or instruction. Take effective in reducing the chance of
a training course. Beginners this type of accident.
2 Be a Responsible Owner should receive training from a cer- Therefore:
As the vehicle’s owner, you are re- tified instructor. Contact an autho- t Wear a brightly colored jacket.
sponsible for the safe and proper oper- rized scooter dealer to find out t Use extra caution when you are
ation of your scooter. about the training courses nearest approaching and passing
Scooters are single-track vehicles. you. through intersections, since in-
Their safe use and operation are de- tersections are the most likely
pendent upon the use of proper riding Safe Riding places for scooter accidents to
techniques as well as the expertise of Perform the pre-operation checks occur.
the operator. Every operator should each time you use the vehicle to make t Ride where other motorists can
know the following requirements be- sure it is in safe operating condition. see you. Avoid riding in another
fore riding this scooter. Failure to inspect or maintain the vehi- motorist’s blind spot.
He or she should: cle properly increases the possibility of t Never maintain a scooter with-
t Obtain thorough instructions from an accident or equipment damage. out proper knowledge. Contact
a competent source on all aspects See page 7-1 for a list of pre-operation an authorized scooter dealer to
of scooter operation. checks. inform you on basic scooter
t Observe the warnings and mainte- t This scooter is designed to carry maintenance. Certain mainte-
nance requirements in this Own- the operator and a passenger. nance can only be carried out
er’s Manual. t The failure of motorists to detect by certified staff.
t Obtain qualified training in safe and recognize scooters in traffic is
and proper riding techniques. the predominating cause of auto-
t Obtain professional technical ser- mobile/scooter accidents. Many
vice as indicated in this Owner’s accidents have been caused by
Manual and/or when made neces- an automobile driver who did not
sary by mechanical conditions. see the scooter. Making yourself
2-1
Safety information
t Many accidents involve inexperi- t Always signal before turning or Protective Apparel
enced operators. In fact, many op- changing lanes. Make sure that The majority of fatalities from scooter
erators who have been involved in other motorists can see you. accidents are the result of head inju-
accidents do not even have a cur- t The posture of the operator and ries. The use of a safety helmet is the 2
rent driver’s license. passenger is important for proper single most critical factor in the pre-
t Make sure that you are qualified control. vention or reduction of head injuries.
and that you only lend your t The operator should keep both t Always wear an approved helmet.
scooter to other qualified opera- hands on the handlebar and t Wear a face shield or goggles.
tors. both feet on the operator foot- Wind in your unprotected eyes
t Know your skills and limits. rests during operation to main- could contribute to an impairment
Staying within your limits may tain control of the scooter. of vision that could delay seeing a
help you to avoid an accident. t The passenger should always hazard.
t We recommend that you prac- hold onto the operator, the seat t The use of a jacket, substantial
tice riding your scooter where strap or grab bar, if equipped, shoes, trousers, gloves, etc., is ef-
there is no traffic until you have with both hands and keep both fective in preventing or reducing
become thoroughly familiar with feet on the passenger footrests. abrasions or lacerations.
the scooter and all of its con- Never carry a passenger unless t Never wear loose-fitting clothes,
trols. he or she can firmly place both otherwise they could catch on the
t Many accidents have been feet on the passenger footrests. control levers or wheels and cause
caused by error of the scooter op- t Never ride under the influence of injury or an accident.
erator. A typical error made by the alcohol or other drugs. t Always wear protective clothing
operator is veering wide on a turn t This scooter is designed for on- that covers your legs, ankles, and
due to excessive speed or under- road use only. It is not suitable for feet. The engine or exhaust sys-
cornering (insufficient lean angle off-road use. tem become very hot during or af-
for the speed). ter operation and can cause
t Always obey the speed limit and burns.
never travel faster than warrant- t A passenger should also observe
ed by road and traffic condi- the above precautions.
tions. 2-2
Safety information
Avoid Carbon Monoxide Poisoning t Do not run engine outdoors where When loading within this weight limit,
All engine exhaust contains carbon engine exhaust can be drawn into keep the following in mind:
monoxide, a deadly gas. Breathing a building through openings such t Cargo and accessory weight
2 carbon monoxide can cause head- as windows and doors. should be kept as low and close to
aches, dizziness, drowsiness, nausea, the scooter as possible. Securely
confusion, and eventually death. Loading pack your heaviest items as close
Carbon Monoxide is a colorless, odor- Adding accessories or cargo to your to the center of the vehicle as pos-
less, tasteless gas which may be scooter can adversely affect stability sible and make sure to distribute
present even if you do not see or smell and handling if the weight distribution the weight as evenly as possible
any engine exhaust. Deadly levels of of the scooter is changed. To avoid the on both sides of the scooter to
carbon monoxide can collect rapidly possibility of an accident, use extreme minimize imbalance or instability.
and you can quickly be overcome and caution when adding cargo or acces- t Shifting weights can create a sud-
unable to save yourself. Also, deadly sories to your scooter. Use extra care den imbalance. Make sure that
levels of carbon monoxide can linger when riding a scooter that has added accessories and cargo are se-
for hours or days in enclosed or poorly cargo or accessories. Here, along with curely attached to the scooter be-
ventilated areas. If you experience any the information about accessories before riding. Check accessory
symptoms of carbon monoxide poi- low, are some general guidelines to fol- mounts and cargo restraints fre-
soning, leave the area immediately, get low if loading cargo to your scooter: quently.
fresh air, and SEEK MEDICAL TREAT- The total weight of the operator, pas- t Properly adjust the suspension
MENT. senger, accessories and cargo must for your load (suspension-ad-
t Do not run engine indoors. Even if not exceed the maximum load limit. justable models only), and
you try to ventilate engine exhaust Operation of an overloaded vehicle check the condition and pres-
with fans or open windows and could cause an accident. sure of your tires.
doors, carbon monoxide can rap- t Never attach any large or heavy
idly reach dangerous levels. Maximum load: items to the handlebar, front
t Do not run engine in poorly venti- fork, or front fender. Such items
168 kg (370 lb)
lated or partially enclosed areas can create unstable handling or
such as barns, garages, or car- a slow steering response.
ports. 2-3
Safety information
t This vehicle is not designed to nize that some aftermarket accesso- are added to the handlebar or
pull a trailer or to be attached to ries or modifications are not suitable front fork area, they must be as
a sidecar. because of potential safety hazards to lightweight as possible and
you or others. Installing aftermarket should be kept to a minimum. 2
Genuine Yamaha Accessories products or having other modifications t Bulky or large accessories may
Choosing accessories for your vehicle performed to your vehicle that change seriously affect the stability of
is an important decision. Genuine any of the vehicle’s design or operation the scooter due to aerodynamic
Yamaha accessories, which are avail- characteristics can put you and others effects. Wind may attempt to lift
able only from a Yamaha dealer, have at greater risk of serious injury or the scooter, or the scooter may
been designed, tested, and approved death. You are responsible for injuries become unstable in cross
by Yamaha for use on your vehicle. related to changes in the vehicle. winds. These accessories may
Many companies with no connection Keep the following guidelines in mind, also cause instability when
to Yamaha manufacture parts and ac- as well as those provided under “Load- passing or being passed by
cessories or offer other modifications ing” when mounting accessories. large vehicles.
for Yamaha vehicles. Yamaha is not in t Never install accessories or carry t Certain accessories can dis-
a position to test the products that cargo that would impair the per- place the operator from his or
these aftermarket companies produce. formance of your scooter. Careful- her normal riding position. This
Therefore, Yamaha can neither en- ly inspect the accessory before improper position limits the
dorse nor recommend the use of ac- using it to make sure that it does freedom of movement of the
cessories not sold by Yamaha or not in any way reduce ground operator and may limit control
modifications not specifically recom- clearance or cornering clearance, ability, therefore, such accesso-
mended by Yamaha, even if sold and limit suspension travel, steering ries are not recommended.
installed by a Yamaha dealer. travel or control operation, or ob- t Use caution when adding electri-
scure lights or reflectors. cal accessories. If electrical ac-
Aftermarket Parts, Accessories, and t Accessories fitted to the han- cessories exceed the capacity of
Modifications dlebar or the front fork area can the scooter’s electrical system, an
While you may find aftermarket prod- create instability due to improp- electric failure could result, which
ucts similar in design and quality to er weight distribution or aerody- could cause a dangerous loss of
genuine Yamaha accessories, recog- namic changes. If accessories lights or engine power.
2-4
Safety information
Aftermarket Tires and Rims cation for the straps carefully so wet. Slow down and cross them
The tires and rims that came with your the straps will not rub against with caution. Keep the scooter up-
scooter were designed to match the painted surfaces during transport. right, otherwise it could slide out
2 performance capabilities and to pro- t The suspension should be com- from under you.
vide the best combination of handling, pressed somewhat by the tie- t The brake pads or linings could
braking, and comfort. Other tires, rims, downs, if possible, so that the get wet when you wash the scoot-
sizes, and combinations may not be scooter will not bounce exces- er. After washing the scooter,
appropriate. Refer to page 7-18 for tire sively during transport. check the brakes before riding.
specifications and more information on EAU57600 t Always wear a helmet, gloves,
replacing your tires. Further safe-riding points trousers (tapered around the cuff
t Be sure to signal clearly when and ankle so they do not flap), and
Transporting the Scooter making turns. a brightly colored jacket.
Be sure to observe following instruc- t Braking can be extremely difficult t Do not carry too much luggage on
tions before transporting the scooter in on a wet road. Avoid hard braking, the scooter. An overloaded scoot-
another vehicle. because the scooter could slide. er is unstable. Use a strong cord
t Remove all loose items from the Apply the brakes slowly when to secure any luggage to the carri-
scooter. stopping on a wet surface. er (if equipped). A loose load will
t Point the front wheel straight t Slow down as you approach a affect the stability of the scooter
ahead on the trailer or in the truck corner or turn. Once you have and could divert your attention
bed, and choke it in a rail to pre- completed a turn, accelerate from the road. (See page 2-3.)
vent movement. slowly.
t Secure the scooter with tie-downs t Be careful when passing parked
or suitable straps that are at- cars. A driver might not see you
tached to solid parts of the scoot- and open a door in your path.
er, such as the frame or upper t Railroad crossings, streetcar rails,
front fork triple clamp (and not, for iron plates on road construction
example, to rubber-mounted han- sites, and manhole covers be-
dlebars or turn signals, or parts come extremely slippery when
that could break). Choose the lo- 2-5
Safety information
EAUN0532
Correct usage
Helmets Types of helmets and their usage
Operating this vehicle without an ap-
proved motorcycle helmet increases t Full-type: use only for riding at low
your chances of a severe head injury or to mid-range speeds 2
death in the event of an accident. The
majority of fatalities from motorcycle or
scooter accidents are the result of
head injuries. The use of a safety hel-
met is the single most critical factor in ZAUU0003
the prevention or reduction of head in-
juries. Wrong usage ZAUU0005
Always select an approved motorcy-

cle helmet t Full-face-type: use for riding at
Pay attention to the following when mid-range to high speeds
choosing a motorcycle helmet.
t The helmet must meet the safety
standard “SIRIM”.
t The helmet size must match the
size of the rider’s head. ZAUU0007
t Never subject a helmet to heavy
shocks.
Wearing the helmet correctly
ZAUU0006
Always connect the chin strap. In the
case of an accident, the helmet has a
much less chance of coming off if the
chin strap is connected.
2-6
Description
EAU10411
Left view
1,2 3 4 5 6 7
9 8
1. Headlight (page 7-31) 9. Shift pedal (page 4-13)

2. Auxiliary light (page 7-31)
3. Fuel tank cap (page 4-14)
4. Air filter (page 7-14)
5. Battery (page 7-29)
6. Fuse (page 7-30)
7. Owner’s tool kit (page 7-1)
8. Sidestand (page 4-18)
3-1
Description
EAU10421
Right view
1 2 3
8 7 65 4
1. Rear turn signal light (page 7-32)
2. Tail/brake light (page 7-31)
3. Front brake fluid reservoir (page 7-21)
4. Front turn signal light (page 7-32)
5. Engine oil filter element (page 7-10)
6. Dipstick (page 7-10)
7. Brake pedal (page 4-13)
8. Rear brake fluid reservoir (page 7-21)
3-2
Description
EAU10431
Controls and instruments

1 2 3 4 5 6 7
1. Clutch lever (page 4-12)

2. Left handlebar switches (page 4-11)
3. Multi-function meter unit (page 4-4)
4. Main switch/steering lock (page 4-1)
5. Right handlebar switches (page 4-11)
6. Throttle grip (page 7-16)
7. Brake lever (page 4-13)
3-3
Instrument and control functions
EAUN0264
To lock the steering
Main switch/steering lock TIP
z The meter lighting comes on auto-
OFF ON matically when the key is turned
to “ ”. 1 2
z The fuel pump can be heard when
the key is turned to “ ”.
EAU76120 4
(off)
LOCK All electrical systems are off. The key
can be removed. 1. Push.
EWA15351
The main switch/steering lock controls 2. Turn.
WARNING
the ignition and lighting systems, and is 1. Turn the handlebars all the way to
used to lock the steering. The various Never turn the key to “ ” or “ ”
while the vehicle is moving. Other- the left.
main switch positions are described 2. Push the key in from the “ ” po-
below. wise the electrical systems will be
switched off, which may result in sition, release it, and then turn it
TIP loss of control or an accident. to “ ”.
The main switch/steering lock is 3. Remove the key.
equipped with a keyhole shutter. (See EAU76130
TIP
page 4-2 for keyhole shutter opening (lock)
If the steering will not lock, try turning
and closing procedures.) The steering is locked, and all electrical
the handlebars back to the right slight-
systems are off. The key can be re-
ly.
EAU80650 moved.
(on)
All electrical circuits are supplied with
power, and the engine can be started.
The key cannot be removed.
4-1
To unlock the steering EAU61101
To close the keyhole shutter
Keyhole shutter
2
4
Insert the key and turn it to “ ”. 1. Main switch/steering lock key Insert the keyhole shutter key into the
2. Keyhole shutter key keyhole shutter receptacle as shown,
and then turn the key to the left to close
To open the keyhole shutter
the keyhole shutter.
Insert the keyhole shutter key into the

keyhole shutter receptacle as shown,
and then turn the key to the right to
open the keyhole shutter.
4-2
EAU4939C EAU11081
Indicator lights and warning High beam indicator light “ ” TIP

lights This indicator light comes on when the For radiator-fan-equipped vehi-
high beam of the headlight is switched cles, the radiator fan(s) automati-
4 on. cally switch on or off according to
the coolant temperature in the ra-
EAUM2782
diator.
Coolant temperature warning
If the engine overheats, see page
3 5 light “ ”
2 6 7-38 for further instructions. 4
This warning light comes on if the en-
1
gine overheats. If this occurs, stop the EAU68540
engine immediately and allow the en- Engine trouble warning light “ ”
gine to cool. This warning light comes on or flashes
1. Engine trouble warning light “ ” The electrical circuit of the warning if a problem is detected in the electrical
2. Coolant temperature warning light “ ” light can be checked by turning the key circuit monitoring the engine. If this oc-
3. Neutral indicator light “ ” to “ ”. The warning light should come curs, have a Yamaha dealer check the
4. Shift timing indicator light on for a few seconds, and then go off. self-diagnosis system.
5. Turn signal indicator light “ ” If the warning light does not come on The electrical circuit of the warning
6. High beam indicator light “ ” initially when the key is turned to “ ”, light can be checked by turning the key
or if the warning light remains on, have to “ ”. The warning light should come
EAU11022
Turn signal indicator light “ ” a Yamaha dealer check the electrical on for a few seconds, and then go off.
This indicator light flashes when a turn circuit. If the warning light does not come on
ECA10022
signal light is flashing. initially when the key is turned to “ ”,
NOTICE or if the warning light remains on, have
EAU11061 Do not continue to operate the en- a Yamaha dealer check the electrical
Neutral indicator light “ ” gine if it is overheating. circuit.
This indicator light comes on when the
transmission is in the neutral position.
4-3
EAU62470 EAU80722 EWA12423
Shift timing indicator light Multi-function meter unit WARNING
This indicator light can be set to come
7 6 Be sure to stop the vehicle before
on and go off at the desired engine
making any setting changes to the
speeds and is used to inform the rider
multi-function meter unit. Changing
when it is time to shift to the next high-
5 settings while riding can distract the
er gear. (See page 4-9 for a more de-
8 4 operator and increase the risk of an
tailed explanation of this indicator light
accident.
and on how to set it.)
The electrical circuit of the indicator The multi-function meter unit is
light can be checked by turning the key 1 2 3 equipped with the following:
4 to “ ”. The indicator light should 1. “SELECT” button z a speedometer
2. “RESET” button
come on for a few seconds, and then 3. Speedometer z a fuel meter
go off. 4. Fuel meter z a VVA indicator
If the indicator light does not come on 5. VVA (variable valve actuation) indicator z a tachometer
initially when the key is turned to “ ”, 6. Tachometer z a transmission gear display
7. Transmission gear display
or if the indicator light remains on, have 8. Multi-function display z a multi-function display
a Yamaha dealer check the electrical z a shift timing indicator light
The multi-function meter unit can be
circuit. adjusted for the brightness screen. z a self diagnosis device
To adjust the brightness screen Speedometer
1. Turn the key to “ ”.
2. Push and hold the “SELECT” but-
ton.
3. Turn the key to “ ” and then re-
lease the “SELECT” button after
five seconds.
4. Push the “RESET” button to select
the desired brightness level. 1. Speedometer 1
4-4
The speedometer shows the vehicle’s VVA indicator Tachometer
traveling speed.
1 2
Fuel meter
1
1 1. VVA (variable valve actuation) indicator
This model is equipped with variable 1. Tachometer

valve actuation (VVA) for good fuel 2. Tachometer red zone
1. Fuel meter economy and acceleration in both the The tachometer allows the rider to
low-speed and high-speed ranges. monitor the engine speed and keep it
The fuel meter indicates the amount of The VVA indicator comes on when the within the ideal power range.
fuel in the fuel tank. The display seg- variable valve actuation system has ECA23050
ments of the fuel meter disappear to- switched to the high-speed range. NOTICE
wards “E” (empty) as the fuel level
Do not operate the engine in the ta-
decreases. When the last segment
chometer high-r/min zone.
start flashing, refuel as soon as possi-
High-r/min zone: 11500 r/min and
ble.
above
When the key is turned to “ ”, the dis-
play segments of the fuel meter will
sweep once across the fuel level range
and then return to the current amount

in order to test the electrical circuit.
4-5
Transmission gear display The multi-function display is equipped cally changes to the fuel reserve trip-
with the following: meter mode “TRIP F” and starts
2 z an odometer counting the distance traveled from
z two tripmeters that point. In that case, push the “SE-
z a fuel reserve tripmeter LECT” button to switch the display be-
1 z a clock tween the various tripmeter, odometer,
z an instantaneous fuel consump- clock, instantaneous fuel consump-
tion display tion, average fuel consumption, and
z an average fuel consumption dis- average speed modes in the following
play order:
4 z an average speed display
1. Neutral indicator light “ ”
2. Transmission gear display Push the “SELECT” button to switch TRIP F o CLOCK o km/L or L/100 km
the display between the odometer o AVE_ _._ km/L or AVE_ _._ L/100 km
This display shows the selected gear. mode “ODO”, tripmeters mode “TRIP o AVE_ _._ km/h o ODO o TRIP 1 o
The neutral position is indicated by “ ” 1” and “TRIP 2”, clock mode “ _ _:_ _ ”, TRIP 2 o TRIP F
and by the neutral indicator light. instantaneous fuel consumption mode
“km/L” or “L/100 km”, average fuel To reset a tripmeter, select it by push-
Multi-function display consumption mode “AVE_ _._ km/L” or ing the “SELECT” button and then
“AVE_ _._ L/100 km” and average push the “RESET” button for at least
speed mode “AVE_ _._ km/h” in the one second.
following order: If you do not reset the fuel reserve trip-
meter manually, it resets itself auto-
ODO o TRIP 1 o TRIP 2 o CLOCK o
matically and the display returns to the
km/L or L/100 km o AVE_ _._ km/L or
prior mode after refueling and traveling
AVE_ _._ L/100 km o AVE_ _._ km/h o
5 km.
ODO
1 If the last segment of the fuel meter
1. Multi-function display starts flashing, the display automati-
4-6
Odometer mode The tripmeters shows the total dis- To set the clock
tance traveled since they were last re- 1. Switch the display to the clock
set. mode.
To reset a tripmeter, push the “RESET” 2. With the display in the clock
button for one second. mode, push and hold the “SE-
LECT” and “RESET” button to-
TIP gether.
z The odometer will lock at 999999 3. When the hour digits start flash-
and cannot be reset. ing, use the “RESET” button to set 4
z The tripmeters will reset and con- the hours.
1 4. Push the “SELECT” button and
tinue counting after 9999.9 is the minutes will start flashing.
1. Odometer reached. To reset the tripmeters, 5. Use the “RESET” button to set the
The odometer shows the total distance while it is being displayed, press minutes.
traveled by the vehicle. It cannot be re- the “RESET” button for at least 6. Push the “SELECT” button to start
one second. the clock.
set.
Clock mode Instantaneous fuel consumption
Tripmeters mode mode
1
1
1 1. Instantaneous fuel consumption display
1. Clock
1. Tripmeter
Shows the current fuel consumption
The clock uses a 12-hour time system. when the vehicle is traveling at least 10
4-7 km/h.
There are two display modes: “km/L” Average fuel consumption mode To reset the average fuel consumption
and “L/100 km” display, push and hold the “RESET”
To switch the instantaneous fuel con- button.
sumption display between “km/L” and TIP
“L/100 km”, push the “SELECT” but- z After resetting the average fuel
ton for one second. consumption, “_ _._” will be
z “km/L”: The distance that can be shown until the vehicle has trav-
traveled on 1.0 L of fuel under the eled 1 km.
current riding conditions is shown. The average fuel consumption
z “L/100 km”: The amount of fuel
1
4 function should be used for gener-
necessary to travel 100 km under 1. Average fuel consumption display al reference only. Do not use this
the current riding conditions is figure to estimate the distance
shown. Show the average fuel consumption
that can be traveled on the current
since it was last reset.
TIP tank of fuel.
There are two display mode: “AVE_ _._
z If traveling at speeds under 10 km/L” and “AVE_ _._ L/100 km”.
km/h, “_ _._” is displayed. Average speed mode
To switch the average fuel consump-
z The instantaneous fuel consump-
tion display between “AVE_ _._ km/L”
tion function should be used for
and “AVE_ _._ L/100 km”, push the
general reference only. Do not use
“SELECT” button for one second.
this figure to estimate the distance
z “AVE_ _._ km/L”: The average dis-
that can be traveled on the current
tance that can be traveled on 1.0 L
tank of fuel.
of fuel is shown.
z “AVE_ _._ L/100 km”: The average
amount of fuel necessary to travel 1
100 km is shown.
1. Average speed display
4-8
Shows the vehicle’s traveling speed z Activation point: this function al- z Flash: the indicator light
since it was last reset. lows you to select the engine flashes when activated. (This
To reset the average speed display, speed at which the indicator light setting is selected when the
push and hold the “RESET” button un- is activated. indicator light flashes four
til the average speed flashes, and then z Deactivation point: this function times per second.)
allows you to select the engine z Off: the indicator light is deac-
push the button again . speed at which the indicator light tivated; in other words, it
is deactivated.
does not come on or flash.
Shift timing indicator light z Brightness: this function allows (This setting is selected when 4
you to adjust the brightness of the
1 the indicator light flashes
indicator light.
once every two seconds.)
To adjust the shift timing indicator light 2. Push the “SELECT” button to con-
1. Turn the key to “ ”. firm the selected flashing pattern.
2. Push and hold the “SELECT” but- The shift timing indicator light
ton. changes to the activation point
3. Turn the key to “ ”, and then resetting mode.
lease the “SELECT” button after
2 five seconds. After that push the The tachometer will show the current
“SELECT” button again. The shift setting r/min for the activation point
1. Shift timing indicator light timing indicator light can now be and deactivation point setting modes.
2. Brightness level display adjusted.
To set the flashing pattern
The shift timing indicator light has four To set the shift activation point
settings which can be adjusted.
one of the following flashing pat- TIP
z Flashing pattern: this function al- tern settings: The shift timing indicator light activa-
lows you to choose whether or not z On: the indicator light stays tion point can be set between 9000
the indicator light will come on and on when activated. (This set- r/min and 13000 r/min. The indicator
whether it should flash or stay on ting is selected when the indi- light can be set in increments of 250
when activated. cator light stays on.) r/min.
4-9
1. Push the “RESET” button to select To adjust the brightness 4. When the first character starts
the desired engine speed for acti- 1. Push the “RESET” button to select flashing, push the “SELECT” but-
vating the indicator light. the desired shift indicator light ton to change the character in the
brightness level. following order.
2. Push the “SELECT” button to con-
2. Push the “SELECT” button to con-
firm the selected engine speed.
firm the selected brightness level.
The control mode changes to the
The display exits the shift timing A B C Y Z
deactivation point setting mode.
light control mode and returns to
To set the deactivation point
the standard multi-function dis- 9 2 1 0
play mode.
4 TIP - (HYPHEN) SPACE
z The shift timing indicator light de- Welcome screen
activation point can be set be- The welcome screen greets the rider
tween 9000 r/min and 13000 when the key is turned to “ ” with the
r/min. The indicator light can be messages “Hi Buddy” and “see you” 5. Push and hold the “SELECT” but-
set in increments of 250 r/min. when the key is turned to “ ”. The ton to confirm the selected char-
z Be sure to set the deactivation user name “Buddy” is set as the facto- acter. The second character will
point to a higher engine speed ry default, but it can be set to your start flashing. Repeat this process
than for the activation point, other- name. for all six characters. After the
wise the shift timing indicator light sixth character is set, all charac-
will not come on. To set the user name ters will flash twice and the setting
1. Turn the key to “ ”. mode will automatically end.
the desired engine speed for de- 2. Push and hold the “RESET” but-
ton. Self-diagnosis device
activating the indicator light. This model is equipped with a self-di-
2. Push the “SELECT” button to con- 3. Turn the key to “ ”, and then re-
lease the “RESET” button after agnosis device for various electrical
firm the selected engine speed. circuits.
The control mode changes to the four seconds
brightness setting mode.
4-10
If a problem is detected in any of those EAU1234M EAU54201
circuits, the engine trouble warning Handlebar switches Dimmer/Pass switch “ / /PASS”
Set this switch to “ ” for the high
light will come on and the display will Left beam and to “ ” for the low beam.
indicate an error code.
ECA11591
To flash the high beam, push the pass
NOTICE side “PASS” of the switch while the
1
headlights are on low beam.
If the display indicates an error
code, the vehicle should be checked EAU12461
as soon as possible in order to avoid 2 Turn signal switch “ / ” 4
engine damage. To signal a right-hand turn, push this
switch to “ ”. To signal a left-hand
3 turn, push this switch to “ ”. When
1. Dimmer/Pass switch “ / /PASS” released, the switch returns to the cen-
2. Turn signal switch “ / ” ter position. To cancel the turn signal
3. Horn switch “ ” lights, push the switch in after it has re-
turned to the center position.
Right
1 EAU12501
Horn switch “ ”
Press this switch to sound the horn.
EAU12662
Engine stop switch “ / ”
Set this switch to “ ” before starting
2 the engine. Set this switch to “ ” to
3 stop the engine in case of an emergen-
cy, such as when the vehicle overturns
1. Engine stop switch “ / ”
2. Hazard switch “ / ”
or when the throttle cable is stuck.
3. Start switch “ ”
4-11
EAU12713 EAU31642 EAU12872
Start switch “ ” Clutch lever Shift pedal
Push this switch to crank the engine
with the starter. See page 6-1 for start-
ing instructions prior to starting the en-
gine. 1
EAUU1021
Hazard lights switch “ / ”
The hazard lights (simultaneous flash-
ing of all turn signal lights) are used in
4 case of an emergency, such as to warn 1
other drivers when your vehicle is 1. Clutch lever 1. Shift pedal
stopped where it might be a traffic haz-
The clutch lever is located on the left The shift pedal is located on the left
ard.
side of the handlebar. To disengage side of the motorcycle and is used in
Set this switch to “ ” to turn on the
the clutch, pull the lever toward the combination with the clutch lever when
hazard lights. To turn off the hazard
handlebar grip. To engage the clutch, shifting the gears of the 6-speed con-
lights, set the switch to “ ”.
ECA10062
release the lever. The lever should be stant-mesh transmission equipped on
NOTICE pulled rapidly and released slowly for this motorcycle.
smooth clutch operation.
Do not use the hazard lights for an
The clutch lever is equipped with a
extended length of time with the en-
clutch switch, which is part of the start-
gine not running, otherwise the bat-
ing circuit cut-off system. (See page
tery may discharge.
4-18.)
4-12
EAU12892 EAU12944 EAUE1481
Brake lever Brake pedal Fuel tank cap
1 2
1
1
4
1. Brake lever 1. Brake pedal 1. Fuel tank cap lock cover
2. Unlock.
The brake lever is located on the right The brake pedal is located on the right
side of the handlebar. To apply the side of the motorcycle. To apply the To remove the fuel tank cap
front brake, pull the lever toward the rear brake, press down on the brake 1. Open the fuel tank cap lock cover.
throttle grip. pedal. 2. Insert the key into the lock and
turn it 1/4 turn clockwise. The lock
will be released and the fuel tank
cap can be removed.
To install the fuel tank cap

1. Push the fuel tank cap into posi-
tion with the key inserted in the
lock.
2. Turn the key counterclockwise to
the original position, and then re-
move it.
3. Close the lock cover.
4-13
EAU13213
TIP Fuel 2
The fuel tank cap cannot be installed Make sure there is sufficient gasoline in 1
unless the key is in the lock. In addi- the tank.
tion, the key cannot be removed if the EWA10882
cap is not properly installed and WARNING

locked. Gasoline and gasoline vapors are
EWA11142 extremely flammable. To avoid fires
WARNING and explosions and to reduce the
Make sure that the fuel tank cap is risk of injury when refueling, follow ZAUE0019
these instructions. 1. Fuel tank filler tube

4 properly installed before riding. 2. Maximum fuel level
Leaking fuel is a fire hazard. 1. Before refueling, turn off the en- 3. Wipe up any spilled fuel immedi-
gine and be sure that no one is sit- ately. NOTICE: Immediately
ting on the vehicle. Never refuel wipe off spilled fuel with a clean,
while smoking, or while in the vi- dry, soft cloth, since fuel may
cinity of sparks, open flames, or deteriorate painted surfaces or
other sources of ignition such as plastic parts. [ECA10072]
the pilot lights of water heaters 4. Be sure to securely close the fuel
and clothes dryers. tank cap.
2. Do not overfill the fuel tank. Stop EWA15152
filling when the fuel reaches the WARNING

bottom of the filler tube. Because Gasoline is poisonous and can
fuel expands when it heats up, cause injury or death. Handle gaso-
heat from the engine or the sun line with care. Never siphon gasoline
can cause fuel to spill out of the by mouth. If you should swallow
fuel tank. some gasoline or inhale a lot of gas-
oline vapor, or get some gasoline in
your eyes, see your doctor immedi-
4-14
ately. If gasoline spills on your skin, EAU13434 ECA10702
wash with soap and water. If gaso- Catalytic converter NOTICE

line spills on your clothing, change This model is equipped with a catalytic Use only unleaded gasoline. The use
your clothes. converter in the exhaust system. of leaded gasoline will cause unre-
EWA10863
WARNING pairable damage to the catalytic

EAU13245 converter.
The exhaust system is hot after op-
eration. To prevent a fire hazard or
Recommended fuel: burns:
Regular unleaded gasoline only z Do not park the vehicle near
Fuel tank capacity:
11 L (2.9 US gal, 2.4 Imp.gal) possible fire hazards such as 4
Fuel reserve amount: grass or other materials that
1.9 L (0.50 US gal, 0.42 Imp.gal) easily burn.
z Park the vehicle in a place
ECA11401
where pedestrians or children
NOTICE
are not likely to touch the hot
Use only unleaded gasoline. The use exhaust system.
of leaded gasoline will cause severe z Make sure that the exhaust sys-
damage to internal engine parts, tem has cooled down before
such as the valves and piston rings, doing any maintenance work.
as well as to the exhaust system. z Do not allow the engine to idle
more than a few minutes. Long
idling can cause a build-up of
heat.
4-15
EAU80670
2. Install the passenger seat by in-
Seats
stalling the nut.
3. Install the plastic cover.
Passenger seat
1 Rider seat
To remove the passenger seat
1. Remove the plastic cover. To remove the rider seat
1. Insert the key into the seat lock,
and then turn it clockwise.
1
1. Nut 1
4
To install the passenger seat
1. Insert the projections on the front 2
of the passenger seat into the seat
holders as shown, and then place
the seat in the original position.
1. Plastic cover
1
2. Remove the nut and then remove 1. Rider seat lock
the passenger seat as shown. 2. Unlock.
2. While holding the key in the posi-

tion “2”, lift the front of the rider
seat and pull it backward.
To install the rider seat
2 1. Insert the projection on the front of
1. Projection the rider seat into the seat holder
2. Seat holder as shown, place the seat in the
4-16
original position.
EAU14326
1 1
Helmet holder
1
2 2
1. Projection 1. Rider seat 4
2. Seat holder 2. Helmet
1. Helmet holder
2. Remove the key.
TIP The helmet holder is located under the To release the helmet from the hel-
rider seat. met holder
Make sure that the seats are properly Remove the rider seat, remove the hel-
secured before riding.
To secure a helmet to the helmet met from the helmet holder, and then
holder install the seat.
1. Remove the rider seat. (See page
4-16.)
2. Hook the helmet onto the helmet
holder, and then securely install
the seat. WARNING! Never ride
with a helmet attached to the
helmet holder, since the helmet
may hit objects, causing loss of
control and possibly an acci-
dent. [EWA10162]
4-17
EAU37491 EAU15393
Sidestand Starting circuit cut-off system

The sidestand is located on the left The starting circuit cut-off system
side of the frame. Raise the sidestand (comprising the clutch switch and the
or lower it with your foot while holding neutral switch) prevents starting when
the vehicle upright. the transmission is in gear and the
EWA14191
clutch lever is not pulled.
WARNING Periodically check the operation of the
The vehicle must not be ridden with starting circuit cut-off system accord-
the sidestand down, or if the side- ing to the following procedure.
4 stand cannot be properly moved up
TIP
(or does not stay up), otherwise the
This check is most reliable if performed
sidestand could contact the ground
with a warmed-up engine.
and distract the operator, resulting
in a possible loss of control.
4-18
With the engine turned off: WARNING

1. Make sure that the engine stop switch is set to “ ”.
If a malfunction is noted, have a Yamaha
2. Turn the key on.
3. Shift the transmission into the neutral position. dealer check the system before riding.
4
4. Push the start switch.
Does the engine start?
The neutral switch may not be working correctly.
YES NO The motorcycle should not be ridden until
checked by a Yamaha dealer.
5. Turn the engine off.
6. Shift the transmission into gear.
7. Keep the clutch lever pulled.
8. Push the start switch.
Does the engine start?
The clutch switch may not be working correctly.
YES The motorcycle should not be ridden until
NO
checked by a Yamaha dealer.
The system is OK. The motorcycle can be ridden.
4-19
For your safety – pre-operation checks
EAU15599
Inspect your vehicle each time you use it to make sure the vehicle is in safe operating condition. Always follow the inspection
and maintenance procedures and schedules described in the Owner’s Manual.
EWA11152
WARNING
Failure to inspect or maintain the vehicle properly increases the possibility of an accident or equipment damage.
Do not operate the vehicle if you find any problem. If a problem cannot be corrected by the procedures provided in
5 this manual, have the vehicle inspected by a Yamaha dealer.
Before using this vehicle, check the following points:
IT EM C HE C K S PAGE
t Check fuel level in fuel tank.

Fuel t Refuel if necessary. 4-14
t Check fuel line for leakage.
t Check oil level in engine.
Engine oil t If necessary, add recommended oil to specified level. 7-10
t Check vehicle for oil leakage.
t Check coolant level in reservoir.
Coolant t If necessary, add recommended coolant to specified level. 7-13
t Check cooling system for leakage.
t Check operation.
t If soft or spongy, have Yamaha dealer bleed hydraulic system.
t Check brake pads for wear.
Front brake t Replace if necessary. 7-20, 7-21
t Check fluid level in reservoir.
t If necessary, add specified brake fluid to specified level.
t Check hydraulic system for leakage.
5-1
ITEM CH E CK S PAGE
t Check operation.
t If soft or spongy, have Yamaha dealer bleed hydraulic system.
t Check brake pads for wear.
Rear brake t Replace if necessary. 7-20, 7-21
t Check fluid level in reservoir.
t If necessary, add specified brake fluid to specified level.
t Check hydraulic system for leakage.
t Check operation.
t Lubricate cable if necessary.
Clutch 7-19
t Check lever free play.
t Adjust if necessary.
t Make sure that operation is smooth. 5
t Check throttle grip free play.
Throttle grip 7-16, 7-25
t If necessary, have Yamaha dealer adjust throttle grip free play and lubricate ca-
ble end and grip housing.
t Make sure that operation is smooth.
Control cables 7-25
t Lubricate cable ends if necessary.
t Check chain slack.
t Adjust if necessary.
Drive chain 7-22, 7-24
t Check chain condition.
t Lubricate if necessary.
t Check for damage.
t Check tire condition and tread depth.
Wheels and tires 7-17, 7-19
t Check air pressure.
t Correct if necessary.
Brake and shift pedals 7-25
t Lubricate pedal pivoting points if necessary.
Brake and clutch levers 7-26
t Lubricate lever pivoting points if necessary.
Sidestand 7-27
t Lubricate pivot if necessary.
5-2
t Make sure that all nuts, bolts and screws are properly tightened.
Chassis fasteners —
t Tighten if necessary.
Instruments, lights, signals t Check operation.
—
and switches t Correct if necessary.
5-3
Operation and important riding points
EAU15952 EAUN0073 EAU54461
Starting the engine

Read the Owner’s Manual carefully to ECAN0072
In order for the starting circuit cut-off
become familiar with all controls. If NOTICE system to enable starting, one of the
there is a control or function you do not Do not ride through deep water, oth- following conditions must be met:
understand, ask your Yamaha dealer. erwise the engine may be damaged. z The transmission is in the neutral
EWA10272
Avoid puddles because they may be position.
WARNING deeper than expected. z The transmission is in gear with
Failure to familiarize yourself with the clutch lever pulled.
the controls can lead to loss of con- See page 4-18 for more informa-
trol, which could cause an accident tion.
or injury. 1. Turn the key to “ ” and make
sure that the engine stop switch is 6
set to “ ”.
The engine trouble warning light
should come on for a few sec-
onds, then go off. NOTICE: If the
warning light does not go off,
have a Yamaha dealer check its
electrical circuit. [ECAT1121]
2. Shift the transmission into the
neutral position. The neutral indi-
cator light should come on. If not,
ask a Yamaha dealer to check the
electrical circuit.
3. Start the engine by pushing the
start switch.
6-1
If the engine fails to start, release EAU16673 ECA10261
the start switch, wait a few sec- Shifting NOTICE

onds, and then try again. Each z Even with the transmission in
starting attempt should be as the neutral position, do not
short as possible to preserve the 6 coast for long periods of time
battery. Do not crank the engine 5 with the engine off, and do not
more than 10 seconds on any one 4 tow the motorcycle for long dis-
3
attempt. 2 tances. The transmission is
ECA11043
2 N properly lubricated only when
NOTICE 1 the engine is running. Inade-
1
For maximum engine life, never ac- quate lubrication may damage
celerate hard when the engine is 1. Shift pedal the transmission.
6 cold! 2. Neutral position z Always use the clutch while
Shifting gears lets you control the changing gears to avoid dam-
amount of engine power available for aging the engine, transmission,
starting off, accelerating, climbing hills, and drive train, which are not
etc. designed to withstand the
The gear positions are shown in the il- shock of forced shifting.
lustration.
TIP
To shift the transmission into the neu-
tral position, press the shift pedal down
repeatedly until it reaches the end of its
travel, and then slightly raise it.
6-2
EAU16811 EAU16842
1600 km (1000 mi) and beyond
Tips for reducing fuel con- Engine break-in The vehicle can now be operated nor-
sumption There is never a more important period mally.
Fuel consumption depends largely on in the life of your engine than the period ECA10311
your riding style. Consider the follow- between 0 and 1600 km (1000 mi). For NOTICE
ing tips to reduce fuel consumption: this reason, you should read the fol- z Keep the engine speed out of
z Shift up swiftly, and avoid high en- lowing material carefully. the tachometer red zone.
gine speeds during acceleration. Since the engine is brand new, do not z If any engine trouble should oc-
z Do not rev the engine while shift- put an excessive load on it for the first cur during the engine break-in
ing down, and avoid high engine 1600 km (1000 mi). The various parts in period, immediately have a
speeds with no load on the en- the engine wear and polish themselves Yamaha dealer check the vehi-
gine. to the correct operating clearances. cle.
z Turn the engine off instead of let- During this period, prolonged full-throt-
tle operation or any condition that 6
ting it idle for an extended length
of time (e.g., in traffic jams, at traf- might result in engine overheating
fic lights or at railroad crossings). must be avoided.
EAU17104
0–1000 km (0–600 mi)

Avoid prolonged operation above 5000
r/min. NOTICE: After 1000 km (600
mi) of operation, the engine oil must
be changed and the oil filter element
replaced. [ECA11153]
1000–1600 km (600–1000 mi)

Avoid prolonged operation above 7500
r/min.
6-3
EAU17214
Parking
When parking, stop the engine, and
then remove the key from the main
switch.
EWA10312
WARNING
z Since the engine and exhaust
system can become very hot,
park in a place where pedestri-
ans or children are not likely to
touch them and be burned.
z Do not park on a slope or on soft
6 ground, otherwise the vehicle
may overturn, increasing the
risk of a fuel leak and fire.
z Do not park near grass or other
flammable materials which
might catch fire.
6-4
EAUV0421
General note
Much can be gained from the correct use and maintenance of a motorcycle.
1. THE CUSTOMERS CAN USE THE FULLEST 2. A MOTORCYCLE CAN KEEP ITS PERFORMANCE
POTENTIAL OF YAMAHA MOTORCYCLES CAPABILITY FOR A LONGER TIME
Comparison of wear on engine parts

(piston, piston ring, cylinder, etc.) 6
100% With maintenance
Perfect operative
condition
Without
maintenance
Distance
covered (km) Engine overhaul, cylinder
boring, piston ring change, etc.
ZAUV0284
6-5
3. FUEL COST AND REPAIR EXPENSES CAN BE 4. A MOTORCYCLE CAN DEMAND A HIGH PRICE
KEPT TO A MINIMUM WHEN IT IS TRADED IN AS A USED PRODUCT
Fuel consumption
With maintenance
100%
Without
maintenance
6 Distance covered (km)
Customer’s running cost

(fuel cost plus maintenance and repair expenses)
S Without maintenance
Big repairs at higher expenses
With maintenance
Distance covered (km)

ZAUV0285
6-6
Periodic maintenance and adjustment
EAU17246 EWA15123 EAU17362
WARNING Owner’s tool kit
Periodic inspection, adjustment, and Turn off the engine when performing
lubrication will keep your vehicle in the maintenance unless otherwise
safest and most efficient condition specified.
possible. Safety is an obligation of the z A running engine has moving
vehicle owner/operator. The most im- parts that can catch on body
portant points of vehicle inspection, parts or clothing and electrical
adjustment, and lubrication are ex- parts that can cause shocks or
plained on the following pages. fires.
The intervals given in the periodic 1
z Running the engine while ser-
maintenance charts should be simply vicing can lead to eye injury, 1. Owner’s tool kit
considered as a general guide under burns, fire, or carbon monoxide
normal riding conditions. However, de- The owner’s tool kit is located under
poisoning – possibly leading to
pending on the weather, terrain, geo- the rider seat. (See page 4-16.)
death. See page 2-3 for more in-
graphical location, and individual use, The service information included in this
formation about carbon monox- 7
the maintenance intervals may need to manual and the tools provided in the
ide.
be shortened. owner’s tool kit are intended to assist
EWA10322 EWA15461
you in the performance of preventive
WARNING WARNING maintenance and minor repairs. How-
Failure to properly maintain the vehi- Brake discs, calipers, drums, and ever, additional tools such as a torque
cle or performing maintenance ac- linings can become very hot during wrench may be necessary to perform
tivities incorrectly may increase use. To avoid possible burns, let certain maintenance work correctly.
your risk of injury or death during brake components cool before
TIP
service or while using the vehicle. If touching them.
If you do not have the tools or experi-
you are not familiar with vehicle ser- ence required for a particular job, have
vice, have a Yamaha dealer perform a Yamaha dealer perform it for you.
service.
7-1
EAUN0510
TIP
z The annual checks must be performed every year, except if a kilometer-based maintenance is performed in-
stead.
z From 13000 km, repeat the maintenance intervals starting from 3000 km.
z Items marked with an asterisk should be performed by a Yamaha dealer as they require special tools, data and tech-
nical skills.
EAUU1543
Periodic maintenance chart for the emission control system

ODOMETER READING
ANNUAL
NO. ITEM CHECK OR MAINTENANCE JOB 1000 km 4000 km 7000 km 10000 km 13000 km CHECK
1 month 4 months 7 months 10 months 13 months
t Check fuel hoses for cracks or

1 * Fuel line
damage.
7
t Check condition.
2 * Fuel filter Every 12000 km (7500 mi)
t Replace if necessary.
t Check condition.

3 Spark plug t Clean and regap.
t Replace. Every 8000 km (5000 mi)
t Check valve clearance.
4 * Valves Every 10000 km (6200 mi)
t Adjust.
t Check engine idle speed.
5 * Fuel injection t Clean, check fuel injection vol-
Every 10000 km (6200 mi)
ume and angle of injector.
t Check for leakage.
6 * Exhaust system t Tighten if necessary.
t Replace gasket(s) if necessary.
7-2
EAUU1554
General maintenance and lubrication chart

ODOMETER READING
ANNUAL
t Perform dynamic inspection us-

Diagnostic system
1 * ing Yamaha diagnostic tool.
check
t Check the error codes.
t Clean.
2 Air filter element
t Replace. E very 10000 k m ( 6200 m i)
t Check voltage.
3 * Battery
t Charge if necessary.
t Check operation.
4 Clutch
t Adjust.
t Check operation, fluid level and
7
5 * Front brake vehicle for fluid leakage.
t Replace brake pads. Whenever wor n to the limit
t Check operation, fluid level and

6 * Rear brake vehicle for fluid leakage.
t Replace brake pads. Whenever wor n to the limit
t Check for cracks or damage.
t Check for correct routing and
7 * Brake hose clamping.
t Replace. Every 4 years
7-3
ODOMETER READING
ANNUAL
8 * Brake fluid t Change. Every 2 years

9 * Wheels t Check runout and for damage.
t Check tread depth and for dam-

age.
10 * Tires t Replace if necessary.
t Check air pressure.
t Correct if necessary.
t Check bearings for looseness or
11 * Wheel bearings
damage.
t Check operation and for exces-

sive play.
12 * Swingarm
t Lubricate with lithium-soap-
7 based grease.
Every 12000 km (7500 mi)
t Check chain slack, alignment and

condition.
Every 1000 km (600 mi) and after washing the motorcycle, riding in the rain or
13 Drive chain t Adjust and lubricate chain with a
riding in wet areas
special O-ring chain lubricant
thoroughly.
t Check bearing play and steering

for roughness.
14 * Steering bearings
t Lubricate with lithium-soap-
Every 12000 km (7500 mi)
based grease.
7-4
ODOMETER READING
ANNUAL
t Make sure that all nuts, bolts and

15 * Chassis fasteners
screws are properly tightened.
Brake lever pivot
16 t Lubricate with silicone grease.
shaft
Brake pedal pivot
shaft
Clutch lever pivot
shaft
Shift pedal pivot t Lubricate with lithium-soap-

19
shaft based grease.
t Check operation.
20 Sidestand t Lubricate with lithium-soap-
based grease. 7
t Check operation and for oil leak-
21 * Front fork
age.
Shock absorber as- t Check operation and shock ab-
22 *
sembly sorber for oil leakage.
t Change.
23 Engine oil t Check oil level and vehicle for oil
leakage.
Engine oil filter ele-
24 t Replace.
ment
7-5
ODOMETER READING
ANNUAL
t Check coolant level and vehicle

25 * Cooling system for coolant leakage.
t Change coolant. Every 3 years
Front and rear
26 * t Check operation.
brake switches
Moving parts and
27 t Lubricate.
cables
t Check operation.
t Check throttle grip free play, and
28 * Throttle grip
adjust if necessary.
t Lubricate cable and grip housing.
Lights, signals and t Check operation.
29 *
switches t Adjust headlight beam.
7
7-6
EAU18662
TIP
z The air filter needs more frequent service if you are riding in unusually wet or dusty areas.
z Hydraulic brake service
t Regularly check and, if necessary, correct the brake fluid level.
t Every two years replace the internal components of the brake master cylinder and caliper, and change the brake
fluid.
t Replace the brake hoses every four years and if cracked or damaged.
7-7
EAU18724
2. Remove the bolts, quick fasteners
Removing and installing the and screw, and then pull the cowl-
cowling and panels ing outward and take it off.
The cowling and panels shown need to
1
be removed to perform some of the 3
maintenance jobs described in this 3
chapter. Refer to this section each time 1
the cowling or a panel needs to be re- 4
moved and installed. 2 2 3
3 2 1 1. Cowling A
2. Projection
3 3. Hole
1. Cowling A
2. Install the screw, quick fasteners
2. Bolt
and bolts.
3. Quick fastener
7 3. Install panels A, B and C. (See
4. Screw
page 7-7.)
4 To install the cowling EAU80690
1. Panel A 1. Fit the projection on the cowling
2. Panel B into the hole, and then push the
3. Panel C cowling inward. Panel A
4. Cowling A
To remove the panel
EAU80680
Cowling A Remove the four quick fasteners and
one bolt for the panel, and then remove
To remove the cowling the panel.
1. Remove panels A, B and C. (See
page 7-7.) 7-8
3
2
2
1 3
2 1
1
3 4
1. Quick fastener 1. Quick fastener 1. Panel B
2. Panel A 2. Screw 2. Projection
3. Bolt 3. Panel B 3. Hole
4. Bolt
2. Install panel C. (See page 7-7.)
To install the panel 3. Remove the quick fasteners, bolt, 3. Install the rider seat and passen-
Place the panel in the original position, and screws, and then pull the pan- 7
ger seat. (See page 4-16.)
and then install the bolt and quick fas- el outward and take it off.
teners.
Panel C
To install the panel
Panel B 1. Fit the projection on the panel into To remove the panel
the hole, push the panel inward, 1. Remove the passenger seat. (See
To remove the panel and then install the screws, bolt, page 4-16.)
1. Remove the passenger seat and and quick fasteners. 2. Remove the bolts and screw, and
rider seat. (See page 4-16.)
then remove the panel.
2. Remove panel C. (See page 7-7.)
7-9
EAUW2165
1 3 Checking the spark plug

The spark plug is an important engine
component, which is easy to check. 1
Since heat and deposits will cause any
spark plug to slowly erode, the spark
plug should be removed and checked
in accordance with the periodic main-
2 tenance and lubrication chart. In addi- 2
tion, the condition of the spark plug
1. Screw 1. Spark plug wrench
can reveal the condition of the engine.
2. Bolt 2. Screwdriver
3. Panel C
To remove the spark plug 3. Remove the spark plug as shown,
1. Remove cowling A. (See page with the spark plug wrench includ-
To install the panel
7-8.) ed in the owner’s tool kit.
7 1. Install the panel by installing the
screw and bolts.
To check the spark plug
2. Install the passenger seat. (See
1 1. Check that the porcelain insulator
page 4-16.)
around the center electrode of the
spark plug is a medium-to-light
tan (the ideal color when the vehi-
cle is ridden normally).
TIP
If the spark plug shows a distinctly dif-
1. Spark plug cap ferent color, the engine could be oper-
2. Remove the spark plug cap. ating improperly. Do not attempt to
7-10
diagnose such problems yourself. In- To install the spark plug EAUE0453
stead, have a Yamaha dealer check 1. Clean the surface of the spark Engine oil and oil filter ele-
the vehicle. plug gasket and its mating sur- ment
face, and then wipe off any grime The engine oil level should be checked
2. Check the spark plug for electrode before each ride. In addition, the oil
from the spark plug threads.
erosion and excessive carbon or must be changed and the oil filter ele-
2. Install the spark plug with the
other deposits, and replace it if ment replaced at the intervals specified
spark plug wrench, and then tight-
necessary. in the periodic maintenance and lubri-
en it to the specified torque.
cation chart.
Specified spark plug:
NGK/MR8E9 Tightening torque:
Spark plug: To check the engine oil level
13.0 N·m (1.3 kgf·m, 9.6 lb·ft) 1. Place the vehicle on a level sur-
3. Measure the spark plug gap with a
wire thickness gauge and, if nec- face and hold it in an upright posi-
essary, adjust the gap to specifi- TIP tion. A slight tilt to the side can
cation. If a torque wrench is not available result in a false reading.
7
when installing a spark plug, a good 2. Start the engine, warm it up for
estimate of the correct torque is 1/4– several minutes, and then turn it
1/2 turn past finger tight. However, the off.
spark plug should be tightened to the 3. Wait a few minutes until the oil set-
specified torque as soon as possible. tles, remove the oil filler cap, wipe
the dipstick clean, insert it back
3. Install the spark plug cap.
into the oil filler hole (without
4. Install the cowling.
screwing it in), and then remove it
again to check the oil level.
1. Spark plug gap NOTICE: Do not operate the ve-
hicle until you know that the en-
Spark plug gap: gine oil level is sufficient. [ECA10012]
0.8–0.9 mm (0.031–0.035 in)
7-11
4. If the engine oil is below the mini-
mum level mark, add sufficient oil
4
of the recommended type to raise
3
it to the correct level.
5. Install and tighten the oil filler cap. 2
To change the engine oil (with or 1

without oil filter element replace-
ZAUE0033
1 ment) ZAUE0672 5
1. Engine oil filler cap 1. Start the engine, warm it up for 1. Engine oil drain bolt
several minutes, and then turn it 2. O-ring
TIP off. 3. Compression spring
The engine oil should be between the 2. Place an oil pan under the engine 4. Strainer
minimum and maximum level marks. to collect the used oil. 5. Oil pan
3. Remove the engine oil filler cap,
7 4. Clean the engine oil strainer with
then the drain bolt along with the
solvent.
1 O-ring, compression spring, and
engine oil strainer, to drain the oil TIP
from the crankcase. NOTICE: Skip steps 5–7 if the oil filter element is
2 When removing the engine oil not being replaced.
3 drain bolt, the O-ring, compres-
5. Remove the oil filter element cover
sion spring, and oil strainer will
by removing the bolts.
fall out. Take care not to lose
ZAUE1300 these parts. [ECA11002]
1. Dipstick
2. Maximum level mark
3. Tip of the engine oil dipstick
7-12
Tightening torques: Recommended engine oil:
Oil filter element cover bolt: See page 9-1.
2 10 N·m (1.0 kgf·m, 7.4 lb·ft) Oil quantity:
Oil change:
1 0.85 L (0.90 US qt, 0.75 Imp.qt)
TIP With oil filter removal:
Make sure that the O-ring is properly 0.95 L (1.00 US qt, 0.84 Imp.qt)
seated. ECA11621
8. Install the engine oil strainer, com- NOTICE

ZAUE1217
1. Bolt
pression spring, O-ring and the z In order to prevent clutch slip-
engine oil drain bolt, and then page (since the engine oil also
2. Oil filter element cover
tighten it to the specified torque. lubricates the clutch), do not
6. Remove and replace the oil filter NOTICE: Before installing the mix any chemical additives. Do
element and O-ring. engine oil drain bolt, do not for- not use oils with a diesel speci-
fication of “CD” or oils of a high-
get to install the O-ring, com- er quality than specified. In
pression spring, and oil strainer 7
addition, do not use oils labeled
1 in position. [ECA10422] “ENERGY CONSERVING II” or
higher.
Tightening torques: z Make sure that no foreign mate-
Engine oil drain bolt: rial enters the crankcase.
32 N·m (3.2 kgf·m, 24 lb·ft)
10. Start the engine, and then let it idle
2
for several minutes while checking
9. Refill with the specified amount of
ZAUE0104 it for oil leakage. If oil is leaking,
1. Oil filter element
the recommended engine oil, and
immediately turn the engine off
2. O-ring then install and tighten the oil filler
and check for the cause.
7. Install the oil filter element cover cap.
11. Turn the engine off, and then
by installing the bolts, then tight- check the oil level and correct it if
ening them to the specified
necessary.
torque. 7-13
EAU20071
Coolant TIP
The coolant level should be checked The coolant should be between the
before each ride. In addition, the cool- minimum and maximum level marks.
ant must be changed at the intervals
specified in the periodic maintenance
and lubrication chart. 1
EAU80890
To check the coolant level
1. Place the vehicle on a level sur- 1 1. Coolant reservoir cap
face. FULL
2 LOW 6. Add coolant to the maximum level
2. Remove cowling A. (See page 3 mark, and then install the coolant
7-7.)
reservoir cap. WARNING! Re-
3. Hold the vehicle in an upright po- 1. Coolant reservoir move only the coolant reservoir
sition. 2. Maximum level mark
7 cap. Never attempt to remove
3. Minimum level mark
TIP the radiator cap when the en-
z The coolant level must be 5. If the coolant is at or below the gine is hot. [EWA15162] NOTICE: If
checked on a cold engine since minimum level mark, remove the coolant is not available, use dis-
the level varies with engine tem- coolant reservoir cap. tilled water or soft tap water in-
perature. stead. Do not use hard water or
z Make sure that the vehicle is posi- salt water since it is harmful to
tioned straight up when checking the engine. If water has been
the coolant level. A slight tilt to the used instead of coolant, replace
side can result in a false reading. it with coolant as soon as possi-
ble, otherwise the cooling sys-
4. Check the coolant level in the
tem will not be protected
coolant reservoir.
against frost and corrosion. If
water has been added to the
7-14
coolant, have a Yamaha dealer EAU80700
check the antifreeze content of Cleaning the air filter element

the coolant as soon as possible, The air filter element should be cleaned
otherwise the effectiveness of at the intervals specified in the periodic
the coolant will be reduced. maintenance and lubrication chart.
[ECA10473]
Clean the air filter element more fre-
quently if you are riding in unusually
1
Coolant reservoir capacity (up to wet or dusty areas.
the maximum level mark): 1. Remove the rider seat. (See page
0.20 L (0.21 US qt, 0.18 Imp.qt) 4-16.) 1. Air filter element
2. Remove cowling A. (See page
7. Install the cowling. 7-7.) 7. Lightly tap the air filter element to
3. Remove the bolts and screws remove the most of the dust and
EAU33032
Changing the coolant from the fuel tank cover. dirt, and then blow the remaining
The coolant must be changed at the in- 4. Remove the bolts from the fuel dirt out with compressed air as
7
tervals specified in the periodic main- tank. shown. If the air filter element is
tenance and lubrication chart. Have a 5. Disconnect the fuel pump lead, damaged, replace it.
Yamaha dealer change the coolant. fuel pump coupler and fuel hose,
WARNING! Never attempt to remove and then remove the fuel tank.
the radiator cap when the engine is 6. Remove the air filter case cover by
hot. [EWA10382] removing the screws, and then
pull the air filter element out.
1. Air filter element
7-15
8. Insert the air filter element into the EAU34302
air filter case. NOTICE: Make Adjusting the engine idling Engine idling speed:
sure that the air filter element is speed 1300–1500 r/min
properly seated in the air filter The engine idling speed must be
case. The engine should never checked and, if necessary, adjusted as TIP
be operated without the air filter follows at the intervals specified in the If the specified idling speed cannot be
element installed, otherwise the periodic maintenance and lubrication obtained as described above, have a
piston(s) and/or cylinder(s) may chart. Yamaha dealer make the adjustment.
become excessively worn. The engine should be warm before
[ECA10482] making this adjustment.
9. Install the air filter case cover by Check the engine idling speed and, if
installing the screws. necessary, adjust it to specification by
turning the idle adjusting screw. To in-
TIP crease the engine idling speed, turn
If dust or water collects in the air filter the screw in direction (a). To decrease
7 check hose, remove the clamp, and the engine idling speed, turn the screw
then remove the plug to drain the hose. in direction (b).
10. Connect the fuel pump lead, fuel
pump coupler and fuel hose.
11. Install the fuel tank and tighten the
bolts. (b)
12. Install the fuel tank cover and
(a)
tighten the bolts and screws.
13. Install the cowling.
14. Install the rider seat.
1
1. Idle adjusting screw
7-16
EAU21377
2. To increase the throttle grip free EAU21402
Adjusting the throttle grip free play, turn the throttle grip free play Valve clearance
play adjusting nut in direction (a). To The valve clearance changes with use,
Measure the throttle grip free play as decrease the throttle grip free resulting in improper air-fuel mixture
shown. play, turn the adjusting nut in di- and/or engine noise. To prevent this
rection (b). from occurring, the valve clearance
must be adjusted by a Yamaha dealer
at the intervals specified in the periodic
maintenance and lubrication chart.
1
(a)
1. Throttle grip free play 1 2 (b)

ZAUE0593 7
1. Locknut
Throttle grip free play: 2. Adjusting nut
3.0–5.0 mm (0.12–0.20 in)
3. Tighten the locknut.
Periodically check the throttle grip free
play and, if necessary, adjust it as fol-
lows.
TIP
The engine idling speed must be cor-
rectly adjusted before checking and
adjusting the throttle grip free play.
1. Loosen the locknut.
7-17
EAU64401
weight of rider, passenger, car- Tire inspection
Tires go, and accessories approved
Tires are the only contact between the for this model.
vehicle and the road. Safety in all con-
ditions of riding depends on a relatively Tire air pressure (measured on cold
small area of road contact. Therefore, it tires):
is essential to maintain the tires in good 1 person:
condition at all times and replace them Front:
at the appropriate time with the speci-
Rear:
fied tires.
Tire air pressure 2 persons:
Front: 1. Tire sidewall
The tire air pressure should be 2. Tire wear indicator
checked and, if necessary, adjusted Rear: 3. Tire tread depth
before each ride.
EWA10504
Maximum load*: The tires must be checked before each
7 WARNING 168 kg (370 lb) ride. If a tire tread shows crosswise
Operation of this vehicle with im- * Total weight of rider, passenger, car- lines (minimum tread depth), if the tire
go and accessories has a nail or glass fragments in it, or if
proper tire pressure may cause se-
vere injury or death from loss of EWA10512 the sidewall is cracked, contact a
control. WARNING Yamaha dealer immediately and have
z The tire air pressure must be Never overload your vehicle. Opera-
the tire replaced.
checked and adjusted on cold tion of an overloaded vehicle could
tires (i.e., when the temperature Minimum tire tread depth (front and
cause an accident. rear):
of the tires equals the ambient
1.0 mm (0.04 in)
temperature).
z The tire air pressure must be
adjusted in accordance with the
riding speed and with the total
7-18
EAU21963
EWA10583
ageing. Old and aged tires shall be
WARNING Cast wheels
checked by tire specialists to ascertain
To maximize the performance, durabil-
z It is dangerous to ride with a their suitability for further use.
ity, and safe operation of your vehicle,
worn-out tire. When a tire tread EWA10462
WARNING note the following points regarding the

begins to show crosswise lines,
specified wheels.
have a Yamaha dealer replace The front and rear tires should be of
z The wheel rims should be
the tire immediately. the same make and design, other-
checked for cracks, bends, warp-
z The replacement of all wheel wise the handling characteristics of
age or other damage before each
and brake-related parts, includ- the vehicle may be different, which
ride. If any damage is found, have
ing the tires, should be left to a could lead to an accident.
a Yamaha dealer replace the
Yamaha dealer, who has the
After extensive tests, only the tires list- wheel. Do not attempt even the
necessary professional knowl-
ed below have been approved for this smallest repair to the wheel. A de-
edge and experience to do so.
model by Yamaha. formed or cracked wheel must be
z Ride at moderate speeds after
replaced.
changing a tire since the tire 7
Front tire: z The wheel should be balanced
surface must first be “broken Size: whenever either the tire or wheel
in” for it to develop its optimal 100/80-17M/C 52P
Manufacturer/model: has been changed or replaced. An
characteristics.
IRC/RX-01F unbalanced wheel can result in
Rear tire: poor performance, adverse han-
Tire information Size: dling characteristics, and a short-
This model is equipped with tubeless 140/70-17M/C 66S ened tire life.
tires and tire air valves. Manufacturer/model:
Tires age, even if they have not been IRC/RX-01R
used or have only been used occasion-
ally. Cracking of the tread and sidewall
rubber, sometimes accompanied by
carcass deformation, is an evidence of
7-19
EAU22047
3. To increase the clutch lever free 6. To increase the clutch lever free
Adjusting the clutch lever free play, turn the clutch lever free play play, turn the clutch lever free play
play adjusting bolt in direction (a). To adjusting nut in direction (a). To
Measure the clutch lever free play as decrease the clutch lever free decrease the clutch lever free
shown. play, turn the adjusting bolt in di- play, turn the adjusting nut in di-
rection (b). rection (b).
2 (a)
3 1 TIP
7. Tighten the locknut at the crank-
case.
If the specified clutch lever free play
8. Tighten the locknut at the clutch
could be obtained as described above,
4 lever and then slide the rubber
(b) skip steps 4–7.
cover to its original position.
4. Fully turn the adjusting bolt at the
clutch lever in direction (a) to loos-
en the clutch cable.
1. Rubber cover 5. Loosen the locknut at the crank-
7 case.
2. Clutch lever free play adjusting bolt
3. Locknut
4. Clutch lever free play
(a)
Clutch lever free play:
10.0–15.0 mm (0.39–0.59 in)
Periodically check the clutch lever free 1

(b)
play and, if necessary, adjust it as fol- 2
lows.
1. Slide the rubber cover back at the
clutch lever. 1. Locknut
2. Loosen the locknut. 2. Clutch lever free play adjusting nut
7-20
EAU22393
indicator grooves have almost disap- EAUV0530
Checking the front and rear peared, have a Yamaha dealer replace Checking the brake fluid level
brake pads the brake pads as a set. Before riding, check that the brake fluid
The front and rear brake pads must be is above the minimum level mark.
checked for wear at the intervals spec- EAU36721 Check the brake fluid level with the top
ified in the periodic maintenance and Rear brake pads of the reservoir level. Replenish the
lubrication chart. brake fluid if necessary.
EAU22432 Front brake
Front brake pads 1 1
1
1 1. Brake pad wear indicator groove 7
Each rear brake pad is provided with
wear indicator grooves, which allow 1. Minimum level mark
1. Brake pad wear indicator groove you to check the brake pad wear with-
out having to disassemble the brake.
Each front brake pad is provided with To check the brake pad wear, check
wear indicator grooves, which allow the wear indicator grooves. If a brake
you to check the brake pad wear with- pad has worn to the point that the wear
out having to disassemble the brake. indicator grooves have almost disap-
To check the brake pad wear, check peared, have a Yamaha dealer replace
the wear indicator grooves. If a brake the brake pads as a set.
pad has worn to the point that the wear
7-21
Rear brake z Use only the specified brake flu- fluid level goes down suddenly, have a
id; otherwise, the rubber seals Yamaha dealer check the cause before
may deteriorate, causing leak- further riding.
age.
z Refill with the same type of
1 brake fluid. Adding a brake fluid
other than DOT 3 or DOT 4 may
result in a harmful chemical re-
action.
z Be careful that water does not
1. Minimum level mark enter the brake fluid reservoir
when refilling. Water will signifi-
Specified brake fluid: cantly lower the boiling point of
DOT 3 or DOT 4 the fluid and may result in vapor
EWA15981
lock.
7 WARNING ECA17641
Improper maintenance can result in NOTICE

loss of braking ability. Observe Brake fluid may damage painted
these precautions: surfaces or plastic parts. Always
z Insufficient brake fluid may al- clean up spilled fluid immediately.
low air to enter the brake sys-
As the brake pads wear, it is normal for
tem, reducing braking
the brake fluid level to gradually go
performance.
down. A low brake fluid level may indi-
z Clean the filler cap before re-
cate worn brake pads and/or brake
moving. Use only DOT 3 or DOT
system leakage; therefore, be sure to
4 brake fluid from a sealed con-
check the brake pads for wear and the
tainer.
brake system for leakage. If the brake
7-22
EAUM1362 EAU22762
Changing the brake fluid Drive chain slack

Have a Yamaha dealer change the The drive chain slack should be
brake fluid at the intervals specified in checked before each ride and adjusted
the periodic maintenance and lubrica- if necessary.
tion chart. In addition, have the brake
hose replaced every four years and EAUE1413
To check the drive chain slack
whenever it is damaged or leaking.
1. Support the motorcycle according
to the procedure on page 7-32. ZAUE1220 1
TIP 1. Drive chain slack
When checking and adjusting the drive
4. If the drive chain slack is incorrect,
chain slack, there should be no weight
adjust it as follows.
on the motorcycle.
2. Shift the transmission into the EAU3431A
To adjust the drive chain slack 7
neutral position.
Consult a Yamaha dealer before ad-
3. Measure the drive chain slack as
justing the drive chain slack.
shown.
1. Loosen the axle nut and the lock-
Drive chain slack: nut on each side of the swingarm.
30.0–40.0 mm (1.18–1.57 in)
7-23
TIP 4. Make sure that the drive chain
Using the alignment marks on each pullers are in the same position,
side of the swingarm, make sure that the drive chain slack is correct,
both drive chain pullers are in the same and the drive chain moves
position for proper wheel alignment. smoothly.
1
1 2 (b)
1. Axle nut
2. To tighten the drive chain, turn the

(a)
drive chain slack adjusting bolt on
each side of the swingarm in di- 3
rection (a). To loosen the drive
7 chain, turn the adjusting bolt on
1. Locknut
each side of the swingarm in di- 2. Drive chain slack adjusting bolt
rection (b), and then push the rear 3. Alignment marks
wheel forward. NOTICE: Improp-
er drive chain slack will over- 3. Tighten the axle nut, then the lock-
load the engine as well as other nuts to their specified torques.
vital parts of the motorcycle and
can lead to chain slippage or Tightening torques:
Axle nut:
breakage. To prevent this from 59 N·m (5.9 kgf·m, 44 lb·ft)
occurring, keep the drive chain Locknut:
slack within the specified limits. 16 N·m (1.6 kgf·m, 12 lb·ft)
[ECA10572]
7-24
EAUE0141 EAUE1151 EAUE1191
Cleaning and lubricating the Checking and lubricating the Checking and lubricating the
drive chain cables throttle grip and cable end
The drive chain must be cleaned and The operation of all control cables and The operation of the throttle grip
lubricated at the intervals specified in the condition of the cables should be should be checked before each ride. In
the periodic maintenance and lubrica- checked before each ride, and the ca- addition, the cable end should be lubri-
tion chart, otherwise it will quickly wear
ble ends should be lubricated if neces- cated by a Yamaha dealer at the inter-
out, especially when riding in dusty or
wet areas. Service the drive chain as sary. If a cable is damaged or does not vals specified in the periodic
follows. move smoothly, have a Yamaha dealer maintenance chart.
ECA10584 check or replace it. WARNING! Dam- The throttle cable is equipped with a
NOTICE age to the outer housing of cables rubber cover. Make sure that the cover
The drive chain must be lubricated may result in internal rusting and is securely installed. Even though the
after washing the motorcycle, riding cause interference with cable move- cover is installed correctly, it does not
in the rain or riding in wet areas. ment. Replace damaged cables as completely protect the cable from wa-
soon as possible to prevent unsafe ter entry. Therefore, use care not to
1. Clean the drive chain with soap conditions. [EWA10712] pour water directly onto the cover or
water to remove the accumulated 7
cable when washing the vehicle. If the
dust & mud and then dry off.
Recommended lubricant: cable or cover becomes dirty, wipe
2. Apply the cleaning spray on all the Lithium-soap-based grease
links and plates of chain, then clean with a moist cloth.
wipe the chain. NOTICE: To pre-
vent damaging the O-rings, do
not clean the drive chain with
steam cleaners, high-pressure
washers or inappropriate sol-
vents. [ECA11122]
3. Thoroughly lubricate the drive
chain with a special O-ring chain
lubricant.
7-25
EAU44276
EAU23144
Checking and lubricating the Recommended lubricant: Checking and lubricating the
Lithium-soap-based grease
brake and shift pedals brake and clutch levers
The operation of the brake and shift The operation of the brake and clutch
pedals should be checked before each levers should be checked before each
ride, and the pedal pivots should be lu- ride, and the lever pivots should be lu-
bricated if necessary. bricated if necessary.
Brake pedal Brake lever
Clutch lever
Shift pedal
7-26
EAU23203 EAUM2701
Recommended lubricants: Checking and lubricating the Lubricating the swingarm piv-
Brake lever:
Silicone grease sidestand ots
Clutch lever: The swingarm pivots must be lubricat-
Lithium-soap-based grease ed at the intervals specified in the peri-
odic maintenance and lubrication
chart.
Recommended lubricant:
Molybdenum disulfide grease
The operation of the sidestand should

be checked before each ride, and the
sidestand pivot and metal-to-metal
7
contact surfaces should be lubricated
if necessary.
EWA10732
WARNING
If the sidestand does not move up
and down smoothly, have a Yamaha
dealer check or repair it. Otherwise,
the sidestand could contact the
ground and distract the operator, re-
sulting in a possible loss of control.
Recommended lubricant:
Lithium-soap-based grease
7-27
EAU23273
EAU23285
Checking the front fork Checking the steering
The condition and operation of the Worn or loose steering bearings may
front fork must be checked as follows cause danger. Therefore, the operation
at the intervals specified in the periodic of the steering must be checked as fol-
maintenance and lubrication chart. lows at the intervals specified in the
periodic maintenance and lubrication
To check the condition chart.
Check the inner tubes for scratches, 1. Raise the front wheel off the
damage and excessive oil leakage. ground. (See page 7-32.)
ECA10591 WARNING! To avoid injury, se-
To check the operation NOTICE curely support the vehicle so
1. Place the vehicle on a level sur- there is no danger of it falling
If any damage is found or the front
face and hold it in an upright posi- over. [EWA10752]
fork does not operate smoothly,
tion. WARNING! To avoid injury, 2. Hold the lower ends of the front
7 have a Yamaha dealer check or re-
securely support the vehicle so fork legs and try to move them for-
pair it.
there is no danger of it falling ward and backward. If any free
over. [EWA10752] play can be felt, have a Yamaha
2. While applying the front brake, dealer check or repair the steer-
push down hard on the handle- ing.
bars several times to check if the
front fork compresses and re-
bounds smoothly.
7-28
z Batteries produce explosive hy-
EAU23292 EAU23377
Checking the wheel bearings Battery drogen gas. Therefore, keep
The front and rear wheel bearings must This model is equipped with a VRLA sparks, flames, cigarettes, etc.,
be checked at the intervals specified in (Valve Regulated Lead Acid) battery. away from the battery and pro-
the periodic maintenance and lubrica- There is no need to check the electro- vide sufficient ventilation when
tion chart. If there is play in the wheel lyte or to add distilled water. However, charging it in an enclosed
hub or if the wheel does not turn the battery lead connections need to space.
smoothly, have a Yamaha dealer be checked and, if necessary, tight- z KEEP THIS AND ALL BATTER-
check the wheel bearings. ened. IES OUT OF THE REACH OF
EWA10761 CHILDREN.
WARNING ECA10621
NOTICE
z Electrolyte is poisonous and
dangerous since it contains sul- Never attempt to remove the battery
cell seals, as this would permanently
furic acid, which causes severe
damage the battery.
burns. Avoid any contact with
skin, eyes or clothing and al- To charge the battery 7
ways shield your eyes when Have a Yamaha dealer charge the bat-
working near batteries. In case tery as soon as possible if it seems to
of contact, administer the fol- have discharged. Keep in mind that the
battery tends to discharge more quick-
lowing FIRST AID.
ly if the vehicle is equipped with op-
t EXTERNAL: Flush with plenty tional electrical accessories.
of water. ECA16522
t INTERNAL: Drink large quan- NOTICE

tities of water or milk and im- To charge a VRLA (Valve Regulated
mediately call a physician. Lead Acid) battery, a special (con-
t EYES: Flush with water for 15 stant-voltage) battery charger is re-
minutes and seek prompt quired. Using a conventional battery
medical attention. charger will damage the battery.
7-29
To store the battery EAU53044
1. If the vehicle will not be used for Replacing the fuses Specified fuses:
Main fuse:
more than one month, remove the 15.0 A
battery, fully charge it, and then Accessory fuse:
place it in a cool, dry place. 2.0 A
1
NOTICE: When removing the
battery, be sure to turn the main 3 3. Turn the main switch on and turn
2
switch off, then disconnect the on the electrical circuit in question
negative lead before discon- to check if the device operates.
necting the positive lead. [ECA16304] 4. If the fuse immediately blows
2. If the battery will be stored for again, have a Yamaha dealer
more than two months, check it at check the electrical system.
1. Main fuse
least once a month and fully 2. Accessory fuse
charge it if necessary. 3. Spare fuse
3. Fully charge the battery before in- The fuse box is located under the rider
7 stallation. NOTICE: When install- seat. (See page 4-16.)
ing the battery, be sure to turn If a fuse is blown, replace it as follows.
the main switch off, then con- 1. Turn the main switch off and turn
nect the positive lead before off the electrical circuit in ques-
connecting the negative lead. tion.
[ECA16842]
2. Remove the blown fuse, and then
4. After installation, make sure that install a new fuse of the specified
the battery leads are properly con- amperage. WARNING! Do not
nected to the battery terminals. use a fuse of a higher amperage
ECA16531
rating than recommended to
NOTICE
avoid causing extensive dam-
Always keep the battery charged. age to the electrical system and
Storing a discharged battery can possibly a fire. [EWA15132]
cause permanent battery damage. 7-30
EAU64070 EAU54502 EAU24182
Headlights Auxiliary lights Tail/brake light

This model is equipped with LED-type This model is equipped with LED-type This model is equipped with an LED-
headlights. auxiliary lights. type tail/brake light.
If a headlight does not come on, have If an auxiliary light does not come on, If the tail/brake light does not come on,
a Yamaha dealer check its electrical have a Yamaha dealer check it. have a Yamaha dealer check it.
circuit.
ECA16581
NOTICE
Do not affix any type of tinted film or
stickers to the headlight lens.
7-31
EAU24361
EAU24205 EAU24351
Replacing a turn signal light Supporting the motorcycle Front wheel

bulb Since this model is not equipped with a
EAUN0582
1. Remove the turn signal light lens centerstand, follow these precautions
by removing the screw. when removing the front and rear
wheel or performing other mainte- To remove the front wheel
EWA10822
nance requiring the motorcycle to
stand upright. Check that the motorcy- WARNING
cle is in a stable and level position be- To avoid injury, securely support the
fore starting any maintenance. A vehicle so there is no danger of it
strong wooden box can be placed un- falling over.
der the engine for added stability.
1. Loosen the front wheel axle nut
To service the front wheel and the brake caliper bolts.
1
1. Stabilize the rear of the motorcy-
1. Screw cle by using a motorcycle stand
7 or, if an additional motorcycle
2. Remove the burnt-out bulb by stand is not available, by placing a
pushing it in and turning it coun- jack under the frame in front of the
terclockwise. rear wheel.
3. Insert a new bulb into the socket, 2. Raise the front wheel off the
push it in, and then turn it clock- ground by using a motorcycle
wise until it stops. stand.
4. Install the lens by installing the To service the rear wheel 1
screw. NOTICE: Do not over- Raise the rear wheel off the ground by 1. Axle nut
tighten the screw, otherwise the using a motorcycle stand or, if a motor-
lens may break. [ECA11192] cycle stand is not available, by placing 2. Lift the front wheel off the ground
a jack either under each side of the according to the procedure in the
frame in front of the rear wheel or under previous section “Supporting the
each side of the swingarm. motorcycle”.
7-32
3. Remove the brake hose holder by To install the front wheel EAU25081
removing the bolt. 1. Lift the wheel up between the fork Rear wheel
4. Remove the brake caliper by re- legs.
EAU80711
moving the bolts. 2. Insert the wheel axle and install
the wheel axle nut.
2 3. Lower the front wheel so that it is To remove the rear wheel
1 on the ground. EWA10822
4 4. Install the brake caliper by install- WARNING
ing the bolts.
To avoid injury, securely support the
TIP
vehicle so there is no danger of it
Make sure that there is enough space falling over.
5 between the brake pads before install-
3 1. Remove the footrest plate by re-
ing the brake caliper onto the brake
1. Brake hose holder disc. moving the bolts.
2. Bolt 5. Install the brake hose holder by in-
3. Brake caliper 7
stalling the bolt.
4. Brake caliper bolt
6. Tighten the wheel axle and brake
5. Wheel axle
caliper bolts to the specified 2
5. Remove the front wheel axle nut. torques. 1
6. Pull the wheel axle out, and then Tightening torques:
remove the wheel. NOTICE: Do Wheel axle:
not apply the brake after the 40 N·m (4.0 kgf·m, 30 lb·ft)
brake calipers have been re- Brake caliper bolt:
moved, otherwise the brake 35 N·m (3.5 kgf·m, 26 lb·ft) 1. Footrest plate
2. Bolt
pads will be forced shut. [ECA11052]
7. Push down hard on the handlebar
2. Remove the drive chain case by
several times to check for proper
removing the bolts along with the
fork operation.
collar.
7-33
6. Fully loosen the drive chain slack 9. While supporting the brake caliper
1 adjuster locknut on each side of bracket, pull the wheel axle out
the swingarm. along with the washer and chain
7. Turn the drive chain slack adjust- puller, and then remove the wheel.
ing bolts fully in direction (a) and NOTICE: Do not apply the brake
push the wheel forward. after the wheel and brake disc
2 have been removed, otherwise
the brake pads will be forced
shut. [ECA11073]
1. Drive chain case
(a)
2. Bolt
3. Loosen the axle nut.
1 2
7
1. Locknut
2. Drive chain slack adjusting bolt
1
8. Remove the drive chain from the
1 rear sprocket. 1. Wheel axle
2 TIP To install the rear wheel
3 z If the drive chain is difficult to re- 1. Install the wheel and the brake cal-
1. Axle nut move, remove the wheel axle first, iper bracket by inserting the wheel
2. Washer and then lift the wheel upward axle along with the washer and
3. Drive chain puller enough to remove the drive chain drive chain puller from the left-
from the rear sprocket. hand side.
4. Lift the rear wheel off the ground
according to the procedure on z The drive chain does not need to TIP
page 7-32. be disassembled in order to re- z Be sure to insert the retainer on
move and install the wheel. the brake caliper bracket into the
5. Remove the axle nut along with
slot in the swingarm.
the washer and drive chain puller. 7-34
EAU25872
z Make sure that there is enough Tightening torques: Troubleshooting
space between the brake pads Axle nut:
Although Yamaha motorcycles receive
before installing the wheel. 59 N·m (5.9 kgf·m, 44 lb·ft)
Locknut: a thorough inspection before shipment
16 N·m (1.6 kgf·m, 12 lb·ft) from the factory, trouble may occur
during operation. Any problem in the
6. Install the drive chain case by in- fuel, compression, or ignition systems,
stalling the bolts along with the for example, can cause poor starting
collar. and loss of power.
7. Install the footrest plate by install- The following troubleshooting charts
ing the bolts. represent quick and easy procedures
for checking these vital systems your-
2 1 self. However, should your motorcycle
1. Retainer require any repair, take it to a Yamaha
2. Slot dealer, whose skilled technicians have
the necessary tools, experience, and 7
2. Install the drive chain onto the rear know-how to service the motorcycle
sprocket. properly.
3. Install the drive chain puller and Use only genuine Yamaha replace-
axle nut along with the washer, ment parts. Imitation parts may look
and then adjust the drive chain like Yamaha parts, but they are often
slack. (See page 7-22.) inferior, have a shorter service life and
4. Lower the rear wheel so that it is can lead to expensive repair bills.
on the ground, and then put the
sidestand down.
5. Tighten the axle nut, and then
tighten the chain adjuster locknuts
to the specified torques.
7-35
EWA15142
WARNING
When checking the fuel system, do
not smoke, and make sure there are
no open flames or sparks in the ar-
ea, including pilot lights from water
heaters or furnaces. Gasoline or
gasoline vapors can ignite or ex-
plode, causing severe injury or prop-
erty damage.
7-36
EAU42136
Troubleshooting charts
Starting problems or poor engine performance
1. Fuel
There is enough fuel. Check the battery.
Check the fuel level in
the fuel tank.
The engine does not start.
There is no fuel. Supply fuel.
Check the battery.
2. Battery The engine turns over

The battery is good.
quickly.
Operate the electric starter.
Check the battery lead connections, Check the ignition.
The engine turns over
and have a Yamaha dealer charge
slowly.
the battery if necessary.
7
3. Ignition Wipe off with a dry cloth and correct the
Wet Operate the electric starter.
spark plug gap, or replace the spark plug.
Remove the spark plug
and check the electrodes.
Dry Have a Yamaha dealer check the vehicle.
Check the compression.
4. Compression The engine does not start.

There is compression.
Have a Yamaha dealer check the vehicle.
Operate the electric starter.
There is no compression. Have a Yamaha dealer check the vehicle.
7-37
Engine overheating
EWA10401
WARNING
z Do not remove the radiator cap when the engine and radiator are hot. Scalding hot fluid and steam may be
blown out under pressure, which could cause serious injury. Be sure to wait until the engine has cooled.
z After removing the radiator cap retaining bolt, place a thick rag, like a towel, over the radiator cap, and then
slowly rotate the cap counterclockwise to the detent to allow any residual pressure to escape. When the hiss-
ing sound has stopped, press down on the cap while turning it counterclockwise, and then remove the cap.
There is Have a Yamaha dealer check

The coolant level is low. leakage. and repair the cooling system.
Check the cooling system
for leakage.
There is
Add coolant. (See TIP.)
7 Wait until the Check the coolant level in the no leakage.
engine has cooled. reservoir and radiator.
The coolant level Start the engine. If the engine overheats again, have a
is OK. Yamaha dealer check and repair the cooling system.
TIP
If coolant is not available, tap water can be temporarily used instead, provided that it is changed to the recommended cool-
ant as soon as possible.
7-38
Motorcycle care and storage
EAU37834
Care
EAUW0066
ucts onto seals, gaskets, sprock-
Matte color caution ets, the drive chain and wheel
ECA15193 While the open design of a motorcycle
axles. Always rinse the dirt and
NOTICE reveals the attractiveness of the tech-
degreaser off with water.
Some models are equipped with nology, it also makes it more vulnera-
ble. Rust and corrosion can develop Cleaning
matte colored finished parts. Be ECA10773
sure to consult a Yamaha dealer for even if high-quality components are NOTICE
advice on what products to use be- used. A rusty exhaust pipe may go un-
noticed on a car, however, it detracts z Avoid using strong acidic wheel
fore cleaning the vehicle. Using a cleaners, especially on spoked
brush, harsh chemical products or from the overall appearance of a mo-
torcycle. Frequent and proper care wheels. If such products are
cleaning compounds when cleaning used on hard-to-remove dirt, do
these parts will scratch or damage does not only comply with the terms of
the warranty, but it will also keep your not leave the cleaner on the af-
their surface. Wax also should not fected area any longer than in-
be applied to any matte colored fin- motorcycle looking good, extend its
life and optimize its performance. structed. Also, thoroughly rinse
ished parts. the area off with water, immedi-
Before cleaning ately dry it, and then apply a cor-
1. Cover the muffler outlet with a rosion protection spray.
plastic bag after the engine has z Improper cleaning can damage 8
cooled down. plastic parts (such as cowlings,
2. Make sure that all caps and cov- panels, windshields, headlight
ers as well as all electrical cou- lenses, meter lenses, etc.) and
plers and connectors, including the mufflers. Use only a soft,
the spark plug cap, are tightly in- clean cloth or sponge with wa-
stalled. ter to clean plastic. However, if
3. Remove extremely stubborn dirt, the plastic parts cannot be thor-
like oil burnt onto the crankcase, oughly cleaned with water, di-
with a degreasing agent and a luted mild detergent with water
brush, but never apply such prod- may be used. Be sure to rinse
8-1
off any detergent residue using leave scratches on the wind- 2. Apply a corrosion protection spray
plenty of water, as it is harmful shield. Test the product on a on all metal, including chrome-
to plastic parts. small hidden part of the wind- and nickel-plated, surfaces to pre-
z Do not use any harsh chemical shield to make sure that it does vent corrosion.
products on plastic parts. Be not leave any marks. If the wind-
sure to avoid using cloths or shield is scratched, use a quality After cleaning
sponges which have been in plastic polishing compound af- 1. Dry the motorcycle with a chamois
contact with strong or abrasive ter washing. or an absorbing cloth.
cleaning products, solvent or 2. Immediately dry the drive chain
thinner, fuel (gasoline), rust re- After normal use and lubricate it to prevent it from
movers or inhibitors, brake fluid, Remove dirt with warm water, a mild rusting.
antifreeze or electrolyte. detergent, and a soft, clean sponge, 3. Use a chrome polish to shine
z Do not use high-pressure wash- and then rinse thoroughly with clean chrome, aluminum and stainless-
ers or steam-jet cleaners since water. Use a toothbrush or bottlebrush steel parts, including the exhaust
they cause water seepage and for hard-to-reach areas. Stubborn dirt system. (Even the thermally in-
deterioration in the following ar- and insects will come off more easily if duced discoloring of stainless-
eas: seals (of wheel and swing- the area is covered with a wet cloth for steel exhaust systems can be re-
arm bearings, fork and brakes), a few minutes before cleaning. moved through polishing.)
8
electric components (couplers, After riding in the rain or near the sea 4. To prevent corrosion, it is recom-
connectors, instruments, Since sea salt is extremely corrosive, mended to apply a corrosion pro-
switches and lights), breather carry out the following steps after each tection spray on all metal,
hoses and vents. ride in the rain or near the sea. including chrome- and nickel-plat-
z For motorcycles equipped with 1. Clean the motorcycle with cold ed, surfaces.
a windshield: Do not use strong water and a mild detergent, after 5. Use spray oil as a universal clean-
cleaners or hard sponges as the engine has cooled down. er to remove any remaining dirt.
they will cause dulling or NOTICE: Do not use warm wa- 6. Touch up minor paint damage
scratching. Some cleaning ter since it increases the corro- caused by stones, etc.
compounds for plastic may sive action of the salt. [ECA10792] 7. Wax all painted surfaces.
8-2
8. Let the motorcycle dry completely z Avoid using abrasive polishing EAU43204
before storing or covering it. compounds as they will wear Storage

EWA11132
away the paint.
WARNING Short-term
Contaminants on the brakes or tires TIP Always store your motorcycle in a cool,
can cause loss of control. z Consult a Yamaha dealer for ad- dry place and, if necessary, protect it
z Make sure that there is no oil or vice on what products to use. against dust with a porous cover. Be
wax on the brakes or tires. z Washing, rainy weather or humid sure the engine and the exhaust sys-
z If necessary, clean the brake climates can cause the headlight tem are cool before covering the mo-
discs and brake linings with a lens to fog. Turning the headlight torcycle.
ECA10811
regular brake disc cleaner or on for a short period of time will
NOTICE
acetone, and wash the tires with help remove the moisture from the
warm water and a mild deter- lens. z Storing the motorcycle in a
gent. Before riding at higher poorly ventilated room or cover-
speeds, test the motorcycle’s ing it with a tarp, while it is still
braking performance and cor- wet, will allow water and humid-
nering behavior. ity to seep in and cause rust.
z To prevent corrosion, avoid 8
ECA10801
damp cellars, stables (because
NOTICE
of the presence of ammonia)
z Apply spray oil and wax spar- and areas where strong chemi-
ingly and make sure to wipe off cals are stored.
any excess.
z Never apply oil or wax to any Long-term
rubber and plastic parts, but Before storing your motorcycle for sev-
treat them with a suitable care eral months:
product. 1. Follow all the instructions in the
“Care” section of this chapter.
8-3
2. Fill up the fuel tank and add fuel e. Remove the spark plug cap
TIP
stabilizer (if available) to prevent from the spark plug, and then
Make any necessary repairs before
the fuel tank from rusting and the install the spark plug and the
storing the motorcycle.
fuel from deteriorating. spark plug cap.
3. Perform the following steps to 4. Lubricate all control cables and
protect the cylinder, piston rings, the pivoting points of all levers and
etc. from corrosion. pedals as well as of the side-
a. Remove the spark plug cap stand/centerstand.
and spark plug. 5. Check and, if necessary, correct
b. Pour a teaspoonful of engine the tire air pressure, and then lift
oil into the spark plug bore. the motorcycle so that both of its
c. Install the spark plug cap onto wheels are off the ground. Alterna-
the spark plug, and then place tively, turn the wheels a little every
the spark plug on the cylinder month in order to prevent the tires
head so that the electrodes are from becoming degraded in one
grounded. (This will limit spark- spot.
ing during the next step.) 6. Cover the muffler outlet with a
8 d. Turn the engine over several plastic bag to prevent moisture
times with the starter. (This will from entering it.
coat the cylinder wall with oil.) 7. Remove the battery and fully
WARNING! To prevent dam- charge it. Store it in a cool, dry
age or injury from sparking, place and charge it once a month.
make sure to ground the Do not store the battery in an ex-
spark plug electrodes while cessively cold or warm place [less
turning the engine over. than 0 °C (30 °F) or more than 30
[EWA10952] °C (90 °F)]. For more information
on storing the battery, see page
7-29.
8-4
Specifications
Dimensions: Starting system: Fuel injection:
Overall length: Electric starter Throttle body:
1990 mm (78.3 in) Lubrication system: ID mark:
Overall width: Wet sump BK61 00
725 mm (28.5 in) Engine oil: Spark plug(s):
Overall height: Recommended brand: Manufacturer/model:
1135 mm (44.7 in) YAMALUBE NGK/MR8E9
Seat height: SAE viscosity grades: Spark plug gap:
815 mm (32.1 in) 10W-40 0.8–0.9 mm (0.031–0.035 in)
Wheelbase: Recommended engine oil grade: Clutch:
1325 mm (52.2 in) API service SG type or higher, JASO Clutch type:
Ground clearance: standard MA Wet, multiple-disc
170 mm (6.69 in) Engine oil quantity: Drivetrain:
Minimum turning radius: Oil change: Primary reduction ratio:
2.8 m (9.19 ft) 0.85 L (0.90 US qt, 0.75 Imp.qt) 3.042 (73/24)
Weight: With oil filter removal: Final drive:
Curb weight: 0.95 L (1.00 US qt, 0.84 Imp.qt) Chain
137 kg (302 lb) Coolant quantity: Secondary reduction ratio:
Engine: Coolant reservoir (up to the maximum level 3.429 (48/14)
Combustion cycle: mark): Transmission type:
4-stroke 0.20 L (0.21 US qt, 0.18 Imp.qt) Constant mesh 6-speed
Cooling system: Radiator (including all routes): Gear ratio:
Liquid cooled 0.49 L (0.52 US qt, 0.43 Imp.qt) 1st:
Valve train: Air filter: 2.833 (34/12) 9
SOHC Air filter element: 2nd:
Number of cylinders: Dry element 1.875 (30/16)
Single cylinder Fuel: 3rd:
Displacement: Recommended fuel: 1.364 (30/22)
Regular unleaded gasoline only 4th:
Bore u stroke: Fuel tank capacity: 1.143 (24/21)
58.0 u 58.7 mm (2.28 u 2.31 in) 11 L (2.9 US gal, 2.4 Imp.gal) 5th:
Compression ratio: Fuel reserve amount: 0.957 (22/23)
11.6 : 1 1.9 L (0.50 US gal, 0.42 Imp.gal)
9-1
Specifications
6th: Rear: Shock absorber:
0.840 (21/25) Hydraulic damper
Chassis: 2 persons: Wheel travel:
Frame type: Front: 130 mm (5.1 in)
Diamond Rear suspension:
Caster angle: Rear: Type:
25.5 ° Swingarm (link suspension)
Trail: Front wheel: Spring:
88 mm (3.5 in) Wheel type: Coil spring
Front tire: Cast wheel Shock absorber:
Type: Rim size: Hydraulic damper
Tubeless 17M/C x MT2.5 Wheel travel:
Size: Rear wheel: 97 mm (3.8 in)
100/80-17M/C 52P Wheel type: Electrical system:
Manufacturer/model: Cast wheel System voltage:
IRC/RX-01F Rim size: 12 V
Rear tire: 17M/C x MT4.0 Ignition system:
Type: Front brake: TCI
Tubeless Type: Charging system:
Size: Hydraulic single disc brake AC magneto
140/70-17M/C 66S Specified brake fluid: Battery:
Manufacturer/model: DOT 3 or 4 Model:
9 IRC/RX-01R Rear brake: GTZ4V
Loading: Type: Voltage, capacity:
Maximum load: Hydraulic single disc brake 12 V, 3.0 Ah (10 HR)
168 kg (370 lb) Specified brake fluid: Bulb wattage:
(Total weight of rider, passenger, cargo DOT 3 or 4 Headlight:
and accessories) Front suspension: LED
Tire air pressure (measured on cold Type: Brake/tail light:
tires): Telescopic fork LED
1 person: Spring: Front turn signal light:
Front: Coil spring 10.0 W
9-2
Specifications
Rear turn signal light:
10.0 W
Auxiliary light:
LED
License plate light:
5.0 W
Meter lighting:
LED
Neutral indicator light:
LED
High beam indicator light:
LED
Turn signal indicator light:
LED
Coolant temperature warning light:
LED
Engine trouble warning light:
LED
Shift timing indicator light:
LED
Fuse(s):
Main fuse:
15.0 A
Accessory fuse: 9
2.0 A
9-3
Consumer information
EAU26365 EAU26401 EAU26442
Identification numbers Vehicle identification number Engine serial number

Record the vehicle identification num-
ber and the engine serial number in the
spaces provided below for assistance
when ordering spare parts from a
Yamaha dealer or for reference in case
the vehicle is stolen.
VEHICLE IDENTIFICATION NUMBER:

1 1
1. Vehicle identification number 1. Engine serial number
The vehicle identification number is The engine serial number is stamped

stamped into the steering head pipe. into the crankcase.
ENGINE SERIAL NUMBER: Record this number in the space pro-
vided.
TIP
The vehicle identification number is
used to identify your motorcycle and
may be used to register your motorcy-
cle with the licensing authority in your
10 area.
10-1
Consumer information
EAU74701
Vehicle data recording

This model’s ECU stores certain vehi-
cle data to assist in the diagnosis of
malfunctions and for research and de-
velopment purposes. This data will be
uploaded only when a special Yamaha
diagnostic tool is attached to the vehi-
cle, such as when maintenance checks
or service procedures are performed.
Although the sensors and recorded

data will vary by model, the main data
points are:
z Vehicle status and engine perfor-
mance data
z Fuel-injection and emission-relat-
ed data
Yamaha will not disclose this data to a
third party except:
z With the consent of the vehicle
owner
z Where obligated by law 10
z For use by Yamaha in litigation
z For general Yamaha-conducted
research purposes when the data
is not related to an individual vehi-
cle nor owner
10-2
#BDBCVLVQBOEVBOEFOHBOUFMJUJTFCFMVNNFOHFOEBMJLBONPUPTJLBMJOJ.
#6,61"/%6"/1&.*-*,
YZF155
B2S-F8199-30
EAU46091
EAU46091
EAU46091
B2S
Pengenalan
Selamat datang ke dunia motosikal Yamaha!
Sebagai pemilik YZF155, anda mendapat manfaat daripada pengalaman luas Yamaha dan teknologi terbaru mengenai
reka bentuk dan pembuatan produk berkualiti tinggi, yang telah diperolehi Yamaha reputasi untuk dipercayai.
Sila luangkan masa untuk membaca manual ini dengan teliti, supaya dapat menikmati semua kelebihan YZF155 anda.
Manual Pemilik tidak hanya mengajar kepada anda bagaimana untuk mengendalikan, memeriksa dan mengekalkan moto-
sikal anda, tetapi juga dalam bagaimana untuk melindungi diri anda dan lain-lain dari masalah dan kecederaan.
Di samping itu, banyak tips diberikan dalam manual ini akan membantu untuk menjaga motosikal anda dalam keadaan
yang terbaik. Jika anda mempunyai sebarang pertanyaan lanjut, hubungi wakil pengedar Yamaha anda.
Pasukan Yamaha mendoakan semoga perjalanan anda selamat dan menyeronokkan. Oleh tu, ingatlah untuk meng-
utamakan keselamatan!
Yamaha secara berterusan mencari kemajuan dalam reka bentuk produk dan kualiti. Oleh itu, sementara manual ini mengan-
dungi maklumat produk terkini yang ada pada masa percetakan, mungkin terdapat perbezaan kecil antara motosikal anda
dan manual ini. Jika ada apa-apa soalan mengenai manual ini, sila berunding dengan peniaga Yamaha.
AMARAN
Sila baca buku panduan ini dengan teliti dan lengkap sebelum mengendalikan motosikal ini.
MAKLUMAT PENTING PEMANDUAN
Maklumat penting di dalam buku panduan pemilik ini dapat dikelaskan dengan simbol seperti berikut:
Ini simbol keselamatan berjaga-jaga. Untuk memberitahu mengenai kemungkinan risiko

kemalangan. Patuhi semua mesej yang mempunyai simbol ini untuk mengelak daripada
kemalangan atau kematian.
AMARAN menandakan risiko di mana, jika tidak dielak, mungkin akan menyebabkan
AMARAN kematian atau kecederaan serius.
PERHATIAN menandakan tindakan berjaga-jaga yang perlu diambil untuk mengelak

PERHATIAN kerosakan pada motosikal dan harta benda lain.
TIP TIP memberikan informasi untuk menjadikan prosedur lebih senang dan mudah difahami.
*Produk dan spesifikasi adalah tertakluk kepada perubahan tanpa notis.

MAKLUMAT PENTING PEMANDUAN
EAUV0012
YZF155
BUKU PANDUAN PEMILIK
@Cetakan June 2018
Hak cipta terpelihara.
Sebarang pencetakan semula atau
penggunaan tanpa kebenaran bertulis
daripada Yamaha Motor Co., Ltd.
adalah dilarang sama sekali.
Dicetak di Malaysia
Isi Kandungan
Lokasi label utama .......................1-1 Untuk keselamatan anda - Jarak bebas injap.........................7-17
pemeriksaan sebelum kendalian... 5-1 Tayar............................................7-18
Maklumat keselamatan .................2-1 Roda............................................ 7-19
Cara penunggangan yang Operasi dan panduan penting Penyelarasan gerak bebas tuil
selamat .....................................2-5 penunggangan .................................6-1 klac........................................... 7-20
Memeriksa pelapik brek hadapan
Topi keledar ................................2-6 Menghidupkan enjin.......................6-1
dan gesel brek belakang ........... 7-21
Penukaran gear............................ 6-2
Memeriksa paras cecair brek .......... 7-21
Keterangan ....................................3-1 Tip mengurangkan penggunaan
Menukar cecair brek ........................7-23
Pandangan kiri ............................3-1 bahan api ................................... 6-3 Kekenduran rantai pemacu..............7-23
Pandangan kanan .......................3-2 Enjin berjalan dengan perlahan.... 6-3 Melaras kekenduran rantai pemacu.7-23
Alatan dan kawalan ....................3-3 Meletakkan motosikal .................. 6-4 Mencuci dan melincirkan rantai
Catatan am .................................. 6-5 pemacu.............................................7-25
Alatan dan fungsi kawalan ...........4-1 Memeriksa dan melincirkan
Suis utama/kunci stering..............4-1 Penyelenggaraan berkala dan kabel ..............................................7-25
Penutup lubang kunci...................4-2 penyelarasan ...................................7-1 Memeriksa dan melincirkan
Lampu penunjuk dan lampu Beg alat pemilik............................. 7-1 cengkaman pendikit dan kabel .....7-25
lamaran .....................................4-3 Carta penyelenggaraan berkala Memeriksa dan melincirkan pedal
Unit meter pelbagai fungsi...........4-4 untuk sistem kawalan emisi ........ 7-2 brek dan peralihan.........................7-26
Suis handel .................................4-11 Penyelenggaraan am dan carta Melincirkan bahagian belakang
pelinciran......................................7-3 dan belakang brek........................7-26
Tuil klac....................................... 4-12
Menanggal dan memasang panel. 7-8 Memeriksa dan melincirkan tongkat
Pedal penukaran......................... 4-12
Pemeriksaan palam pencucuh...... 7-10 sisi ..................................................7-27
Tuil brek.......................................4-13
Minyak enjin dan penapis Pelinciran pangsi membelok (Swing
Penutup tangki bahan api............ 4-13
minyak..........................................7-11 arm pivots)........................................7-27
Bahan api.....................................4-14 Cecair penyejuk............................. 7-14 Memeriksa cabang depan................7-28
Penukar pemangkin.....................4-15 Penapis udara dan elemen bekas Memeriksa stering ...........................7-28
Tempat duduk .............................4-16 penapis udara V belt....................7-15 Memeriksa galas-galas roda............7-29
Pemegang topi keledar................4-17 Menyesuaikan kelajuan enjin Bateri ............................................... 7-29
Tongkat sisi..................................4-18 melahu........................................7-16 Menukar fius.....................................7-30
Sistem pemotongan litar Pemeriksaan gerak bebas kabel
pencucuhan............................... 4-18 pendikit...........................................7-17
Isi Kandungan
Lampu.............................................. 7-31
Menukar mentol bantuan................. 7-31
Lampu belakang/brek...................... 7-31
Menukar lampu isyarat.....................7-32
Penahan pada motosikal..................7-32
Roda depan......................................7-32
Roda belakang................................. 7-33
Penyelesaian masalah......................7-35
Carta penyelesaian masalah ........... 7-37
Penjagaan motosikal dan

penyimpanan.......................................8-1
Amaran pada warna malap...................8-1
Penjagaan ..................................8-1
Penyimpanan..............................8-3
Speksifikasi ........................................9-1
Maklumat pengguna ......................... 10-1

Maklumat pengguna ....................... 10-1
Nombor pengenalan ....................... 10-2
Indexs.................................................. 11-1
Lokasi Label Utama
1 Baca dan fahami semua label pada motosikal. Ia mengandungi maklumat penting mengenai keselamatan dan cara
pengendalian motosikal yang betul. Jangan tanggalkan mana-mana label pada motosikal anda. Jika label menjadi sukar
untuk dibaca atau tercabut, penggantian label boleh diperolehi daripada wakil Yamaha.
1 2 3
1-1
Lokasi label penting
1 2
AMARAN
Sebelum anda mengen-
dalikan kenderaan ini,
baca manual pemilik. 100kPa=1bar kPa, psi kPa, psi
LIMIT LOAD 225, 33 220, 36

Cangkuk: 1Kg Seat Box: 1Kg
Kotak Depan: 1kg 225, 33 250, 36
1-2
Maklumat keselamatan
EAU1026B
z Jangan sekali-kali mengendalikan keadaan yang mudah dilihat untuk
motosikal tanpa latihan atau arahan mengelakkan kemalangan.
Jadilah penunggang yang bertang- yang betul. Ikuti kursus latihan. Oleh itu:
2 gungjawab Pelatih harus menerima latihan dari- t Pakai jaket yang berwarna terang.
Sebagai pengguna motosikal, anda ber- pada jurulatih bertauliah. Hubungi t Lebih berhati-hati apabila meng-
tanggungjawab ke atas keselamatan dan wakil penjual motosikal yang sah hampiri atau melalui simpang, me-
pengendalian motosikal yang betul. untuk mengetahui tentang kursus mandangkan persimpang adalah
Motosikal adalah kenderaan satu trek. latihan yang berhampiran anda. tempat yang sentiasa berlakunya
Keselamatan dan pengendalian motosikal kemalangan motosikal.
bergantung kepada teknik penunggangan Penunggangan selamat t Menunggang diruang yang dapat
yang betul dan juga kemahiran penung- Lakukan pemeriksaan sebelum kendalian dilihat oleh pemandu kenderaan.
gang. Setiap penunggang motosikal harus setiap kali ingin menggunakan motosikal Elakkan daripada menunggang di-
tahu keperluan seperti berikut sebelum untuk memastikan ianya selamat dikenda- ruang yang terhalang daripada pe-
menunggang motosikal. likan. Kegagalan untuk memeriksa dan me- mandangan pemandu kenderaan.
Anda perlu: ngekalkan motosikal dalam keadaan baik t Jangan sekali-kali menyenggarakan
z Memperoleh arahan yang lengkap memungkinkan kemalangan atau kerosak- motosikal tanpa pengetahuan yang
dari sumber yang betul dalam semua an peralatan. Lihat muka surat 5-1 untuk cukup. Hubungi wakil penjual moto-
aspek pengendalian motosikal. senarai pemeriksaan sebelum kendalian. sikal yang sah untuk memaklumkan
z Sentiasa berwaspada dengan tanda z Motosikal ini direka untuk membawa kepada anda tentang asas penye-
amaran dan keperluan penjagaan di penunggang dan penumpang. lenggaraan motosikal. Penyeng-
dalam buku panduan. z Kegagalan pemandu kenderaan untuk garaan tertentu hanya boleh dilaku-
z Memperoleh latihan dalam teknik pe- mengesan dan mengenalpasti pe- kan oleh kakitangan yang diperakui.
nunggangan yang betul dan selamat. nunggang motosikal adalah punca
z Kebanyakan kemalangan melibatkan
z Memperoleh servis teknikal yang pro- utama kemalangan kenderaan/moto-
fesional seperti yang ditunjukkan di penunggang yang tidak berpengalam-
sikal. Kebanyakan kemalangan di-
dalam buku panduan dan/atau apa- an. Pada hakikatnya, kebanyakan pe-
sebabkan pemandu kenderaan yang
bila perlu dibuat mengikut keadaan nunggang yang terlibat dalam kema-
tidak perasan kewujudan motosikal.
mekanikal. langan tidak mempunyai lesen me-
Pastikan anda menunggang dalam
nunggang motosikal.
2-1
t Pastikan bahawa anda berkelayakan z Cara duduk tubuh badan penunggang z Sentiasa memakai topi keledar yang
dan meminjamkan motosikal hanya dan penumpang adalah penting untuk diluluskan.
kepada pengendali yang berkelayak- kawalan yang betul. z Memakai pelindung muka atau kaca
an sahaja. t Penunggang harus sentiasa mene- mata. Angin yang masuk ke dalam mata 2
t Ketahui kemahiran dan had anda. tapkan kedudukan kedua-dua tangan tanpa pelindungan boleh mengaburi
Mengekalkan had anda akan dapat di handel bar dan kedua-dua kaki penglihatan daripada melihat keadaan
mengelakkan diri dari kemalangan. di tempat rehat kaki penunggang yang berbahaya.
t Kami mengesyorkan bahawa anda semasa pengedalian untuk menge- z Penggunaan jaket, but yang berat, seluar
berlatih menunggang motosikal anda kalkan kawalan motosikal. panjang, sarung tangan, dan lain-lain
di mana tiada lalu lintas sehingga t Penumpang harus sentiasa meme- adalah berkesan untuk mengelakan atau
anda menjadi begitu biasa dengan gang penunggang, tali tempat duduk mengurangkan calar atau luka.
motosikal dan semua kawalannya. atau palang pemegang, jika ada, z Jangan memakai pakaian yang longgar,
z Kebanyakan kemalangan yang berlaku dengan kedua-dua tangan dan ke- ianya boleh mempengaruhi kawalan tuil,
disebabkan kesilapan penunggang dua-dua kaki sentiasa letak di atas kedudukan kaki, atau roda dan akan
motosikal. Kesalahan yang sering di- tempat rehat kaki penumpang. menyebabkan kecederaan atau kema-
lakukan oleh penunggang motosikal Jangan memulakan perjalanan se- langan.
ialah mengubah haluan dari jarak jauh hingga penumpang meletakkan kaki z Sentiasa memakai pakaian yg dapat
dengan membelok dengan kelajuan di tempat rehat kaki dengan kemas. melindungi kaki, buku lali dan tapak kaki.
tinggi atau di luar kawalan (tidak cukup z Jangan menunggang di bawah pe- Enjin dan ekzos akan menjadi panas
kecondongan sudut dalam kelajuan). ngaruh alkohol atau dadah. apabila atau selepas motosikal diguna-
t Sentiasa mematuhi had laju dan z Motosikal ini direka untuk kegunaan kan dan boleh menyebabkan melecur.
jangan memandu dengan kelajuan di jalan raya sahaja. Ia tidak sesuai z Penumpang juga haruslah mematuhi
lebih daripada yang dibenarkan di untuk kegunaan di luar jalan raya. arahan keselamatan di atas.
jalan raya dan keadaan lalu lintas. Pemakaian Perlindungan
Elakkan Keracunan Karbon Monoksida
t Sentiasa memberikan lampu isyarat Kebanyakan kematian yang berlaku dalam
Semua enjin ekzos mengandungi karbon
sebelum membelok atau menukar kemalangan motosikal adalah disebabkan
monoksida, gas maut. Menyedut karbon
laluan. Pastikan pemandu lain boleh oleh kecederaan pada bahagian kepala.
monoksida boleh menyebabkan sakit ke-
melihat anda. Penggunaan topi keledar keselamatan ada-
pala, pening, mengantuk, loya, kekeliruan,
lah satu faktor penting dalam mengelakkan
dan akhirnya kematian.
atau mengurangkan kecederaan kepala.
2-2
Karbon Monoksida adalah tidak berwarna, Bebanan pengagihan berat di antara kedua-dua
tidak berbau, gas tanpa rasa yang mungkin Penambahan aksesori atau muatan pada belah sisi motosikal anda adalah seim-
hadir walaupun jika anda tidak melihat atau motosikal boleh menjejaskan kestabilan bang untuk mengurangkan ketidakse-
menghidu mana-mana ekzos enjin. Tahap dan kawalan jika berat pengagihan moto- imbangan atau kestabilan.
2
bahaya karbon monoksida boleh meningkat sikal berubah. Untuk mengelak kemung- Penukaran berat boleh membuatkan
dengan cepat dan boleh menyebabkan kinan berlaku kemalangan, berhati-hati ketidakseimbangan secara tiba-tiba.
kehilangan kawalan diri dalam masa yang semasa menambah muatan atau aksesori z Pastikan aksesori dan muatan diletak-
singkat. Tahap bahaya karbon monoksida pada motosikal anda. Lebih berhati-hati kan dengan cara yang selamat pada
juga boleh berlarutan untuk beberapa jam semasa menunggang motosikal yang telah motosikal sebelum dikendalikan. Sen-
atau hari di kawasan tertutup atau kurang ditambah muatan atau aksesori. tiasa periksa ikatan kesemua aksesori
pengudaraan yang baik. Jika anda menga- Di sini, bersama-sama maklumat mengenai dan muatan.
lami sebarang gejala keracunan karbon aksesori di bawah, adalah beberapa garis t Melaras suspensi bersesuaian de-
monoksida, tinggalkan kawasan itu serta- panduan umum untuk diikuti jika menam- ngan berat muatan (hanya model
merta, dapatkan udara yang segar, dan bahkan muatan pada motosikal anda: suspensi boleh laras) dan periksa
DAPATKAN RAWATAN PERUBATAN. Jumlah berat pengendali, penumpang, tekanan angin dan keadaan tayar.
z Jangan hidupkan enjin dalam bangunan. aksesori dan muatan tidak boleh melebihi t Jangan letakkan sesuatu yang besar
Walaupun anda cuba untuk mengalih berat maksimum yang telah ditetapkan. atau berat pada handel bar, cabang
udara ekzos enjin dengan kipas atau Pengendalian yang melebihi muatan hadapan, atau alas geseran hadap-
membuka tingkap dan pintu, karbon kenderaan akan menyebabkan kema- an. Kesemua alatan ini, termasuk
monoksida dengan cepat boleh men- langan. muatan seperti beg tidur, beg ber-
jangkau tahap berbahaya. bulu tebal, atau khemah, boleh men-
Beban maksimum: jadikan ketidakstabilan pengawalan
z Jangan hidupkan enjin di dalam ruang
168 kg (370 lb) atau tindakbalas pemanduan yang
yang mempunyai pengudaraan yang
lemah dan kawasan yang separa ter- Apabila membawa muatan dengan berat perlahan.
yang ditetapkan, sentiasa mengikuti arahan z Kenderaan ini tidak direka untuk
tutup seperti bangsal, tempat simpan
berikut: menarik kenderaan lain atau dipa-
kereta, atau port kereta.
sang kereta penumpang di sebelah.
z Jangan hidupkan enjin di kawasan z Berat muatan dan aksesori sepatutnya
luar yang boleh menyebabkan asap dikekalkan rendah dan dekat dengan Alatan Tambahan Tulen Yamaha
ekzos memasuki bangunan melalui motosikal seboleh mungkin. Pastikan Pemilihan alatan tambahan untuk moto-
tingkap ataupun pintu. sikal anda adalah keputusan yang penting.
2-3
Alatan tambahan tulen yang hanya pada kematian pada penunggang dan orang lain. nolak motosikal menjadikan ianya
wakil Yamaha telahpun direka, diuji dan Anda bertanggungjawab pada kecederaa- hilang kestabilan. Aksesori ini juga
diluluskan oleh Yamaha untuk kegunaan an berkenaan berikutan pengubahsuaian akan menyebabkan motosikal hilang
motosikal anda. pada motosikal. keseimbangan sekiranya memotong 2
Banyak syarikat yang tiada jalinan antara Ingat panduan berikut dan juga yang telah atau dipotong oleh kenderaan besar.
Yamaha mengeluarkan komponen dan diberikan pada bahagian ‘Bebanan’ apabila t Sesetengan aksesori menyebabkan
alatan tambahan atau memberikan pengu- memasang alatan tambahan. penunggang berada pada posisi
bahsuaian pada motosikal Yamaha. z Jangan memasang alatan tambahan tunggangan yang tidak sepatutnya.
Yamaha tidak akan menguji terlebih dahulu atau membawa muatan yang boleh Ketidaksesuaian ini menghadkan
produk yang dikeluarkan oleh syarikat lain. menjejaskan prestasi motosikal. Ber- pergerakan penunggang, oleh itu,
Oleh itu, Yamaha tidak menggalakkan pe- hati-hati memeriksa alatan tambahan aksesori seperti itu tidak digalakkan.
masangan alatan ataupun pengubahsuai- sebelum menggunakannya untuk me-
z Berhati-hati semasa memasang akse-
an motosikal yang tidak dikeluarkan dan mastikan ianya tidak menghalang ke-
sori elektrikal. Jika aksesori elektrikal
dijual oleh Yamaha, walaupun ia dijual dan lancaran apabila di selekoh dan jalan
ini melangkaui kapasiti sistem elektrikal
dipasang oleh wakil Yamaha. lurus, had suspensi dalam perjalanan
motosikal, akan menyebabkan ke-
jauh, pergerakan stering atau pengen-
Barangan Selepas Pasaran, Alatan gagalan elektrik, di mana kegagalan
dalian kawalan atau kemalapan lampu
Tambahan dan Pengubahsuaian lampu berfungsi atau kuasa enjin
dan pemantul cahaya.
Anda akan dapat jumpa produk-produk mungkin terjadi.
barangan selepas pasaran yang seakan-
t Aksesori yang dipasang pada handel
bar ataupun cabang hadapan men- Barangan Selepas Pasaran Tayar dan
akan sama bentuk dan kualiti dengan alat-
jadikan motosikal tidak stabil dise- Rim
an tambahan tulen Yamaha, menyedari se-
babkan pengagihan beban atau daya Tayar dan rim yang dibekalkan dengan
setengah alatan tambahan selepas pasaran
gerak udara berubah. Jika aksesori motosikal adalah direka untuk kemam-
atau pengubahsuaian tidak sesuai disebab-
dipasang pada handel bar atau pada puan dan prestasi untuk memberikan
kan oleh risiko keselamatan kepada pe-
cabang hadapan seharusnya tidak kombinasi terbaik dalam pengendalian.
nunggang atau orang lain. Memasang produk
mempunyai berat yang berlebihan. Tayar lain, rim, saiz dan kombinasi mungkin
selepas pasaran ataupun membuat modi-
fikasi pada motosikal yang mengubah bentuk
t Aksesori yang besar dan banyak akan tidak tepat. Lihat halaman 7-18 untuk
memberi kesan yang serius dalam spesifikasi tayar dan maklumat lebih lanjut
dan pengendalian motosikal boleh menda-
kestabilan motosikal disebabkan oleh tentang penggantian tayar.
tangkan risiko yang tinggi untuk cedera atau
daya gerak udara. Udara akan me-
2-4
Memindahkan Motosikal Cara penunggangan selanjutnya Sentiasa pakai topi keledar, sarung
Pastikan anda mematuhi arahan berikut Pastikan anda memberikan signal yang tangan, seluar panjang (di ikat pada peng-
sebelum memindahkan motosikal di dalam jelas sebelum membelok. hujung kaki supaya tidak mengibas), dan
2 kenderaan lain. Membrek pada keadaan jalan basah boleh menggunakan warna jaket yang terang
z Tanggalkan semua barangan yang menjadi terlalu sukar. Elakkan membrek Jangan membawa muatan yang terlalu
mudah tercabut dari motosikal. secara mengejut kerana motosikal akan berat menggunakan motosikal kerana
z Periksa bahawa picu bahan api (jika tergelincir. Membrek secara perlahan- muatan yang berlebihan menjadikan
dilengkapi) adalah dalam “OFF” dan lahan apabila berada di jalan basah. motosikal tidak stabil. (Lihat m/s 2-3).
bahawa tiada kebocoran bahan api. Perlahankan motosikal apabila berha-
z Tukarkan transmisi dalam gear (untuk dapan dengan selekoh. Setelah mengambil
model dengan transmisi manual). selekoh, pecut secara perlahan-lahan.
z Memastikan motosikal dalam keadaan Berhati-hati apabila melintasi kenderaan
selamat dengan mengikat “tie-downs” yang sedang berhenti. Pemandu mungkin
atau tali yang sesuai yang melekat pada tidak dapat melihat anda lalu terus mem-
bahagian pejal motosikal, seperti kerangka buka pintu pada laluan anda.
atau atas cabang hadapan pengapit
Lintasan landasan, laluan kenderaan, plat
bertiga (dan tidak, sebagai contoh, pada
besi pada jalan dikawasan pembinaan dan
getah yang dipasang pada pemegang
penutup lubang kabel pada jalan men-
atau isyarat membelok, atau bahagian
jadikan jalan amat licin semasa basah.
yang boleh pecah). Pilih lokasi untuk
Perlahankan motosikal dan melaluinya
mencengkam yang tidak akan berge-
sel permukaan yang dicat semasa dengan berhati-hati. Pastikan motorsikal
mengangkut. berkeadaan tegak, jika tiada ia akan
z Suspensi itu hendaklah dimampatkan tergelincir.
sedikit oleh “tie downs”, jika boleh, Pad brek mungkin akan basah jika anda
supaya motosikal tidak akan melantun membasuh motosikal. Setelah mem-
berlebihan semasa proses pengang- basuh motorsikal, periksa brek sebelum
kutan. memulakan pemanduan.
2-5
EAUN0532
Helmet Penggunaan helmet yang betul
Penggunaan kenderaan ini tanpa
menggunakan helmet yang diluluskan
. akan meningkatkan peratusan meng- 2
alami kecederaan kepala atau kema-
tian jika terlibat dalam kemalangan.
Kebanyakkan pengguna motosikal
atau scooter mengalami kecederaan
kepala apabila terlibat dalam kema-
langan. Penggunaan helmet keselam- Jenis bertutup penuh: Gunakan untuk
atan dapat mengelak atau mengurang- pemanduan pada pertengahan kepada
kan kecederaan kepala. Penggunaan helmet yang salah
berkelajuan tinggi.
Sentiasa memilih helmet yang dilu-

luskan.
Sila berikan perhatian sepeti dibawah
apabila memilih helmet motosikal
Helmet itu haruslah mematuhi
piawai keselamatan “SIRIM”
Helmet itu haruslah bersesuaian
dengan saiz kepala pengguna.
Jangan mengenakan hentakan Jenis penuh: Gunakan hanya untuk
yang kuat pada helmet pemanduan pada kelajuan perlahan
Penggunaan helmet yang betul kepada pertengahan
Ikat tali topi keledar. Jika berlaku
kemalangan, peluang topi keledar
tertanggal adalah tipisa jika tali diikat.
2-6
Keterangan
Pandangan kiri
1,2 3 4 5 6 7
9 8
1. Lampu hadapan (m/s 7-31) 9. Pedal penukaran (m/s 4-12)
2. Lampu bantuan (m/s 7-31)
3. Penutup tangki bahan api (m/s 4-13)
4. Elemen penapis udara (m/s 7-15)
5. Battery (m/s 7-29)
6. Fius (m/s 7-30)
7. Pemilik alat kit (m/s 7-1)
8. Tongkat sisi (m/s 4-18)
3-1
Keterangan
EAU10421
Pandangan kanan
1 2 3
8 7 65 4
1. Lampu isyarat belakang (m/s 7-32)
2. Lampu belakang/brek (m/s 7-31)
3. Takungan cecair brek depan (m/s 7-21)
4. Lampu isyarat depan (m/s 7-32)
5. Penapis minyak enjin (m/s 7-11)
6. Dipstick (m/s 7-11)
7. Pedal brek (m/s 4-13)
8. Takungan cecair brek belakang (m/s 7-21)
3-2
Keterangan
1 2 3 4 5 6 7
1. Tuil brek belakang (m/s 4-12)

2. Suis kiri handel (m/s 4-11)
3. Unit meter pelbagai fungsi (m/s 4-4)
4. Suis utama / kunci stering (m/s 4-1)
5. Suis kanan handel (m/s 4-11)
6. Cengkaman pendikit (m/s 7-17)
7. Tuil brek depan (m/s 4-13)
3-3
Alatan dan fungsi kawalan
EAU68550
Suis utama / kunci stereng TIP Untuk mengunci stereng

t-BNQVNFUFSBLBOIJEVQCJMBLVODJ
ON diputarkan ke " ".
OFF t1BNCBIBOBQJCPMFIEJEFOHBSBQB 1 2
bila kunci diputarkan ke kedudukan
" ".
EAU10662
OFF 4
Semua sistem elektrik tidak aktif. Kunci
LOCK boleh dikeluarkan.
EWA10062
WARNING 1. Tekan.
Kawalan suis utama / kunci stereng 2. Putar.
Jangan sekali-kali menghidupkan
sistem pencucuhan dan pencahayaan,
kunci kepada "OFF" atau "LOCK" 1. Putar hendal sehingga ke
adalah digunakan untuk mengunci st-
semasa kenderaan sedang bergerak. sebelah kiri.
ereng. Kedudukan suis utama ditera-
Jika tidak, sistem elektrik akan di- 2. Dengan kunci dalam kedudukan
ngkan di bawah.
matikan, yang boleh menyebabkan " ", tolak kunci masuk dan putar-
kehilangan kawalan atau kemalan- kannya " ".
TIP 3. Keluarkan kekunci.
gan.
Suis utama dilengkapi dengan shutter
lubang kunci. Lihat halaman 4-2 untuk EAU10686 TIP
arahan bagaimana untuk membuka LOCK Jika stereng tidak akan dikunci, cuba
dan menutup shutter lubang kunci. Stereng dikunci dan semua elektrik beralih hendal belakang ke kanan sed-
EAUU1055
sistem mati. Kunci boleh dikeluarkan. ikit.
(on)
Semua litar elektrik dibekalkan dengan
kuasa, dan enjin boleh dimulakan.
kunci tidak boleh dikeluarkan. 4-1
EAUU0820
Untuk membuka kunci stereng Untuk menutup penutup lubang kunci
Penutup lubang kunci
2
4 1. Kunci pencucuhan
1. Tekan 2. Kunci keselamatan
2. Putar Masukkan kepala kunci ke dalam luba-
Untuk membuka penutup lubang kunci ng kunci meliputi bekas seperti yang
Menolak kunci dalam, dan kemudian ditunjukkan, dan kemudian putar keku-
mengubahnya kepada "OFF" sema- nci ke kiri untuk menutup penutup.
sa masih menolaknya.
Masukkan kepala kunci ke dalam tempat

penutup lubang kunci seperti yang ditun-
jukkan, dan kemudian pusingkan kunci
ke kanan untuk membuka penutup.
4-2
Lampu penunjuk dan Lampu penunjuk pancaran tinggi “ ” mengikut suhu penyejuk di radiator.
Lampu penunjuk ini akan menyala apabi- t Jika enjin terlampau panas, lihat
amaran la pancaran tinggi lampu utama dinyala- halaman 7-38 untuk arahan selanj-
4 kan. utnya.
Lampu amaran suhu cecair penyejuk Lampu amaran masalah enjin “ ”
“ ” Lampu amaran ini akan menyala atau
3 5 Lampu amaran suhu cecair penyejuk akan berkelip jika masalah dalam litar elektrikal
2 6 menyala apabila enjin terlalu panas. Apa- pemantauan enjin dikesan. Jika ini ber-
1 4
bila ini berlaku, matikan enjin serta-merta laku, dapatkan peniaga Yamaha untuk
dan biarkan enjin itu sejuk. memeriksa sistem diagnosis diri.
Lampu amaran bagi litar elektrikal ini Lampu amaran bagi litar elektrikal ini
1. Lampu amaran masalah enjin " " dapat diperiksa dengan memusingkan dapat diperiksa dengan memusingkan
2. Lampu amaran suhu " " kunci ke arah “ON”. Lampu amaran ini kunci ke arah “ON”. Lampu amaran ini
3. Lampu penunjuk neutral " " harus menyala bagi beberapa saat, dan harus menyala bagi beberapa saat, dan
4. Lampu penunjuk gear penghantaran kemudian akan hilang.
kemudian akan hilang.
5. Lampu penunjuk isyarat " "
Jika lampu amaran tidak menyala pada Jika lampu amaran tidak menyala pada
6. Lampu penunjuk pancaran tinggi " "
mulanya semasa kunci diputarkan ke mulanya semasa kunci diputarkan ke
EAU11060
“ON”, atau jika lampu amaran sentiasa “ON”, atau jika lampu amaran sentiasa
Lampu penunjuk amaran “ ”
menyala, dapatkan pengedar Yamaha menyala, dapatkan pengedar Yamaha
Lampu penunjuk ini berlaku apabila untuk memeriksa litar elektrikal. untuk memeriksa litar elektrikal.
penghantaran berada dalam kedudu- Peralihan penunjuk cahaya
kan neutral. PERHATIAN
EAU11020
Lampu penunjuk ini boleh ditetapkan
Jangan biarkan enjin anda beroperasi untuk menghidupkan atau mematikan
Lampu penunjuk isyarat “ ” jika ia terlampau panas. pada kelajuan enjin yang diingini dan
Lampu penunjuk ini berkelip apabila berguna untuk memaklumkan penung-
giliran suis isyarat ditolak ke kiri TIP
gang berkenaan masa gear beralih ke
atau kanan. t Untuk kenderaan yang dilengkapi
radiator-fan, kipas radiator (s) seca- yang lebih tinggi pecutan. (Lihat halam-
ra automatik hidupkan atau matikan an 4-9 untuk perincian penjelasan cah-
4-3 aya penunjuk.)
Litar elektrik lampu amaran ini boleh Unit meter pelbagai fungsi AMARAN EWA12423
diperiksa dengan mengubah kunci pe-

nyalaan ke kedudukan " ". Lampu a- 7 6 Pastikan untuk berhentikan kenderaan
sebelum membuat apa-apa perubahan
maran tidak boleh menyala selama be-
tetapan unit meter pelbagai fungsi. Me-
berapa saat, kemudian matikan. Jika
ngubah tetapan semasa menunggang
lampu amaran tidak dinyalakan bila k- 5
4 boleh mengalih pandangan pengendali
unci pencucuhan sebaliknya meletakk- 8 dan meningkatkan risiko kemalangan.
an kedudukan " ", atau jika lampu a-
maran dihidupkan, tanya Yamaha pen- Unit meter pelbagai fungsi dilengkapi
iaga untuk memeriksa litar elektrik ke- 1 2 3 dengan yang berikut:
4 nderaan anda. t meter kelajuan
1. Butang “SELECT”
t meter bahan api
2. Butang “RESET” t VVA penunjuk
3. Meter kelajuan t takometer
4. Meter bahan api tpaparan gear penghantaran
5. Penunjuk VVA (variable valve actuation) t paparan pelbagai fungsi
6. Takometer tlampu penunjuk gear penghantaran
7. Paparan gear penghantaran talat diagnosis diri
8. Paparan pelbagai fungsi
Meter kelajuan
1
1. Meter kelajuan
4-4
Meter kelajuan menunjukkan kelaj- Penunjuk VVA Takometer
uan perjalanan kelajuan.
1 2
Meter bahan api
1
1. VVA (variable valve actuation) penunjuk 1. Takometer
2. Zon rpm tinggi
Model ini dilengkapi dengan pemboleh
Takometer membolehkan penunggang
ubah menggerakkan injap (VVA) untuk
1. Meter bahan api memantau kelajuan enjin dan memastikan
menjimatkan bahan api dan pecutan
Meter bahan api menunjukkan jumlah ia berada dalam julat kuasa yang ideal.
kelajuan rendah dan kelajuan tinggi. ECA10031
bahan api dalam tangki minyak. Seg- Penunjuk VVA menyala apabila sist-
men paparan meter bahan api yang em pemboleh ubah menggerakkan PERHATIAN
hilang dari 'F' (penuh) ke arah 'E' injap telah bertukar ke rangkaian kela- Jangan mengendalikan enjin di tac-
(kosong) sebagai bahan api tahap juan tinggi. hometer zon merah.
berkurangan. Apabila segmen terakhir Zon merah: 11500 r/min dan ke atas.
mula berkelip, mengisi minyak secepat
mungkin.
Apabila suis utama dihidupkan " ",
semua segmen paparan bahan api
meter akan muncul selama beberapa
saat, dan kemudian meter bahan api
menunjukkan tahap bahan api sebenar.
4-5
Paparan gear penghantaran Paparan pelbagai fungsi dilengkapi momod "TRIP F" dan mula mengira
dengan yang berikut: jarak perjalanan dari titik itu. Dalam kes
2
t odometer itu, tolak butang set kiri ke matikan p-
t dua tripmeter
t tripmeter rizab bahan api
aparan antara pelbagai tripmeter, od-
t jam ometer, seketika penggunaan bahan
1 t paparan penggunaan bahan api api dan bahan api purata mod pengg-
semasa unaan mengikut susunan berikut:
t penggunaan bahan api purata
Tekan butang set kiri untuk menukar
TRIP F JCLOCK Jkm/L atau L/100 km
paparkan antara mod odometer
1. Paparan gear penghantaran J AVE__._ km/L atau AVE_ _._ L/100 km
2. Lampu penunjuk neutral " " "ODO", mod tripmeter "TRIP 1" dan
4 J _ _km/h J ODO J TRIP 1 JTRIP 2
"TRIP 2", mod jam "_ _: _ _", serta
Paparan ini menunjukkan gear yang
merta mod penggunaan bahan api JTRIP F
dipilih. Kedudukan neutral ditunjukkan
"Km / L" atau "L / 100 km", purata b- Untuk menetapkan semula TripMeter,
oleh " " dan dengan lampu penunjuk
ahan api mod penggunaan "AVE_ _._
neutral. pilih ia dengan menolak butang "SEL-
km / L" atau "AVE_ _._ L / 100 km",
ECT", dan kemudian tekan butang
Paparan pelbagai fungsi kelajuan purata mod "AVE_ _._ km /
"RESET" sekurang-kurangnya satu sa-
h" dalam susunan berikut:
at. Sekiranya anda tidak menetapkan
semula perjalanan rizab bahan api me-
ODO J TRIP 1 J TRIP 2 JCLOCK
Jkm/L atau L/100 km J AVE_ _._ ter secara manual, ia semula semula
km/L atau AVE_ _._L/100 km J AVE secara automatik dan paparan kembali
_ _. _ km/L J ODO ke mod sebelum selepas mengisi min-
yak dan perjalanan 5 km.
Jika penunjuk amaran tahap bahan
1 api dan meninggalkan segmen awal
bahan api berkelip, paparan secara
1. Paparan pelbagai fungsi
automatik perubahan pada tripmeter
rizab bahan api
4-6
Mod odometer TripMeter menunjukkan jumlah jarak Untuk menetapkan jam
yang jalan sejak reset. 1. Tukar ke mod jam.
Untuk menetapkan semula tripmeter, 2. Semasa dalam mod jam, tolak bu-
tekan "RESET" butang sekurang-kur- tang "SELECT" dan "RESET" but-
angnya satu saat. ang bersama sekurang-kurangnya
dua saat.
TIP 3. Apabila digit jam mula berkelip,
t odometer akan mengunci di 999999 menggunakan 'RESET / SELECT'
dan tidak boleh ditetapkan semula. butang untuk menetapkan jam.
4. Tolak butang 'RESET / SELECT' 4
t TripMeter akan menetapkan semula
selama dua saat, dan minit
1. Odometer
dan terus mengira selepas 9999.9 akan mula berkelip.
adalah dicapai. Untuk menetapkan 5. Gunakan 'RESET / SELECT' butang
Odometer menunjukkan jumlah jarak untuk menetapkan minit.
semula TripMeter , tekan “RESET /
yang dilalui oleh kenderaan. Odometer 6. Tekan butang ''RESET / SELECT'
SELECT' selama satu saat.
tidak boleh diatur semula. selama dua saat untuk memulakan
jam.
Jam Paparan penggunaan segera bahan
Mod Tripmeter
api
1. Paparan penggunaan segara bahan api

1. Jam
1. Tripmeter Paparan penggunaan segera bahan api
Jam menggunakan sistem 12-jam. boleh ditetapkan sama ada kepada “km/L”,
“L/10 km” .
4-7
Penggunaan bahan api serta-merta pa- Purata mod penggunaan bahan api Untuk menetapkan semula penggunaan
paran boleh ditetapkan sama ada "km bahan api purata, tekan butang "RES-
/ L" dan "L / 100 km". ET" sekurang-kurangnya satu saat.
Untuk beralih antara seketika tetapan
TIP
paparan penggunaan bahan api, anta-
t Selepas menetapkan semula peng-
ra pusingan "km / L" dan "L / 100 km" gunaan bahan api purata paparan,
butang "RESET / SELECT" selama satu "_ _._" ditunjukkan untuk yang dipa-
saat. parkan sehingga kenderaan telah
t iLN-w+BSBLQFSKBMBOBOZBOHCPMFI mengembara 1 km. Mod pengguna-
dilalui pada 1.0 L bahan api di bawah an purata bahan api sebaiknya digu-
4 keadaan semasa penunggangan di- nakan sebagai rujukan am sahaja.
1. Purata mod penggunaan bahan api
tunjukkan.
Jangan gunakan ini untuk mengang-
t i-LNw+VNMBICBIBOBQJZBOH Paparan ini menunjukkan bahan api
garkan jarak boleh dicapai dengan
diperlukan untuk perjalanan 100 km purata penggunaan sejak ia ditetapkan
jumlah bahan api dalam tangki.
di bawah keadaan semasa penung- semula. Paparan penggunaan bahan
gangan ditunjukkan. api purata boleh ditetapkan sama ada Mod purata penggunaan bahan api
“km / L" atau "L / 100 km".
TIP
t Jika membuat perjalanan pada kela- tLN-+BSBLQVSBUBJUVCPMFI
juan bawah 10 km/j "_ _._" dipaparkan. dilalui 1.0 L bahan api ditunjukkan.
t Penggunaan bahan api serta-merta t-LN+VNMBIQVSBUBCBIBO
sebaiknya digunakan sebagai ruj- bakar yang diperlukan untuk per-
ukan am sahaja. Jangan gunakan jalanan 100 km ditunjukkan.
ini untuk menganggarkan jarak d- 1. Paparan purata penggunaan bahan api
apat dicapai oleh jumlah bahan
api dalam tangki.
4-8
Menunjukkan purata motosikal kelajuan s4ITIKPENGAKTIFANFUNGSIINIMEMBOL dipilih semasa lampu penunjuk
sejak kali terakhir ditetapkan berulang. ehkan anda memilih kelajuan enjin masih aktif.)
Untuk menetapkan semula paparan ke- di mana lampu penunjuk diaktifkan. s"ERKELIPLAMPUPENUNJUKBERKELIPAP
lajuan secara purata, tekan dan tahan s4ITIKPENOLAKANFUNGSIINIMEMBOLEHKAN abila diaktifkan. (Tetapan ini dipilih ap-
butang "RESET" sehingga kelajuan pur- anda memilih kelajuan mesin di mana abila lampu penunjuk berkelip empat
ata berkelip, kemudian tekan kunci lagi. lampu penunjuk dinyahaktifkan. kali sesaat.)
Lampu penunjuk shift s+ECERAHANFUNGSIINIMEMBOLEHKAN s-ATILAMPUPENUNJUKDIMATIKANDEN
anda melaraskan kecerahan lampu gan kata lain, tidak menyala atau ber-
penunjuk. kelip. (Tetapan ini dipilih apabila lampu 4
indikator berkelip sekali setiap dua sa-
Untuk menetapkan lampu penunjuk at.)
anjakan
1. Pusingan kunci pencucuhan ke ked- 4EKAN3%,%#4UNTUKMENGESAHKAN
udukan " ". corak sekelip yang dipilih. Lampu pe-
2. Tekan dan tahan butang "PILIH". nunjuk peralihan berubah kepada mod
1. Lampu penunjuk Shift
3. Hidupkan kunci pencucuhan ke ked- pengaktifan.
2. Paparkan pelarasan kecerahan udukan "", kemudian keluarkan buta-
NG3%,%#4SELEPASLIMASAAT3EL Tachometer akan menunjukkan seting
Lampu penunjuk peralihan mempunyai epas itu, tekan butang "PILIH" sekali kelajuan mesin untuk memasuki mod
empat tetapan laras. lagi. Lampu penunjuk peralihan kini titik pengaktifan dan titik penyahaktifan.
s#ORAKBERKELIPFUNGSIMEMBOLEHKAN boleh ditetapkan.
anda untuk memilih sama ada lampu Untuk menetapkan Titik tukar shift
penunjuk dihidupkan atau tidak dan Untuk menetapkan corak berkelip TIP
sama ada ia perlu berkelip atau kekal 1. Tekan butang "RESET" untuk memil- Titik pengaktifan lampu penunjuk pe-
apabila diaktifkan. ih salah satu daripada tetapan corak rubahan syif boleh ditetapkan antara
BERIKUT 9000 rpm dan 13000 rpm. Lampu pe-
s!KTIFLAMPUPENUNJUKMASIHAKTIF nunjuk boleh disesuaikan dengan ke-
apabila diaktifkan. (Tetapan ini naikan 250 rpm.
4-9
1. Tekan butang "RESET" untuk memilih Untuk melaraskan kecerahan
kelajuan enjin yang diingini untuk me- 1. Tekan butang "RESET" dan pilih tahap
ngaktifkan cahaya penunjuk. kecerahan cahaya penunjuk shift.
2. Tekan butang "SELECT" untuk meng- 2. Tekan butang "PILIH" untuk mengesa-
esahkan kelajuan mesin yang dipilih. hkan tahap kecerahan. Paparkan kelu-
Mod kawalan berubah ke mod tetapan ar dari cahaya kawalan peralihan dan
titik penonaktifan. kembali ke mod paparan pelbagai fun-
gsi standard
Untuk menetapkan titik penyahaktifan
Skrin Aluan 5. Tekan butang "SELECT" untuk satu
TIP
4 s0ETUNJUKTITIKPENUNJUKPELEPASANTUGAS Skrin selamat datang menyampaikan saat untuk mengesahkan watak ya-
boleh ditetapkan antara 9000 rpm dan kepada penunggang apabila kuncinya ng dipilih. Watak kedua akan mula
13000 rpm. Lampu penunjuk boleh di- dihidupkan dengan " " dengan mesej berkelip. Ulangi proses ini untuk se-
sesuaikan dengan kenaikan 250 rpm. "Buddy" dan "melihat anda" apabila ke- mua enam aksara. Selepas watak
s0ASTIKANUNTUKMENETAPKANTITIKPENY kuncinya ditukar kepada " ". Nama pe- keenam ditetapkan, semua aksara
ahaktifan kepada kelajuan enjin yang ngguna "Buddy" ditetapkan sebagai la- akan berkelip dua kali dan mod tet-
lebih tinggi daripada titik permulaan, ji- lai kilang, tetapi ia boleh ditetapkan pa- apan akan berakhir secara autom-
ka lampu penunjuk semasa peralihan da nama anda. atik.
tidak akan dihidupkan. Untuk menetapkan nama pengguna
1. Letakkan kunci kepada " ". Peranti diagnosis sendiri
2. Tekan dan tahan butang "RESET" Model ini dilengkapi dengan peranti diag-
1. Tekan butang "RESET" untuk memi- 3. Membuat kunci untuk " ", dan nosis diri untuk pelbagai litar elektrikal.
lih kelajuan enjin yang dikehendaki kemudian keluarkan butang "RE- Jika masalah dapat dikesan dalam mana
untuk mematikan lampu penunjuk. SET" selepas empat saat. litar, lampu amaran masalah enjin akan
4EKANBUTANG0),)(UNTUKMENGE 4. Apabila watak pertama mula berk- menyala dan paparan akan menunjukkan
sahkan kelajuan mesin yang dipilih. elip, tekan butang "RESET" untuk kod ralat.
Mod kawalan berubah kepada mod menukar watak dalam susunan
pelarasan kecerahan. berikut.
4-10
ECA11591
Suis lampu pancaran “ / ”
NOTIS Suis handel
Tetapkan suis ini ke “ ” untuk pancaran
Jika paparan menunjukkan kod ralat, Kiri tinggi dan ke “ ” untuk pancaran rendah.
kenderaan itu perlu diperiksa secepat Untuk memasang lampu, tekan sebelah
mungkin untuk mengelakkan kerosak- tukar "PASS" apabila lampu berada
an enjin. 1 digunakan sebagai cahaya yang rendah.
Suis isyarat membelok “ / ” 4

2
Untuk isyarat sebelah kanan, tekan suis ke
“ ”. Untuk isyarat sebelah kiri, tekan suis
3 ke “ ”. Apabila dilepaskan, suis kembali
ke kedudukan tengah. Untuk membatalkan
1. Suis lampu pancaran “ / / Pass” isyarat membelok, tekan suis ke dalam
2. Suis isyarat membelok “ / ” selepas ia telah kembali ke kedudukan
3. Suis hon “ ” tengah.
Kanan
Suis hon “ ”
1 Tekan suis ini membunyikan hon.
Berhenti dan Sistem Mula

suis “ A / A ”
Tetapkan suis ini sebelum " A " bermula
enjin. Tetapkan suis ini kepada " A " untuk
2 hentikan enjin sekiranya berlaku kecemasan,
seperti apabila kenderaan terbalik atau
3
apabila kabel pendikit terjebak.
1. Berhenti dan suis sistem penghidup “ / ”
2. Suis Hazard “ / ”
3. Suis penghidup “ ”
4-11
Suis penghidup “ ” Tuil klac Pedal penukaran
Tekan suis ini untuk mengengkol enjin
dengan penghidup. Lihat m/s 6-1 untuk
arahan permulaan sebelum menghidup-
kan enjin.
1
Suis lampu Bahaya “ / ”
Lampu bahaya (kedua-dua lampu pada
masa yang sama) digunakan dalam ke-
4 adaan kecemasan, sebagai contoh unt- 1
uk memberi amaran kepada pemandu 1. Tuil klac 1. Pedal penukaran
lain apabila perhentian motosikal anda
Tuas kopling terletak di sebelah kiri ge- Pedal anjakan terletak di sebelah kiri se-
di mana ia boleh membawa bahaya ke-
nggaman pegangan. Untuk melepaskan belah enjin dan digunakan dalam komb-
pada lalu lintas. Tetapkan butang ini ke-
klac, tarik tuil ke arah bar tangan cen- inasi dengan tuas kopling apabila beral-
pada " " untuk menghidupkannya cah-
gkaman. Untuk melibatkan klac, kelua- ih gear dari pemalar 6-kelajuan-pengha-
aya bahaya, tetapkan butang ke " ".
rkan tuil. Tuas itu mestilah ditarik den- ntaran muatan yang dilengkapi pada
gan cepat dan dikeluarkan dengan pe- motosikal ini.
rlahan operasi klac licin.
Tuil klac dilengkapi dengan suis klac,
yang merupakan sebahagian daripada
penyalaan sistem litar litar. (Lihat hala-
man 4-18.)
4-12
Tuil brek Pedal brek Penutup tangki bahan api
1 2
1
1 4
1. Tuil brek
1. Perlindungan kunci tangki minyak
Tuil brek hadapan terletak di sebelah
1. Pedal brek 2. Buka
kanan bar hendal. Untuk menggunakan
brek hadapan, tarik tuil ke arah pendikit Pedal brek berada di sebelah kanan Untuk mengeluarkan tukup tangki
dengan perlahan. motosikal. Untuk memohon belakang bahan api
brek, tekan ke atas pedal brek. 1. Buka tutup kunci penutup tangki ba-
han api.
2. Masukkan kekunci ke dalam kunci
dan putar 1/4 gilirannya mengikut a-
rah jam. Kunci akan dikeluarkan dan
tangki penutup bahan api boleh dik-
eluarkan.
Untuk memasang tukup tangki bahan
api
1. Tolak tutup tangki bahan api ke dalam
kedudukan dengan kunci dimasukkan
ke dalam kunci.
4-13
2. Hidupkan kunci lawan ke kedudu- 2
Bahan api
kan asal, dan kemudian keluarka- Pastikan gasolin di dalam tangki men- 1
nnya. cukupi.
3. Tutup penutup kunci. EWA10882
AMARAN
TIP Gasolin dan gas gasolin adalah sangat
Penutup tangki bahan api tidak boleh mudah terbakar. Untuk mengelak dari-
dipasang melainkan kunci berada dalam pada kebakaran atau letupan dan untuk ZAUE0019
kunci. Sebagai tambahan, kunci tidak mengurangkan risiko kecederaan se-
boleh dialih keluar jika tutup tidak dipa- masa mengisi bahan api, turuti arahan 1. Tuib pengisi tangki bahan api
4 2. Aras bahan api
sang dengan betul dan terkunci. berikut:
3. Lap secepat mungkin tumpahan
1. Sebelum mengisi minyak, matikan
EWA11092 bahan api. PERHATIAN : Secepat
dahulu enjin dan pastikan tiada se-
AMARAN mungkin lap tumpahan bahan api
siapa yang duduk di atas motosikal.
Pastikan penutup tangki bahan api dengan kain yang bersih, kering
Jangan mengisi bahan api semasa
ditutup dengan betul selepas mengisi kerana bahan api boleh merosak-
merokok, terdapat percikan atau api,
bahan api.Kebocoran bahan api adalah kan permukaan cat atau bahagian
ataupun punca-punca yang boleh
plastik. [ECA10072]
bahaya kebakaran. menyebabkan nyalaan api seperti
lampu pemanas air atau pengering 4. Pastikan penutup tangki bahan api
pakaian. ditutup rapat.
2. Jangan mengisi tangki bahan api ber- AMARAN
lebihan. Berhenti mengisi apabila bahan
api sampai ke bahagian bawah tiub Gasolin adalah bahan yang mengan-
pengisi. Ini kerana bahan api akan me- dungi racun yang boleh menyebabkan
ngembang apabila panas, haba dari kecederaan atau kematian. Gunakan ia
enjin atau matahari boleh menyebab- secara berhati-hati. Jangan masukkan
kan bahan api tumpah daripada tangki gasolin ke mulut. Jika anda tertelan
bahan api. atau terhidu gas gasolin yang banyak,
atau gasolin terkena mata, segera ber-
4-14
jumpa doktor anda. Jika gasolin terkena EAU13434 ECA10702
Penukar pemangkin PERHATIAN
kulit, basuh dengan menggunakan air
Model ini dilengkapi dengan penukar
dan sabun. Jika terkena pada pakaian, Gunakan hanya petrol tanpa plumbum.
pemangkin di dalam sistem ekzos.
tukar pakaian anda. Penggunaan petrol berplumbum akan
EWA10863
menyebabkan kerosakan yang tidak
AMARAN
boleh diperbaiki kepada penukar pe-
Sistem ekzos masih panas selepas mangkin.
pengendalian. Untuk mengelakkan
Bahan api yang disyorkan: bahaya kebakaran atau melecur:
Regular unleaded gasoline sahaja z Jangan meletakkan kenderaan di
Kapasiti tangki bahan api: sebelah sesuatu yang menyebabkan
11 L (2.9 US gal, 2.4 Imp.gal) bahaya kebakaran seperti rumput 4
Jumlah rizab bahan api: atau bahan lain yang mudah terbakar.
1.9 L (0.5 US gal) (0.4 Imp.gal) z Meletakkan kenderaan di tempat di
mana pejalan kaki atau kanak-kanak
tidak dapat menyentuh panas sistem
ekzos.
z Pastikan sistem ekzos telah sejuk
PERHATIAN sebelum melakukan sebarang kerja-
Gunakan hanya petrol tanpa plumbum. kerja penyelenggaraan.
Penggunaan petrol berplumbum akan z Jangan biarkan enjin terbiar lebih
menyebabkan kerosakan teruk kepada daripada beberapa minit. Membiar-
bahagian dalaman enjin, seperti injap kan terlalu lama boleh menyebab-
dan gelang omboh, serta sistem ekzos. kan pengumpulan haba.
4-15
Tempat duduk 2. Pasang tempat duduk dengan nut.
3. Pasang penutup plastik.
Tempat duduk penumpang 1 Tempat duduk penunggang

Untuk mengeluarkan tempat duduk
Untuk mengeluarkan tempat duduk penunggang
penumpang 1. Masukkan kekunci ke tempat duduk
1. Keluarkan penutup plastik utama, kemudian pusing mengikut
arah jam.
4 1. Nut
1
Untuk memasang tempat duduk 1
penumpang
1. Masukkan unjuran di hadapan dari
tempat duduk ke tempat duduk se-
2
bagai ditunjukkan.
1
1. Penutup plastik
2. Longgarkan nat, keluarkan temp-

1. Tempat duduk penunggang
at duduk seperti yang ditunjukkan. 2. Buka
Untuk memasang tempat duduk
penunggang
1. Masukkan unjuran di bahagian de-
2 pan dari tempat duduk ke tempat
duduk seperti yang ditunjukkan, me
1. Unjuran masang tempat duduk di kedudukan
2. Pemegang tempat duduk
asalnya.
4-16
1 Pemegang topi keledar EAU14326

1
1
2 2
4
1. Unjuran 1. Tempat duduk
2. Pemegang tempat duduk 2. Topi keledar
1. Pemegang topi keledar
2. Mengeluarkan kunci. Pemegang topi keledar berada di bawah Cara mengeluarkan topi keledar dari
TIP tempat duduk. pemegang topi keledar
Pastikan tempat duduk dipasang deng- Untuk meletakkan topi keledar kepada Buka tempat duduk, keluarkan topi keledar
an betul sebelum menunggang. pemegang topi keledar dari pemegang topi keledar, dan kemudian
tutup tempat duduk.
1. Buka tempat duduk (m/s 4-16)
2. Sangkutkan topi keledar di tempat
pemegang topi keledar, dan kemudian
tutup dan kuncikan tempat duduk.
AMARAN! Jangan menunggang
motosikal jika topi keledar berada
di tempat pemegangnya, topi kele-
dar mungkin akan terlanggar se-
suatu objek, menyebabkan hilang
kawalan dan mengakibatkan ke-
malangan. [EWA10162]
4-17
EAU15304 EAU44892
Tongkat sisi Sistem pemotongan litar

Tongkat sisi terletak pada bahagian kiri pencucuhan
bingkai. Naikkan tongkat tepi atau turun-
Sistem pemutus litar pencucuhan (ter-
kannya dengan kaki anda sambil meme-
diri daripada suis sidestand, klac suis
gang motosikal dengan tegak.
dan suis neutral) menghalang bermula
apabila transmisi masuk gear dan tuil
EWA10242
AMARAN klac tidak ditarik.
Kenderaan ini tidak boleh ditunggang Periksa pengendalian suis tongkat sisi
4 dengan tongkat sisi ke bawah, atau mengikut prosedur berikut.
jika tongkat sisi tidak betul-betul di-
naikkan (atau tidak sepenuhnya), jika TIP
_
tidak tongkat sisi boleh menyentuh Pemeriksaan adalah lebih meyakinkan

tanah dan mengalihkan perhatian pe- apabila dilakukan dalam keadaan enjin
ngendali, menyebabkan kemungkin- dipanaskan.
an hilangan kawalan.
4-18
Dengan enjin dimatikan: AMARAN

1. Pastikan suis mula/berhenti enjin ditetapkan ke " ".
2. Putar kunci kepada ON. t Jika kerosakan dikenalpasti, dapatkan peniaga
Yamaha untuk memeriksa sistem sebelum me-
3. Pindahkan transmisi ke kedudukan neutrral.
nunggang.
4. Tekan suis mula/hidupkan enjin.
Adakah enjin bermula?
Suis neutral mungkin tidak berfungsi dengan betul. 4
YA TIDAK motosikal tidak boleh ditunggang
sehingga diperiksa oleh peniaga Yamaha.
5. Matikan enjin
6. Pindah transmisi ke kedudukan gear.
7. Pastikan tuil klac ditarik.
8. Tekan suis mula/hidupkan enjin.
Adakah enjin bermula?
Suis klac mungkin tidak berfungsi dengan betul.
YA TIDAK motosikal tidak boleh ditunggang
sehingga diperiksa oleh peniaga Yamaha.
Sistem ini OK. Motosikal boleh ditunggang.
4-19
Untuk keselamatan anda - pemeriksaan sebelum kendalian
Periksa motosikal setiap kali digunakan untuk memastikan motosikal di dalam keadaan yang selamat digunakan.
Sentiasa mematuhi prosedur penyelanggaraan dan jadual yang disediakan di dalam Buku Panduan Pengguna.
AMARAN
Kegagalan untuk memeriksa dan menjaga motosikal dengan baik boleh meningkatkan kemungkinan kerosakan atau
kemalangan. Elakkan menggunakan motosikal jika terdapat kerosakan. Jika masalah itu tidak dapat dibetulkan meng-
5 gunakan prosedur yang disediakan di dalam buku panduan ini, dapatkan wakil Yamaha untuk pemeriksaan.
_
Sebelum menggunakan motosikal ini, periksa perkara-perkara berikut:

t Periksa paras bahan api di dalam tangki.

Bahan api t Tambah jika perlu. 4-14
t Periksa kebocoran bahan api.
t Periksa paras minyak dalam enjin.
Minyak enjin t Jika perlu, tambah minyak enjin yang disyorkan mengikut paras yang ditentukan. 7-11
s Periksa motosikal jika ada kebocoran.
t Periksa paras cecair penyejuk di dalam takungan.
Cecair Penyejuk t Jika perlu, tambahkan cecair penyejuk ke paras yang ditentukan. 7-14
t Periksa sistem penyejuk supaya tiada kebocoran..
s Periksa pengendalian.
s Jika brek terlalu lembut atau kenyal, dapatkan pemeriksaan daripada wakil Yamaha.
s Periksa kehausan pada pad brek hadapan.
Brek hadapan s Ganti jika perlu. 7-21, 7-21
s Periksa paras cecair brek dalam takungan.
s Jika perlu, tambah cecair brek yang disyorkan pada paras yang ditetapkan.
s Periksa sistem hidrolik jika ada kebocoran.
5-1
ITEM CH E CK S PAGE
s Periksa pengendalian.
s*IKABREKTERLALULEMBUTATAUKENYALDAPATKANPEMERIKSAANDARIPADAWAKIL9AMAHA
s+EHAUSANPADAPADBREK
Brek belakang s'ANTIKANJIKAPERLU 9-20, 9-21
s0ERIKSAPARASCECAIRBREKDALAMTAKUNGAN
s*IKAPERLUTAMBAHKANCECAIRBREKYANGDISYORKANPADAPARASYANGDITETAPKAN
s0ERIKSASISTEMHIDRAULIKUNTUKKEBOCORAN
t1FSJLTBPQFSBTJ
Klac t,BCFMQFMJODJSKJLBQFSMV
t1FSJLTBHFSBLCFCBTUVJM 7-20
t-BSBTLBOKJLBQFSMV
t1BTUJLBOCBIBXBPQFSBTJCFSKBMBOMBODBS 5
t1FSJLTBHFSBLCFCBTQFNFHBOHQFOEJLJU
Pemegang pendikit t+JLBQFSMV EBQBULBOXBLJM:BNBIBVOUVLMBSBTLBOHFSBLCFCBT MJDJOLBOLBCFM 7-17, 7-25
EBOQFNFHBOHQFOEJLJU
s 0ASTIKANPENGENDALIANLANCAR
Kabel kawalan 7-25
s ,INCIRKANJIKAPERLU
t1FSJLTBLFMPOHHBSBOSBOUBJ
Rantaian pemacu t-BSBTLBOKJLBQFSMV
t1FSJLTBLFBEBBOSBOUBJ 7-23, 7-25
t-JODJSLBOKJLBQFSMV
s 0ERIKSAJIKATERDAPATKEROSAKAN
s 0ERIKSAKEADAANTAYARDANKEDALAMANBUNGA
Roda dan tayar 7-18, 7-19
s 0ERIKSATEKANANUDARA
s "ETULKANJIKAPERLU
Brek dan pedal penukaran t1BTUJLBOPQFSBTJJUVMBODBS 7-26

t-JODJSLBOQBLTJQFEBMCSFLKJLBQFSMV
s 0ASTIKANPENGENDALIANLANCAR
Brek dan tuil klac 7-26
s -JODJSLBOQBLTJUVJMKJLBQFSMV
t1BTUJLBOPQFSBTJJUVMBODBS
Tongkat sisi t-JODJSLBOQBLTJKJLBQFSMV 7-27
5-2
ITEM CH E CK S PAGE
s Pastikan semua nat, bolt dan skru diketatkan dengan betul.

Pengikat chasis —
s Ketatkan jika perlu.
Alatan, lampu, lampu isyarat s Periksa pengendalian.

—
dan suis s Betulkan jika perlu.
5-3
Operasi dan panduan penting penunggangan
Menghidupkan enjin
#BDBCVLV1BOEVBO1FOHHVOBVOUVL Dalam usaha untuk memotong litar pen-
memahami lebih semua kawalan moto- NOTIS cucuhan sistem untuk membolehkan
sikal ini. Jika terdapat kawalan atau Jangan menunggang melalui air permulaan, salah satu syarat berikut
fungsi yang tidak difahami, dapatkan yang dalam, jika tidak enjin boleh mesti dipenuhi:
penerangan dari wakil yamaha. rosak. Elakkan dari lopak kerana t1FOHIBOUBSBOBEBMBIOFVUSBMLFEV
ia mungkin lebih dalam daripada dukan.
AMARAN yang dijangkakan. t1FOHIBOUBSBOBEBMBIEBMBNHFBS
Kegagalan untuk membiasakan diri dengan tuil klac ditarik ke atas. Lih-
dengan kawalan boleh menyebabkan at halaman 4-18 untuk maklumat
kehilangan kawalan, yang mana bo- lanjut.
leh menyebabkan kemalangan atau 1VTJOHBOLVODJLFQBEBEBO 6
kecederaan. pastikan bahawa suis berhenti en-
KJOEJUFUBQLBOLFQBEB-BNQV
amaran berikut dan lampu penun-
juk perlu dihidupkan beberapa sa-
at, kemudian pergi. NOTIS: Jika
amaran atau petunjuk cahaya
tidak pergi, tanya Yamaha peni-
aga untuk memeriksa elektrik
litar.
2. Tukar transimi ke kedudukan neut-
ral. Lampu penunjuk neutral seha-
rusnya hidup. Jika tidak, mintalah
bantuan wakil Yamaha untuk per-
iksa litar elektrik.
3. Mula enjin dengan menolak perm-
6-1
ulaan suis. Jika enjin gagal bermu- PERHATIAN
la, lepaskan suis mula, tunggu be-
Penukaran gear
tWalaupun transmisi berada digear n-
berapa saat, dan kemudian cuba
eutral, jangan tolak motosikal untuk
lagi. Setiap usaha harus sesingkat
6 jarak jauh mahupun enjin sudah dim-
yang mungkin untuk mengekalkan
5 atikan. Transmisi hanya akan dilincir-
kuasa bateri. Jangan cuba hidup- 4 kan ketika enjin sedang hidup. Pelin-
kan enjin lebih daripada 10 saat 3 ciran yang tidak mencukupi boleh
pada setiap percubaan. 2 merosakkan transmisi.
ECA11043 2 N
1 tSentiasa menggunakan sistem penc-
PERHATIAN 1 engkam semasa menukar gear bagi
Untuk memelihara hayat enjin, mengelakkan kerosakan dalam enjin,
jangan terlampau menekan kelajuan 1. Pedal penukaran
2. Posisi neutral
transmisi, dan “drive train”, yang tid-
6 ketika enjin masih sejuk ak direka untuk menahan kejutan pa-
Penukaran gear membolehkan anda me-
ngawal jumlah kuasa enjin yang sedia ada ksaan penukaran gear.
untuk mula berjalan, mempercepatkan,
mendaki bukit dan sebagainya.
Posisi gear ditunjukkan pada gambarajah
diatas.
TIP
Untuk menukar gear ke kedudukan neu-
tral, tekan pedal penukaran ke bawah
berulang kali sehingga mencapai peng-
hujung dan kemudian sedikit menaikka-
nnya.
6-2
Tip-tip menjimatkan 1600 km (1000 mi) dan seterusnya
Tempoh matang enjin Kenderaan ini kini boleh beroperasi
penggunaan bahan api Jangka masa 0 and 1600 km (1000mi) seperti biasa. ECA10271
Penggunaan bahan api bergantung adalah masa terpenting untuk hayat
kepada cara penunggangan. Di bawah motosikal. Dengan sebab itu, anda perlu PERHATIAN
adalah tip-tip menjimatkan peng- meneliti perkara-perkara di bawah se- tJauhi kelajuan enjin dari men-
gunaan bahan api:- baik mungkin.
capai ke zon merah tachometer.
Menukar gear dengan cepat, dan Memandangkan enjin masih baru,
t Jika sebarang masalah enjin
elakkan kelajuan enjin semasa jangan meletakkan beban berlebihan
telah berlaku sepanjang tem-
memecut. pada 1600 km (1000 batu) pertama.
poh matang enjin, dengan se-
Jangan memulas pendikit semasa Bahagian-bahagian di dalam enjin be-
gera meminta wakil pengedar
menurunkan posisi gear, dan elak- lum dapat memberi keserasian untuk
Yamaha memeriksa kender-
kan kelajuan enjin yang tiada pengoperasian yang cekap. Dalam ja-
aan tersebut. 6
beban pada enjin. ngkamasa ini elakkan penggunaan pe-
Matikan enjin daripada membiar- ndikit secara maksimum ataupun per-
kan enjin hidup dalam jangka kara-perkara yang boleh menyebab-
masa yang lama (seperti dalam kan enjin menjadi terlampau panas.
EAUM2012
kesesakan lalulintas, lampu
isyarat atau di tempat lintasan 0-1000 km (0-600 mi)
keretapi. Elakkan operasi panjang atas 5000
r/min. NOTIS: Selepas 1000 km (600
mi) dari operasi, minyak enjin mesti
ditukar dan kartrij penapis minyak
atau elemen diganti. [ECA11152]
1000-1600 km (600-1000 mi)

Elakkan operasi panjang atas 7500
r/min.
6-3
Meletakkan motosikal
Semasa meletakkan motosikal, matik-
an enjin dan keluarkan kunci dari suis
utama.
AMARAN
t Memandangkan enjin dan sistem
ekzos boleh menjadi panas,
letakkan motosikal di tempat yang
penjalan kaki atau kanak-kanak
tidak mudah tersentuh.
t Jangan letakkan motosikal anda
6 di tempat yang berbukit atau
tanah yang lembut, jika tidak
kenderaan anda mungkin tumba-
ng, meningkatkan risiko keboc-
oran bahan api dan kebakaran.
t Tidak meletakkan motosikal
berhampiran rumput atau lain-
lain bahan-bahan mudah ter-
bakar y ang m ung kin a k a n
terbakar.
6-4
Catatan Am
Banyak kebaikan yang dapat diperolehi daripada penggunaan dan penyelenggaraan sebuah motosikal yang betul.
1. PELANGGAN BOLEH MENGGUNAKAN SE- 2. MOTOSIKAL DAPAT MENGEKALKAN KEUPAYAAN

PENUHNYA POTENSI MOTOSIKAL YAMAHA PRESTASINYA UNTUK TEMPOH LEBIH PANJANG
Perbandingan keausan komponen-komponen mesin

(piston, ring piston , silinder, dsb.)
6
100% Dengan penyelenggaraan
Kondisi berfungsi
sempurna
Tanpa
penyelenggaraan
Jarak yang
ditempuh (km) Turun mesin, pengeboran silinder,
penggantian ring piston, dsb.
6-5
3. KOS BAHAN API DAN PERBELANJAAN PEM- 4. SEBUAH MOTOSIKAL BOLEH MENDAPAT PERMINTAAN
BAIKAN BOLEH DIMINIMUMKAN HARGA TINGGI APABILA IA DITUKAR BELI SEBAGAI
PRODUK TERPAKAI
Penggunaan bahan bakar
Dengan penyelenggaraan
100%
Tanpa
penyelenggaraan
6 Jarak yang ditempuh (km)
Perjalanan kos pelanggan

(kos bahan bakar plus kos penyelenggaraan dan perbaikan)
S Tanpa penyelenggaraan
Servis berat dengan kos
yang lebih mahal
Dengan penyelenggaraan
Jarak yang ditempuh (km)
6-6
EAU17246 EWA15123 EAU39692
Pemeriksaan berkala, penyelarasan, dan _

AMARAN Beg alatan pemilik
_
pelinciran akan memastikan kenderaan Matikan enjin ketika melakukan penye-

anda di dalam keadaan yang paling sela- lenggaraan melainkan jika ditetapkan.
mat dan paling berkesan. Keselamatan Enjin yang berfungsi mempunyai
adalah kewajipan pemilik/pengendali bahagian yang bergerak dapat
kenderaan. Perkara yang paling penting menangkap bahagian badan atau
pemeriksaan kenderaan, pelarasan, dan pakaian dan bahagian elektrik yang
pelinciran diterangkan pada halaman boleh menyebabkan renjatan atau
berikut. kebakaran.
Jarak masa diberikan dalam carta penye- Menghidupkan enjin ketika servis
lenggaraan berkala harus dianggap seboleh menyebabkan kecederaan 1. Beg alatan pemilik
bagai panduan umum di bawah keadaan mata, luka bakar, kebakaran atau
penunggangan biasa. Walau bagaimana- Beg alatan pemilik ini terletak di bawah
keracunan karbon monoksida - kerusi penumpang. (Lihat m/s 4-16.)
pun, bergantung kepada cuaca, kawasan, mungkin membawa kepada kema-
geografi lokasi, dan kegunaan individu, Maklumat servis termasuk buku panduan
tian. Lihat muka surat 2-2 untuk dan alatan yang disediakan dalam beg 7
jarak masa penyelenggaraan mungkin maklumat lanjut mengenai karbon
perlu dipendekkan. alatan pemilik bertujuan membantu anda
monoksida. di dalam melaksanakan penyelengg-
EWA10322 _
AMARAN araan dan pembaikan kecil. Bagaiman-

_
_
AMARAN EWA15461
apun, alat tambahan seperti tork sepa-
Kegagalan untuk mengekalkan kende- _
raan atau melaksanakan aktiviti penye- Cakera brek, angkup, dram, dan pelapik na juga perlu digunakan untuk kerja
lenggaraan tidak tepat boleh mening- boleh menjadi sangat panas semasa penyelenggaraan yang cekap.
katkan risiko kecederaan atau kematian digunakan. Untuk mengelakkan kem- TIP
_
semasa servis atau semasa gunakan ungkinan melecur, biarkan komponen Jika anda tidak mempunyai alat atau pe-
kenderaan. Jika anda tidak biasa dengan brek sejuk sebelum menyentuh mereka. ngalaman yang diperlukan untuk kerja
servis kenderaan, dapatkan pengedar tertentu, dapatkan wakil Yamaha untuk
Yamaha untuk melakukan servis. membantu anda.
7-1
Penyelenggaraan berkala dan penyelarasan
EAU46882
TIP
z Pemeriksaan tahunan wajib dilakukan setiap tahun, kecuali jika penyelenggaraan berdasarkan jarak kilometer
telah dilakukan.
z Dari 16000 km, ulangi jadual penyelenggaraan bermula dari 4000 km.
z Perkara yang bertanda “ * ” harus dilakukan oleh seorang wakil penjual Yamaha kerana memerlukan alat-alat khusus,
data dan kemahiran teknikal.
EAU46932
Carta penyelenggaraan berkala untuk sistem kawalan pelepasan

BACAAN ODOMETER (yang mana tiba dahulu)
PEMERIKSAAN ATAU KERJA 1000 km 4000 km 7000 km 10000 km 13000 km PEMERIKSAAN
NO. PERKARA
PENYELENGGARAAN atau atau atau atau atau TAHUNAN
1 bulan 4 bulan 7 bulan 10 bulan 13 bulan
7
t Periksa hos bahan api bagi
1 * Saluran bahan api √ √ √ √ √
kebocoran dan kerosakan.
t Periksa keadaan.
2 * Penapis bahan api t Gantikan jika perlu. Setiap 12000 km (7500 mi)
t Periksa keadaan.
t Bersih dan laraskan jarak. √ √ √ √
3 Palam pencucuh
t Gantikan. Setiap 8000 km (5000 mi)
t Periksa gerak bebas injap.
4 * Injap t Laraskan. Setiap 10000 km (6200 mi)
5 * Penyuntik bahan api t √ √ √ √ √

t Periksa untuk kebocoran.
6 * Sistem ekzos t Ketatkan jika perlu. √ √ √ √ √
t Gantikan gasket jika perlu.
7-2
EAUN0284
Penyelenggaraan am dan carta pelinciran

NO. PERKARA
t.FMBLTBOBLBOQFNFSJLTBBOEJOBNJL
Pemeriksaan
1 * menggunakan alat diagnostik Yamaha. √ √ √ √ √ √
Sistem diagnostik
t4FNBLLPESBMBU
t Bersihkan. √ √ √ √ √
2 * Elemen penapis udara
t Gantikan. Setiap 10000 km (6200 mi)
t Periksa voltan.
3 * Bateri t Cas jika perlu. √ √ √ √ √ √
t1FSJLTBPQFSBTJ
4 * Klac t.FMBSBTLBO √ √ √ √ √
t 1FSJLTBPQFSBTJ QBSBTDFDBJSEBO 7
√ √ √ √ √ √
5 * Brek hadapan LFCPDPSBODFDBJSCSFL
t Gantikan pad brek. Apabila digunakan melebihi had
t4FNBLPQFSBTJ QBSBTDFDBJSEBO
LFOEFSBBOVOUVLLFCPDPSBODFD √ √ √ √ √ √
6 * Brek belakang air.
t Gantikan pad brek. Apabila digunakan melebihi had

t 1FSJLTBLFCPDPSBOBUBVLFSPTBLBO
t Periksa untuk laluan yang betul √ √ √ √ √
7 * Hos brek dan pengapit.
t Gantikan. Setiap 4 tahun
7-3
NO. PERKARA
8 * Cecair brek t (BOUJLBO Setiap UBIVO

9 * Roda t 1FSJLTBLFIBVTBOEBOLFSPTBLBO √ √ √ √ √
t 1FSJLTBLFEBMBNBOCVOHBUBZBS
EBOLFSPTBLBO
10 * Tayar t (BOUJLBOKJLBQFSMV √ √ √ √ √
t 1FSJLTBUFLBOBOVEBSB
t #FUVMLBOKJLBQFSMV
t 1FSJLTBLFMPOHHBSBOBUBV
11 * Galas roda √ √ √ √
LFSPTBLBOQBEBHBMBT
t1FSJLTBPQFSBTJEBOMFCJIBO √ √ √ √ √ √
12 * Swingarm LFMPOHHBSBO
7 t.FMJODJSLBOEFOHBOHSJTCFSBTBT
Setiap 12000 km (7500 mi)
LBOMJUIJVNTPBQ
t1FSJLTBSBOUBJLFOEVS QFOKBKBSBO
EBOLFBEBBO
13 Rantai penggerak t-BSBTLBOEBONFMJODJSLBOSBOUBJBO 4FUJBQLN LN
EBOTFMFQBTNFODVDJNPUPTJLBM NFOVOHHBOH
EFOHBOQFMJODJSSBOUBJLIBT0SJOH EBMBNIVKBOBUBVNFOVOHHBOHEJLBXBTBOCBTBI
EFOHBOUFMJUJ
t1FSJLTBNBJOCFBSJOHEBOTUFSFOH √ √ √ √ √
VOUVLLFLBTBSBO
14 * Galas stereng
t.FMJODJSLBOEFOHBOHSJTCFSBTBT
Setiap 12000 km (7500 mi)
LBOMJUIJVNTPBQ
7-4
NO. PERKARA
t Pastikan kesemua nat, bolt dan
15 * Pengetat chasis √ √ √ √ √
skru diikat dengan ketat.
16 Pangsi tuil brek t Lincirkan dengan gris silikon. √ √ √ √ √
17 Pangsi pedal brek t Lincirkan dengan gris silikon. √ √ √ √ √
18 Pangsi tuil klac t Lincirkan dengan gris silikon. √ √ √ √ √
Pangsi pedal t Lincirkan dengan gris yang

19 √ √ √ √ √ √
penukaran berasaskan lithium-soap.
t Periksa operasi.
7
20 Tongkat sisi t Lincirkan dengan gris yang √ √ √ √ √ √
berasaskan lithium-soap.
21 * Cabang depan t Periksa operasi dan kebocoran

√ √ √ √
minyak.
Pemasangan t Periksa operasi dan kebocoran
22 * √ √ √ √
penyerap hentakan minyak penyerap hentakan.
t Tukar.
23 Minyak enjin t Periksa paras minyak dan √ √ √ √ √ √
kebocoran pada motosikal.
24 Penapis minyak enjin t Bersihkan. √ √ √
7-5
NO. PERKARA
t Periksa paras penyejuk dan kebo- √ √ √ √ √
coran penyejuk.
25 * Sistem penyejuk
t Gantikan penyejuk. Setiap 3 tahun
Suis brek hadapan

26 * t Periksa operasi. √ √ √ √ √ √
dan belakang
Bahagian bergerak
27 t Lincirkan. √ √ √ √ √
dan kabel
t Periksa operasi.
t Periksa gerak bebas kebel
28 * Cengkam pendikit √ √ √ √ √
pendikit dan laraskan jika perlu.
7 t Lincirkan pendikit & kabel.
Lampu, signal dan t Periksa operasi.
29 * √ √ √ √ √ √
suis t Laraskan pancaran lampu utama.
7-6
EAU62401
TIP
t Penapis udara memerlukan servis yang lebih kerap jika anda menunggang di kawasan luar biasa basah atau berdebu.
t Servis brek hidraulik
t Sentiasa memeriksa dan, jika perlu, perbetulkan paras cecair brek. Selepas menanggalkan silinder utama brek dan
angkup, sentiasa menukar cecair brek.
t Setiap dua tahun gantikan komponen dalaman silinder brek utama brek dan angkup, dan tukar cecair brek.
t Gantikan salur brek setiap empat tahun dan jika ia pecah atau rosak.
7-7
EAU18773
2. Tanggalkan bolt, quick fastener, dan
Menanggal dan memasang skru, lalu tarik cowling ke arah luar
panel dan keluarkan.
Panel perlu ditanggalkan untuk melak 1
3
ukan kerja-kerja penyelenggaraan yang
3
dihuraikan dalam bahagian ini. 1
Rujuk bahagian ini setiap kali panel 4
perlu ditanggalkan dan dipasang. 2 2 3
3 2 1
1. Cowling A
3 2. Unjuran cowling
3. Lubang
1. Cowling A
2. Bolt 2. Pasang skru, pengikat cepat, dan
7 3. Pengikat Skru bolt.
4. Skru 3. Pasang panel A, B dan C. (m/s
4 7-8)
1. Panel A Untuk memasang cowling
2. Panel B 1. Menyesuaikan unjuran cowling ke
3. Panel C dalam lubang, dan kemudian men-
4. Cowling A EAU77170
Panel A
olak cowling tersebut ke dalam.
Untuk menanggalkan panel
Cowling A
Keluarkan empat pengikat cepat dan
Untuk menanggalkan panel satu bolt dan keluarkan panel.
1. Keluarkan panel A, B dan C. (m/s
7-8).
7-8
3
2
2
1 3
2 1
1
3 4
1. Pengikat Cepat 1. Pengikat Cepat 1. Panel B

2. Panel A 2. Skru 2. Panel Unjuran
3. Bolt 3. Panel B 3. Lubang
4. Bolt
Untuk memasang panel 2. Pasang panel C. (m/s 7-8).
Letakkan panel dalam kedudukan asal, 3. Keluarkan pengikat cepat, bolt 3. Pasang tempat duduk penumpang 7
kemudian pasangkan skru dan pengikat dan skru, dan kemudian tarik pa- dan penunggang. (Rujuk m/s 4-16)
cepat. nel ke arah luar dan lepaskan.
Panel C
Panel B Untuk memasang panel
Untuk menanggalkan panel
Untuk menanggalkan panel 1. Letakkan panel unjuran masuk
lubang, dan kemudian pasangkan 1. Keluarkan tempat duduk penump-
1. Keluarkan tempat duduk penump- skru, bolt dan pengikat cepat. ang. (Rujuk m/s 4-16)
ang dan tempat duduk penungga- 2. Keluarkan bolt dan skru, kemudian
ng (Rujuk m/s 4-16) keluarkan panel.
2. Keluarkan panel C. (m/s 7-8).
7-9
EAUT2075
1 3 Pemeriksaan palam pencucuh

Palam pencucuh adalah bahagian enjin
yang penting, dimana ia mudah dipe- 1
riksa. Memandangkan haba dan keko-
toran akan menyebabkan palam pen-
cucuh perlahan-lahan terhakis, ia harus
diperiksa dan di ganti dengan merujuk
kepada rajah penyelenggaraan dan pe-
2 linciran berkala. Selain itu, keadaan pa- 2
lam pencucuh mempengaruhi keadaan
1. Skru enjin.
1. Palam pencucuh
2. Bolt Untuk menanggalkan palam 2. Spark plug sepana
3. Panel C pencucuh
3. Tanggalkan palam pencucuh seperti
1. Tanggalkan cowling A. (Lihat m/s 7-8.)
yang ditunjukkan, dengan sepana
Untuk memasang panel
7 palam pencucuh.
1. Pasang panel dengan memasang
skru dan bolt. Untuk memeriksa palam pencucuh
2. Pasang semula tempat duduk pen- 1 1. Periksa disekeliling penebat por-
umpang. (m/s 4-16) selin dan di tengah elektrod palam
pencucuh berwarna kelabu yang
sedikit cerah (Warna ini biasanya
untuk motosikal yang ditunggang
TIP
1. Penutup palam pencucuh Jika palam pencucuh menunjukkan
warna yang berbeza setelah digunakan
2. Tanggalkan penutup palam pen- enjin mungkin beroperasi secara tidak
cucuh.
7-10
wajar. Jangan membaikinya sendiri. Untuk memasang palam pencucuh EAU62845
Sebaliknya, dapatkan wakil Yamaha 1. Bersihkan permukaan gasket palam Minyak enjin dan penapis minyak.
untuk memeriksa kenderaan. pencucuh dan permukaan yang ko- Paras minyak enjin perlu diperiksa se-
tor, dan bersihkan sebarang keko- belum setiap penunggangan. Di samping
2. Periksa hakisan elektrod pada pa- toran pada ulir palam pencucuh. itu, minyak mesti ditukar dan penapis
lam pencucuh dan karbon yang 2. Pasangkan palam pencucuh dengan minyak dibersihkan mengikut tempoh
berlebihan atau kotoran lain, dan spana palam pencucuh, dan kemu- yang ditetapkan dalam penyelenggaraan
gantikannya jika perlu. dian ketatkannya kepada spesifikasi berkala dan carta pelinciran.
tork yang ditentukan Memeriksa paras minyak enjin
Palam pencucuh yang disyorkan: 1. Letakkan motosikal secara tegak
NGK/MR8E9 Tork pengetatan: menggunakan pangsi tengah. Jika
Palam pencucuh: ia berkeadaan condong, bacaan
3. Ukur jarak palam pencucuh dengan 12.5 N·m (1.25 kgf·m, 9.2 lb·ft)
alat pengukur ketebalan dan jika akan menjadi tidak tepat.
perlu, selaraskan jarak mengikut 2. Hidup dan panaskan enjin untuk be-
TIP
spesifikasi. berapa minit, kemudian matikannya.
Jika tiada spana pengukur tork ketika 7
3. Tunggu beberapa minit sehingga
memasang palam pencucuh, anggaran
minyak terkumpul, buka penutup pen-
yang terbaik adalah dengan memulas
gisi minyak enjin, lapkan ukur celup
selepas diketatkan dengan tangan. Wa-
dengan kain bersih, masukkan ukur
lau 1/4 - 1/2 pusingan bagaimanapun, celup (tanpa mengikatnya) untuk
palam pencucuh haruslah diketatkan memeriksa paras minyak enjin.
mengikut spesifikasi yang ditetapkan AMARAN: Jangan beroperasi ken-
secepat yang mungkin. deraan sehingga anda tahu bahawa
3. Pasang palam pencucuh. tahap minyak enjin mencukupi.
1. Jarak palam pencucuh
4. Pasang cowling.
Jarak palam pencucuh
0.8–0.9 mm (0.031–0.035 in)
7-11
4. Jika paras minyak enjin berada
atau lebih rendah daripada paras 4
minima, tambahkan minyak yang
secukupnya untuk menaikkan paras 3
minyak ke tahap yang sepatutnya.
5. Pasang dan ketatkan penutup pe- 2
ngisi minyak enjin.
1
Untuk menukar minyak enjin dan
membersih penapis minyak 5
1 ZAUE0672
ZAUE0033 1. Hidupkan enjin, panaskan enjin
1. Penutup pengisi minyak enjin beberapa minit, selepas itu matikan 1. Bolt buangan minyak enjin
suis. 2. O-ring
TIP
2. Letakan bekas minyak di bawah 3. Spring mampatan
Ketinggian minyak enjin mestilah antara 4. Penapis
had minima dan maksimum. enjin untuk mengumpul minyak
5. Bekas minyak
7 enjin terpakai.
3. Keluarkan penutup pengisi minyak
4. Bersihkan penapis minyak enjin
enjin dan bolt buangan bersama-
1 dengan pelarut.
sama dengan O-ring, mampatan sp-
ring, dan minyak enjin penapis, untuk TIP
2 mengalirkan minyak dari kotak engkol. Langkau langkah 5-7 jika elemen pe-
3 PERHATIAN : Apabila membuka napis minyak tidak diganti.
bolt buangan, “O-ring”, spring
pemampatan dan penapis minyak 5. Keluarkan penutup elemen penapis
akan jatuh keluar. Jangan hilang minyak dengan mengeluarkan bolt.
ZAUE1300
kan komponen yang disebutkan
1. Ukur celup ini. [ECA11002]
2. Tanda paras maksimum
3. Hujung minyak enjin ukurcelup
7-12
Tork pengetatan: Minyak enjin yang disyorkan:
Perlindungan elemen penapis Lihat m/s 9-1.
2 minyak bolt: Kuantiti minyak:
10 N·m (1.0 kgf·m, 7.4 lb·ft) Tanpa penggantian elemen penapis
1 minyak:
TIP 0.85 L (0.90 US qt, 0.75 Imp.qt)
Pastikan bahawa O-ring di kedudukan Dengan penggantian elemen pen-
apis minyak:
yang betul.
0.95 L (1.00 US qt, 0.84 Imp.qt)
8. Pasangkan penapis minyak enjin, PERHATIAN
1. Bolt spring pemampatan, palam pem-
2. Penutup penapis minyak elemen t Untuk mengelakkan kelinciran
buangan minyak enjin dengan yang
6. Keluarkan dan ganti penapis minyak O-ring yang baru, dan kemudian klac (minyak enjin juga melincir-
elemen dan O-ring. ketatkan palam pembuangan den- kan klac), tidak mencampurkan
gan tork yang dinyatakan. mana-mana bahan kimia tamba-
NOTIS: Sebelum memasang han. Jangan gunakan minyak
bolt buangan minyak enjin, ja- dengan spesifikasi diesel dari- 7
1 pada "CD" atau minyak yang le-
ngan lupa untuk memasang O- bih berkualiti dari yang ditetap-
ring, mampatan, dan minyak kan.Selain itu, jangan menggu-
penapis dalam kedudukan. nakan minyak label " Memulihara
[ECA10421] TENAGA II" atau lebih tinggi.
t Pastikan tiada bahan asing me-
2 Tork pengetatan: masuki kotak engkol.
Bolt buangan minyak enjin:
ZAUE0104 10. Hidupkan enjin, dan biarkan sela-
32 N·m (3.2 kgf·m, 24 lb·ft)
ma beberapa minit semasa meme-
1. Penapis minyak elemen riksa kebocoran minyak. Jika min-
9. Tambah minyak enjin yang disyor
2. O-ring yak bocor, segera matikan enjin
kan dan kemudian tutupkan penut- dan periksa puncanya.
7. Pasang penutup elemen penapis
minyak dengan memasang bolt, up pengisi minyak enjin dengan 11. Matikan enjin, dan kemudian pe-
kemudian mengetatkannya ke to- ketat. riksa tahap minyak dan betulkan-
7-13 nya jika perlu.
rsi yang ditentukan.
EAU20071 4. Periksa paras cecair penyejuk
Cecair Penyejuk dalam tangki cecair penyejuk.
Tahap cecair penyejuk perlu diperiksa
sebelum setiap perjalanan. Di samping TIP
itu, cecair penyejuk mesti ditukar men- Penyejuk perlu berada di antara paras
gikut tempoh dalam penyelenggaraan minimum dan maksimum.
berkala dan carta pelinciran yang di- 1
syorkan .
EAU67000
Untuk memeriksa tahap penyejuk
1. Letakkan motosikal pada permu-
kaan rata 1. Penutup tangki cecair penyejuk
2. Keluarkan cowling A. (Lihat m/s 6. Tambahkan bahan penyejuk pada
7-8) tanda tahap maksimum, dan ke-
1
3. Memegang kenderaan dalam ke- FULL
mudian pasang semula penutup
2
dudukan tegak. 3
LOW
takungan. AMARAN! Buka pe-
7
TIP nutup takungan penyejuk.
t Tahap cecair penyejuk mesti di- Jangan sekali-kali cuba untuk
1. Tangki cecair penyejuk
periksa semasa enjin berada dalam mengeluarkan penutup radiator
2. Paras maksimum
keadaan sejuk. Ini disebabkan oleh ketika enjin panas.
3. Paras minimum
paras penyejuk akan berubah men- PERHATIAN: Jika cecair penye-
gikut suhu enjin. 5. Jika penyejuk berada atau di ba- juk tiada, gunakan air suling atau
wah tanda aras minimum, air paip lembut. Jangan guna-
t Pastikan motosikal adalah dalam
Buka penutup takungan penyejuk. kan air keras atau air garam ker-
keadaan tegak semasa memeriksa
ana ia akan memudaratkan
paras minyak. Jika condong sedikit,
enjin tersebut. Jika air telah di-
bacaan akan salah.
gunakan gantikan dengan cecair
7-14
EAU65831
penyejuk dengan secepat mung- Pembersihan elemen penapis
kin, jika tidak, sistem penyeju-
kan tidak akan dilindungi dari-
udara
pada pengaratan dan hakisan. Elemen penapis udara patut dicuci dalam
Jika air telah ditambah dengan jangkamasa yang ditentukan dalam jadual
bahan penyejuk, minta pengedar penyelenggaraan dan pelinciran. Ber-
Yamaha memeriksa kandungan sihkan elemen penapis udara lebih ke-
anti-beku penyejuk secepat mu- rap jika anda menunggang di kawasan 1
ngkin, jika tidak, keberkesanan
-kawasan luar biasa basah atau temp-
penyejuk akan berkurang.
[ECA10473] at yang berhabuk.
1. Elemen penapis udara
1. Keluarkan tempat duduk. (m/s 4-16.)
Kapasiti tangki penyejuk (sehingga 7. Ketukkan secara ringan elemen
2. Keluarkan cowling A (m/s 7-8.)
tahap paras maksimum): penapis udara untuk membuang
0.20 L (0.21 US qt, 0.18 Imp.qt)
3. Keluarkan skru dan bolt dari kotoran dan habuk yang terlekat,
penutup tangki minyak. selepas itu guna kan semburan
7. Pasang cowling. 4. Keluarkan bolt dari tangki bahan tekanan angin yang tinggi untuk
7
api. menanggalkan sisa-sisa kotoran.
5. Putuskan sambungan hos pam ba- Periksa elemen penapis udara, jika
Penukaran cecair penyejuk EAU33032
rosak, gantikan jika perlu.
han api dan soket pam bahan api,
Cecair penyejuk mesti ditukarganti
kemudian keluarkan tangki bahan
dalam jangkamasa yang ditentukan
api.
dalam jadual penyelenggaraan berkala
6. Keluarkan penutup elemen penapis
dan rajah pelinciran. Dapatkan peng-
udara dengan mengeluarkan skru
edar YAMAHA untuk menukar-gantikan
dan kemudian tarik elemen penapis
cecair penyejuk tersebut. AMARAN !
udara keluar.
Jangan cuba membuka penutup ra-
diator semasa enjin dalam keadaan 1
panas. [EWA10382]
1. Elemen penapis udara
7-15
EAU34302
5. Masukkan elemen penapis udara Menyesuaikan kelajuan enjin TIP
ke dalam penutup penapis udara. Jika kelajuan tanpa bergerak yang di-
melahu
PERHATIAN: Pastikan elemen tetapkan tidak boleh diperoleh seperti
Penyelarasan halaju enjin tanpa ber-
penapis udara dimasukkan ke yang dinyatakan di atas, hubungi pen-
gerak mestilah diperiksa dan, jika perlu,
dalam bekas penapis udara. gedar Yamaha untuk membuat pelara-
diselaraskan seperti berikut pada jangka
Enjin tidak patut dijalankan jika san.
masa yang dinyatakan dalam carta pen-
elemen penapis tidak dipasang
yelenggaraan berkala dan pelinciran.
kan. Jika tidak, “piston” atau
Enjin mesti dipanaskan sebelum pen-
“cylinder” atau kedua-duanya
yelarasan dilakukan.
akan haus atau rosak.
[ECA10482] Periksa kelajuan enjin tanpa bergerak
6. Pasangkan penutup penapis udara dan, jika perlu, sesuaikan dengan spe-
dengan memasang skru. sifikasi skru mudah alih. untuk mening-
TIP katkan kelajuan enjin tanpa bergerak
Jika habuk atau air berkumpul dalam hos putarkan skru arah (a). untuk mengu-
7 periksa penapis udara, keluarkan rangkan kelajuan enjin tanpa bergerak,
pengapit, dan kemudian cabut hos putarkan skru arah (b).
untuk mengalirkan debu dan air.
10. Sambungkan hos bahan api, pam
fuel coupler dan hos tangki bahan (b)
api.
(a)
11. Pasang tangki bahan api dan ketat-
kan bolt.
12. Pasang penutup tangki bahan api
kemudian mengetatkan bolt dan skru. 1
13. Pasang cowling. 1. Skru pelarasan tanpa bergerak
14. Memasang tempat duduk penum- Halaju enjin tanpa bergerak:
pang. 1300–1500 r/min
7-16
EAU48433
EAU21402
Pemeriksaan gerak bebas 2. Untuk meningkatkan gerak bebas
kabel pendikit, putarkan nut pela-
Jarak bebas injap
kabel pendikit Jarak bebas injap berubah apabila di
rasan arah (a). Untuk mengurang-
Mengukur pemegang pendikit gerak gunakan, menyebabkan pembakaran
kan gerak bebas kabel pendikit
bebas seperti yang ditunjukkan. campuran udara minyak kurang tepat
putarkan nut pelarasan ke arah (b).
dan/ atau enjin berbunyi hingar. Untuk
mengelakkan ini terjadi, hubungilah
pengedar YAMAHA untuk penyelen-
ggaraan dan pelinciran yang khusus.
1
(a)
1. Gerak bebas kabel pendikit ZAUE0593

1 2 (b)
7
Gerak bebas kabel pendikit: 1. Nut kunci.
3.0–5.0 mm (0.12–0.20 in) 2. Nut pelarasan
Sentiasa memeriksa gerak bebas ka-

bel pendikit dan jika perlu, laraskan 3. Mengetatkan nut kunci.
ia seperti berikut.
TIP
Sebelum menyelaras gerak bebas bagi
kabel pendikit, pastikan menyelaraskan
halaju enjin tanpa bergerak dengan betul.
1. Longgarkan nut kunci.
7-17
EAU64401
diselaraskan mengikut kelajuan Pemeriksaan tayar
Tayar
menunggang dan dengan jumlah
Tayar adalah satu-satunya hubungan
berat penunggang, penumpang,
antara motosikal dan jalan raya. Kese-
kargo, dan aksesori yang dilu-
lamatan memandu terletak pada seba-
luskan untuk model ini.
hagian kecil tayar yang menyentuh
jalan. Oleh itu, adalah penting untuk Tekanan udara tayar (diukur ketika
mengekalkan tayar dalam keadaan tayar sejuk):
baik pada setiap masa dan gantikan 1 orang:
pada masa yang sesuai dengan yang Hadapan:
tayar yang disyorkan. 225 kPa (2.25 kgf/cm , 33 psi)
1. Tayar sisi
Belakang:
Tekanan udara tayar 220 kPa (2.50 kgf/cm , 36 psi) 2. Penunjuk tayar haus
Tekanan udara tayar perlu diperiksa dan, 2 orang: 3. Kedalaman bunga tayar
jika perlu, diselaraskan sebelum setiap Hadapan: Tayar hendaklah diperiksa sebelum se-
perjalanan. 225 kPa (2.25 kgf/cm , 33 psi) tiap kali penunggangan. Jika tayar me-
7 EWA10504
Belakang: mpunyai paku atau serpihan kaca di
250 kPa (2.50 kgf/cm , 36 psi)
AMARAN Beban Maksimum*: dalamnya, atau jika dinding sisi yang
Mengendalikan kenderaan ini dengan 168 kg (370 lb) retak, mencapai had kedalaman bunga
tekanan udara tayar yang tidak sem- * Jumlah berat penunggang, yang dinyatakan, minta wakil penjual
purna boleh menyebabkan kecede- penumpang, kargo & aksesori Yamaha menggantikan tayar dengan
raan teruk atau kematian akibat ke- EWA10512
segera.
hilangan kawalan. AMARAN Kedalaman bunga tayar minimum
t Tekanan udara tayar mestilah (depan dan belakang)
Jangan sekali-kali melebihi muatan 1.0 mm (0.04 in)
diperiksa dan diselaraskan pada
motosikal anda. Melebihi beban ope-
tayar sejuk (iaitu, apabila suhu
rasi sebuah motosikal boleh menye- EWA10583
tayar sama suhu sekeliling). AMARAN
babkan kemalangan.
t Tekanan udara tayar mestilah t Adalah berbahaya menunggang
motosikal dengan tayar yang tidak
7-18
berbunga. Jika bunga tayar me- EWA10462 EAU21963
nunjukkan garisan, dapatkan AMARAN Pemilihan roda

khidmat pihak wakil Yamaha untuk Untuk memaksimumkan prestasi, ke-
Tayar depan dan belakang perlu men-
menggantikan tayar tersebut tahanan dan operasi yang selamat bagi
ggunakan reka bentuk dan jenama
dengan segera. kenderaan anda, perhatikan perkara-
yang sama, sebaliknya ciri-ciri peng-
t Penukaran barangan brek, tayar perkara berikut mengenai roda yang
endalian motosikal yang berbeza,
dan roda harus dikendalikan oleh disyorkan.
boleh membawa kepada kemalangan.
wakil Yamaha yang berpengalaman t Rim roda perlu diperiksa jika retak,
t Menunggang pada kelajuan se- Selepas ujian menyeluruh, hanya tayar melengkung atau kerosakan lain
derhana selepas menukar tayar yang disenaraikan di bawah ini telah sebelum setiap menunggang. Jika
kerana permukaan tayar mesti diluluskan untuk model ini oleh Yamaha. terdapat kerosakan, minta seorang
terlebih dahulu menjadi “broke wakil penjual Yamaha menggan-
in” untuk membangunkan ciri- Tayar hadapan:
ciri yang optimum. tikan roda. Jangan cuba lakukan
Saiz:
100/80-17M/C 52P sendiri walaupun pembaikan kecil
Pengilang/model: pada roda.Kerosakan atau kere-
IRC/RX-01F takan roda mestilah diganti. 7
Maklumat tayar
Tayar belakang: t Roda perlu seimbang, sama ada
Model ini dilengkapi tayar tanpa tiub. Saiz:
Jangka tayar, walaupun ia tidak digunakan 140/70-17M/C 66P tayar atau roda telah ditukar atau
nakan atau hanya digunakan sekali- Pengilang/model: diganti. Satu roda tidak seimbang
sekala. Keretakan daripada bunga dan IRC/RX-01R boleh menyebabkan prestasi yang
sisi roda, kadang-kadang disertai dengan buruk, ciri-ciri pengendalian yang
ubah bentuk, adalah satu bukti men- buruk, dan memendekkan hayat
jadi lama. Tayar yang lama dan berusia tayar.
hendaklah diperiksa oleh pakar tayar
untuk memastikan kesesuaiannya untuk
kegunaan selanjutnya.
7-19
Melaraskan gerak bebas tuil 3. Untuk meningkatkan gerak bebas 6. Untuk meningkatkan gerak bebas
klac tuil klac, putar bolt pelarasan ke tuil klac, putar nut pelarasan ke ar-
Mengukur gerak bebas tuil seperti yang arah(a). Untuk mengurangkan ger- ah (a). Untuk mengurangkan gerak
ditunjukkan. ak bebas tuil klac, putar bolt pelar- bebas tuil klac, putar penyesuaian
asan ke arah (b). nut arah (b).
2 (a)
3 1 TIP 7. Mengetatkan locknut pada kotak
Sekiranya gerak bebas tuil klac ditetapkan engkol.
boleh diperolehi seperti yang diterangkan 8. Ketatkan locknut pada klac tuil dan
4 di atas, langkau langkah 4-7. kemudian luncurkan getah meliputi
(b) 4. Putar sepenuhnya bolt penyesuaian ke kedudukan asalnya.
di tuas klac kepada arah (a) hingga
melonggarkan kabel klac.
5. Longgarkan locknut pada kotak
engkol.
7 1. Perlindungan getah
2. Bolt pelarasan gerak bebas tuil klac
3. Locknut
4. Gerak bebas tuil klac (a)
Gerak bebas tuil klac

10.0-15.0 mm (0.39-0.59 in) 1
(b)
Periksa secara berkala gerak bebas 2
tuil klac dan, jika perlu, melaraskan
seperti berikut.
1. Luncurkan penutup getah semula di
tuil klac. 1. Locknut
2. Longgarkan locknut itu. 2. Nut pelarasan gerak bebas tuil klac
7-20
EAU22382 EAU22541 EAU77811
Memeriksa pelapik brek depan Pelapik brek belakang Memeriksa paras cecair brek
dan belakang depan
Pelapik brek depan dan pelapik brek Sebelum menunggang, pastikan cecair
belakang mesti diperiksa dalam tem- brek melebihi tanda aras minimum.
poh yang telah ditentukan dalam rajah 1 1 Jika perlu, tambahkan cecair brek.
penyelenggaraan dan pelinciran.
EAU22432
Brek depan
Pelapik brek depan
1. Penunjuk pelapik brek belakang

2. Had garisan brek belakang
1
1 Penunjuk kehausan adalah dilampirkan
pada setiap brek. Penunjuk ini mem- 7
bolehkan pemeriksaan dibuat tanpa
membuka brek itu. Tekankan brek dan 1. Tanda aras minimum
perhatikan kedudukan penunjuk itu.
1. Pelapik brek depan menggunakan penunjuk
alur
Jika penunjuk sampai ke garisan paras
kehausan, minta penjual Yamaha men-
Setiap brek dilengkapi dengan satu pe-
ggantikan pelapik tersebut sebagai
nunjuk haus. Penunjuk haus ini mem-
satu set.
bolehkan pemeriksaan kehausan pelapik
brek dilakukan tanpa menanggalkan
brek tersebut. Tekan brek dan periksa
penunjuk haus. Sekiranya pelapik brek
telah haus sehingga hadnya, mintalah
penjual Yamaha menggantikan pelapik.
7-21
Brek belakang t Hanya gunakan cecair brek yang Menggunakan pelapik brek, ia adalah
disyorkan; sebaliknya, getah pe- perkara biasa untuk cecair brek secara
lekat bertambah buruk, menye- beransur-ansur mengalir ke bawah.
babkan kebocoran. Cecair brek paras rendah mungkin me-
t Isi semula cecair brek dengan nunjukkan pelapik brek haus dan/atau
1 jenis yang sama. Menambah ce- kebocoran pada sistem brek; Oleh itu,
cair brek selain daripada DOT 3 pastikan anda memeriksa pelapik brek
atau DOT 4 menyebabkan tindak dan sistem brek untuk kebocoran. Jika
balas kimia yang berbahaya. tahap cecair brek turun secara men-
t Berhati-hati supaya air atau de- dadak, minta wakil penjual Yamaha
bu tidak memasuki takungan
1. Tanda aras minimum periksa sebelum memulakan penung-
cecair brek apabila mengisi se-
gangan.
mula. Air akan menurunkan ta-
Cecair brek disyorkan : kat didih cecair dan akan men-
DOT 3 atau DOT 4
yebabkan “vapor lock”.
7
EWA18870 ECA17641
AMARAN PERHATIAN
Penyelenggaraan yang tidak betul Cecair brek boleh merosakkan per-
boleh menyebabkan kehilangan ke-
mukaan yang dicat atau bahagian-
upayaan untuk brek. perhatikan lang-
bahagian plastik. Sentiasa member-
kah berjaga-jaga ini:
sihkan cecair yang tertumpah dengan
t Cecair brek yang tidak mencu-
kupi boleh membenarkan udara serta-merta.
memasuki sistem brek, mengu-
rangkan prestasi brek.
t Bersihkan penutup tangki sebe-
lum keluarkan. Hanya gunakan
cecair brek DOT 3 atau DOT 4
daripada bekas yang tertutup. 7-22
Penukaran cecair brek

EAU22724
Kekenduran rantai pemacu
Dapatkan dealer Yamaha melakukan Rantaian memandu kendur harus dipe
penggantian minyak brek dalam sela- riksa sebelum setiap perjalanan dan
ng masa seperti yang tertera di baha- diselaraskan jika perlu.
EAU22773
gian rawatan dan pelinciran berkala.
Untuk menyemak rantai kendur
Selain itu, mintalah hos brek diganti
setiap empat tahun atau bila sudah ro- 1. Letakkan motosikal di sebelah kiri
sak atau bocor. mengikut prosedur rujuk m/s 7-32.
TIP
Semasa menyemak dan melaraskan 1. Kekenduran rantai
rantai kendur, tidak perlu ada barang
4. Jika kendur rantai tidak betul, men-
pada motosikal.
yesuaikannya seperti berikut.
2. Shift penghantaran ke dalam
EAUE0440 7
kedudukan neutral. Untuk melaraskan rantai pemacu
3. Mengukur kendur rantai seperti
1. Longgarkan nut gandar dan bela-
yang ditunjukkan.
kang caliper pendakap bolt di se-
Rantai kendur: belah kanan sisi swingarm.
30.0–40.0 mm (1.18–1.57 in)
7-23
TIP 4. Pastikan tanda penyelarasan rantai
Pastikan kedua-dua tanda penyelarasan adalah dalam kedudukan yang sa-
berada dalam kedudukan yang sama ma, kekenduran rantai betul, dan
untuk penjajaran roda yang betul. rantai boleh bergerak dengan
sempurna.
1
1 2 (b)
1. Axle nut
2. Untuk mengetatkan rantaian pem-
acu, belok rantaian pemacu rantai (a)
pemacu pada setiap sisi swingarm 3
dalam arah (a). Untuk melonggar-
7 kan pemacu rantai, putar bolt men-
yesuaikan setiap sisi swingarm da-
lam arah (b), dan kemudian tolak 1. Locknut
belakang roda ke hadapan. 2. Bolt penyelarasan kekenduran rantai
PEMBERITAHUAN: Kelemahan 3. Tanda penyelarasan
rantaian pemanduan tidak akan 3. Ketatkan nut gandar, kemudian be-
berlebihan enjin serta bahagian- lakang caliper pendakap bolt untuk
bahagian penting motosikal dan tork yang dinyatakan mereka.
boleh membawa kepada kemero-
Pengetatan tork:
sotan rantai atau kerosakan. Untuk Axle nut:
mengelakkan ini daripada berlaku, 55 Nm (5.9 m·kgf, 44 ft·lbf)
pastikan rantaian pemacu kendur Locknut:
dalam had yang ditetapkan. 16 Nm (1.6 m·kgf, 12 ft·lbf)
7-24
Mencuci dan melincirkan 3. Melincirkan dengan teliti rantai pe-
EAU23113
rantai pemacu macu dengan pelincir khas rantai

Memeriksa dan melincirkan
Rantaian pemacu mesti dibersihkan “O-RING”. pemegang pendikit dan
dan dilincirkan pada selang yang dite-
ntukan dalam carta penyelenggaraan Memeriksa dan melincirkan kabel
Periksa operasi pemegang pendikit
dan pelinciran berkala, jika tidak, ia a- kabel
kan cepat haus, terutamanya semasa sebelum menunggang. Kabel perlu
Operasi yang dijalankan oleh kabel ka-
menunggang di kawasan yang berde- dilincirkan dan ditukar dalam tempoh
walan dan keadaan kabel seharusnya
bu atau basah. Mencuci rantai pemacu diperiksa sebelum menunggang. Kabel tertentu seperti dalam rajah penyelen-
seperti berikut. haruslah diminyakkan jika perlu. Jika ggaraan dan pelinciran. Kabel pendikit
dilengkapi dengan penutup getah. Pas-
PERHATIAN kabel rosak atau tidak bergerak dengan
lancar, mintalah pihak penjual Yamaha tikan penutup dengan selamat dipasang.
Rantai pemacu mesti dilincirkan se- Walaupun but dipasang dengan betul,
untuk memeriksa atau menukarkannya.
lepas mencuci motosikal, menung- ia tidak benar-benar melindungi kabel
AMARAN! Kerosakan pada perlin-
gang dalam hujan atau menunggang daripada kemasukan air. Oleh itu, ber-
dungan kabel luar boleh menyebab-
di kawasan basah. hati-hati jangan tuangkan air secara 7
kan pengaratan dalaman dan gang-
1. Bersihkan rantaian pemacu dengan guan menyebabkan dengan perge- langsung ke but atau kabel apabila
air sabun untuk menghilangkan ha- rakan kabel. Gantikan kabel yang mencuci kenderaan. Jika kabel atau
buk & lumpur terkumpul dan kemu- boot menjadi kotor, lap bersih dengan
rosak secepat mungkin untuk men-
dian keringkan. kain lembap.
2. Sapukan semburan pembersihan gelakkan keadaan yang tidak selamat.
[EWA10712]
pada semua pautan dan plat rantai,
kemudian lapkan rantai. Pelincir yang disyorkan:
PEMBERITAHUAN: Untuk meng- Gris berasaskan “lithium-soap”
elakkan merosakkan “O-RING”,
jangan bersihkan rantaian pema-
cu dengan pembersih wap, pen-
cuci tekanan tinggi atau pelarut
yang tidak sesuai. [ECA11121]
7-25
Memeriksa dan melincirkan Pelincir yang disyorkan:
EAU43643
Periksa dan melincirkan tuil

pedal brek dan pedal penukaran gris berasaskan “lithium-soap”
brek dan klac.
Operasi pedal brek dan pedal penuka-
Titik penggerak tuas brek depan dan klac
ran hendaklah diperiksa sebelum seti-
mestilah dilincirkan pada jangka masa
ap perjalanan, dan pivot pedal perlu
tertentu dalam carta penyelenggaraan
dilincirkan jika perlu.
dan pelinciran berkala.
Pedal brek
Tuil brek depan
Pedal penukaran Tuil klac
7-26
EAU23215
Pelincir yang disyorkan: Pemeriksaan dan pelinciran Pelincir yang disyorkan:
Tuil brek hadapan: Gris berasaskan “lithium-soap”
Gris silikon tongkat sisi
Tuil klac:
Gris berasaskan “lithium-soap”
Pelinciran pangsi membelok
(Swingarm pivots)
Pivot swingarm mesti dilincirkan pada
jarak yang ditentukan dalam carta pe-
nyelenggaraan dan pelinciran berkala.
Pelincir yang disyorkan:
Gris molybdenum disulfide
Operasi tongkat sisi patutlah diperiksa

sebelum penunggangan dan bahan besi
patut diminyakkan untuk melancarkannya. 7
EWA10742
AMARAN
Jika tongkat sisi tidak berfungsi den-
gan lancar, hubungilah penjual Yam-
aha untuk memeriksa atau membai-
kinya. Jika tidak, tongkat sisi boleh
tersentuh tanah dan mengalihkan per-
hatian pengendalian, yang mengak-
ibatkan kemungkinan hilang kawalan.
7-27
EAU23273
Pemeriksaan stering EAU45512
Pemeriksaan cabang depan Galas-galas stering yang haus atau lon-
Pemeriksaan keadaan sepit depan hen- ggar adalah berbahaya. Adalah penting
daklah diperiksakan mengikut tempoh untuk memeriksakan operasi stering
yang dinyatakan dalam rajah penyele- dalam tempoh yang ditentukan dalam
nggaraan dan pelinciran. rajah penyelenggaraan dan pelinciran,
seperti berikut.
Cara memeriksa keadaan cabang 1. Naikkan roda hadapan sehingga ia
depan tidak menyentuh tanah.(m/s 7-32)
Periksa sama ada terdapat calar atau AMARAN! Untuk mengelakkan
kerosakan pada bahagian tiub dalam ECA10591 kecederaan, tahan kenderaan
dan kebocoran minyak yang berlebihan PERHATIAN sehingga tidak terjatuh dengan
di cabang depan. Jika terdapat apa-apa kerosakan teruk. [EWA10752]
Cara memeriksa operasinya atau gerakan cabang depan yang tidak 2. Pegangkan hujung sepit depan mo-
1 Letakkan motosikal di tempat rata lancar, sila hubungi penjual Yamaha tosikal dan cuba menggerakkannya
7 ke depan dan ke belakang. Jika
dalam keadaan tegak. untuk membaikinya.
merasa sebarang gerak bebas,
Untuk mengelak daripada kecede- mintalah penjual Yamaha untuk
raan, penahanan yang stabil dan memeriksa dan menyelaraskan
kemas pada motosikal diperlukan stering.
supaya tidak mudah jatuh. [EWA10752]
2 Menarik brek depan, sambil tekan
dengan kuat pada bar pemegang ke
bawah beberapa kali untuk mem-
astikan sepit depan bergerak ke
bawah dan ke atas secara lancar.
7-28
EAU23292 EAU50292
t Bateri mungkin mengeluarkan
Pemeriksaan galas-galas roda Bateri gas letupan. Jauhilah bateri dari
Pemeriksaan galas-galas roda haruslah Model ini dilengkapi dengan bateri VRLA api, bunga api, putung rokok dan
dilakukan mengikut jadual penyeleng- (Valve Regulated Lead Asid). Oleh itu sebagainya. Pengaliran udara
garaan. Sekiranya terdapat gerak be- ia tidak memerlukan pemeriksaan elek- mestilah baik apabila mencas-
bas pada hab roda ataupun roda tidak trolit atau penambahan air bateri ke da- kan bateri di kawasan yang
dapat bergerak dengan lancar, dapat- lam bateri. Walau bagaimanapun, sam- tertutup.
kanlah penjual Yamaha untuk meme- bungan pada bateri perlu diperiksa dan
t JAUHI SEBARANG BATERI DA-
riksa galas-galas roda itu. ketatkannya jika perlu.
RIPADA KANAK-KANAK.
EWA10761
ECA16522
AMARAN
PERHATIAN
t Elektrolik bateri adalah beracun
dan berbahaya dan boleh men-
Jangan cuba mengeluarkan meterai
gakibatkan kebakaran yang ter- sel bateri, kerana tindakan ini akan
uk dan sebagainya. Jauhi dari- merosakkan bateri secara kekal.
pada terkena kulit, mata atau pa- 7
Mengecas bateri
kaian. Sentiasa melindungi mata
Bawa bateri ke wakil Yamaha secepat
anda ketika bekerja berdekatan
mungkin sekiranya bateri menunjukkan
dengan bateri. Jika berlaku ma-
ianya perlu dicas. Perlu diingati baha-
salah, ikutilah langkah-langkah wa bateri mudah lemah jika motosikal
pertolongan cemas berikut. ditambah dengan barang tambahan
t LUAR: Cuci dengan air yang elektronik.
banyak. ECA16522
t DALAM: Minum banyak air PERHATIAN

atau susu dan segera meman- Untuk mengecas bateri jenis VRLA
ggil seorang doktor. (Valve Regulated Lead Asid), memer-
t MATA: Cuci dengan air selama lukan pengecas yang khas (voltan
dibekalkan secara sekata).Menggu-
15 minit dan dapatkan rawatan nakan pengecas yang biasa boleh
segera. merosakkan bateri.
7-29
Menyimpan bateri EAU66795
Fius dinyatakan:
1. Apabila motosikal tidak akan digu-
Penggantian fius
Fius utama :
nakan selama sebulan atau lebih, 15.0A
tanggalkan bateri, caskan sepenuh- Aksesori fius:
nya dan simpan di tempat sejuk
dan kering. PERHATIAN! Semasa 1 2.0 A
menanggalkan bateri, pastikan 3 3. Hidupkan suis utama dan menghid-
suis utama dalam keadaan ‘OFF’, 2
cabut pada penyambungan ne- upkan litar elektrik yang berkenaan
gatif dahulu sebelum penyam- untuk menguji operasi peranti.
bungan positif. [ECA16303] 4. Sekiranya fius segera terbakar sek-
2. Jika bateri disimpan untuk lebih ali lagi, dapatkan peniaga Yamaha
dari dua bulan, bateri harus diperiksa 1. Fius utama menyemak sistem elektrik.
sekurang-kurangnya sekali sebulan 2. Fius aksesori
dan caskan sepenuhnya 3. Fius gantian
3. Sebelum pemasangan, bateri perlu Kotak fius, yang mengandungi fius bagi
dicas sepenuhnya. PERHATIAN:
7 Semasa menanggalkan bateri, litar individu, terletak bawah tempat
pastikan suis utama dalam kea- duduk. (Lihat muka surat 4-16.)
daan ‘OFF’, cabut pada penyam- 1. Matikan suis utama dan akan me-
bung negatif dahulu sebelum matikan semua litar elekrik yang
penyambungan positif. berkenaan.
4. Selepas pemasangan bateri pada 2. Tanggalkan fius yang terbakar, dan
kedudukan asal motosikal, pastikan kemudian pasang fius yang baru
sambungan terminal bateri di mengikut amperage yang ditetapkan.
sambung dengan baik. AMARAN! Jangan gunakan fius
ECA16531 daripada aliran elektrik yang le-
PERHATIAN bih tinggi daripada yang disyor-
Pastikan bateri dicas sepenuhnya kan untuk mengelakkan daripada
sebelum disimpan. Kerosakan kerosakan besar kepada sistem
mungkin terjadi sekiranya bateri elektrik dan mungkin berlaku
disimpan tanpa di cas kebakaran.
7-30
Lampu utama EAU62850
Lampu bantuan
EAUV0700 EAU24182
Lampu belakang/brek
Model ini dilengkapi dengan lampu
Model ini dilengkapi dengan lampu Model ini dilengkapi dengan lampu
utama jenis LED.
bantuan jenis LED. belakang/brek jenis LED.
Jika lampu tidak menyala, jumpa pem-
Jika lampu tidak menyala, jumpa pem- Jika lampu belakang/brek tidak men-
bekal Yamaha untuk memeriksa litar
bekal Yamaha untuk memeriksa litar yala, dapatkan wakil penjual Yamaha
elektrik.
elektrik. untuk diperiksa.
ECA16581
PERHATIAN
Jangan melekatkan apa-apa jenis
filem gelap atau pelekat pada kanta
lampu utama.
7-31
Menukar mentol lampu isyar- Penahan pada motosikal EAU43054
Oleh kerana model ini tidak dilengkapi

Roda depan
at
1. Keluarkan lensa cahaya isyarat dengan tongkat tengah, ikuti langkah ber-
putaran dengan mengeluarkan jaga-jaga ini apabila mengeluarkan roda
skru. hadapan dan belakang atau melakukan Mengeluarkan roda depan
penyelenggaraan lain yang memerlukan EWA10742
motorsikal berdiri tegak. Periksa bahawa AMARAN

motosikal berada di kedudukan stabil dan Untuk mengelakkan kecederaan, de-
tahap sebelum memulakan penyelengga- ngan selamat menyokong kenderaan
raan. Kotak kayu yang kuat boleh diletakk- supaya tidak ada bahaya ia jatuh.
an di bawah enjin untuk kestabilan tam-
bahan. 1. Longgarkan gandar roda hadapan
Untuk menyelenggara roda hadapan dan bolt brek caliper.
1
1. Menstabilkan belakang motosikal
dengan menggunakan pendirian mo-
7 1. Skru tosikal atau, jika motosikal tambahan
2. Keluarkan mentol terbakar dengan pendirian tidak tersedia, dengan me-
menekan dan memutarkannya la- letakkan bicu di bawah bingkai di ha-
wan arah jam. dapan roda belakang.
3. Masukkan mentol baru ke soket, 2. Naikkan roda depan dari tanah den-
tolakkannya, dan kemudian putar- gan menggunakan pendirian motosikal.
kan mengikut arah jam sehingga ia Untuk menyelenggara roda belakang 1
berhenti. Naikkan roda belakang dari tanah den-
4. Pasang lensa dengan memasang gan menggunakan pendirian motosikal 1. Axle nut
skru. NOTIS: Jangan terlalu kuat atau, jika pendirian motosikal tidak ter-
mengetatkan skru, jika tidak len- sedia, dengan meletakkan bicu sama 2. Angkat roda depan dari tanah me-
sa boleh pecah. [ECA11191] ada di bawah setiap sisi bingkai di had- ngikut prosedur "Menyokong moto-
apan roda belakang atau di bawah seti- sikal".
ap sisi swingarm.
7-32
EAU43054
3. Keluarkan pemegang hos brek de- 2. Masukkan roda dan pasang roda
ngan mengeluarkan bolt. Roda Belakang
gandar
2 3. Turunkan roda depan supaya ia ada-
lah di atas tanah.
1
4 4. Pasang caliper brek dengan mema- Untuk mengeluarkan roda belakang
sang bolt. EWA10742
TIP AMARAN
Pastikan terdapat ruang yang cukup Untuk mengelakkan kecederaan, de-
5
3 antara pad brek sebelum memasang ngan selamat menyokong kenderaan
caliper brek ke cakera brek. supaya tidak ada bahaya ia jatuh.
1. Pemegang hos brek
5. Pasang caliper brek dengan mema-
2. Bolt 1. Keluarkan plat tempat letak kaki
3. Caliper brek sang bolt.
dengan mengeluarkan bolt.
4. Brake caliper bolt 6. Ketatkan gandar roda dan brek cali-
5. Gandar bolt per bolt untuk tork yang dinyatakan.
4. Keluarkan caliper brek dengan me- 7
ngeluarkan bolt. Mengetatkan tork:
5. Tarik gandar roda keluar, dan kemu- Gandar roda:
dian keluarkan roda. 40 Nm (4.0 m·kgf, 30 ft·lbf) 2 1
NOTIS: Jangan gunakan brek se- Brek caliper bolt:
lepas calipers brek telah dikeluar- 35 Nm (3.5 m·kgf, 26 ft·lbf)
kan, jika tidak, brek brek akan di-
paksa ditutup. 7. Tolak ke bawah keras pada handl-
ebar beberapa kali untuk memerik-
Pasang roda depan sa operasi fork yang tetap.
1. Plat tempat duduk
2. Bolt
1. Angkat roda di antara kaki fork.
2. Keluarkan penutup rantai dengan
mengeluarkan bolt dan kolar.
7-33
6. Keluarkan kekunci rantai penyesua- 9. Semasa menyokong braket caliper
1 ian di kedua-dua hujung lengan ay- brek, tarik roda bersama dengan was-
unan. her dan rantai penarik, kemudian kelu-
7. Putar bolt rantai penyesuaian sepe- arkan roda. PEMBERITAHUAN:
nuhnya ke arah (a) dan tolak roda ke Jangan gunakan brek selepas roda
hadapan. telah dikeluarkan bersama dengan
2 cakera brek, jika tidak, brek pad
akan dipaksa tutup.
(a)
1. Penutup rantai
2. Bolt
3. Longgarkan nut gandar
1 2
7
1. Locknut
2. Melaraskan bolt rantaian 1
8. Keluarkan rantai dari pemancuan
1. Axle nut
belakang.
1 TIP Untuk memasang roda belakang
2 Sekiranya rantaian pemacu sukar 1. Pasang roda dan bracket caliper
1. Nut gandar 3 dibuang, keluarkan roda gandar te- brek dengan memasukkan gandar
2. Washer rlebih dahulu, kemudian angkat ro- roda dari sebelah kiri.
3. Penarik rantai da ke atas yang cukup untuk meng-
4. Angkat roda belakang dari tanah eluarkan rantai pemacu dari peman- TIP
mengikut prosedur di halaman 7-32. cuan belakang. Pastikan bahawa slot dalam bracket
5. Keluarkan roda gandar dengan Rantaian pemacu tidak perlu dibon- caliper brek adalah sesuai dengan
washer dan penarik rantaian. gkar. Apabila anda mengeluarkan penahan pada swingarm.
atau memasang roda.
7-34
EAU60701
Pastikan terdapat ruang yang cu- Mengetatkan tork:
kup antara pad brek sebelum me- Penyelesaian masalah
Axle nut:
masang roda. 59 N·m (5.9 kgf·m, 44 lb·ft)
Walaupun motosikal Yamaha menerima
Locknut: pemeriksaan yang teliti sebelum peng-
16 N·m (1.6 kgf·m, 12 lb·ft) hantaran dari kilang, masalah mungkin
berlaku semasa operasi. Sebarang ma-
6. Pasang penutup rantaian dengan salah dalam sistem bahan api, mampa-
memasang dengan bolt dan kolar. tan, atau pengapian, sebagai contoh,
7. Pasang plat kaki dengan memasang boleh menyebabkan permulaan yang
bolt. lemah dan kehilangan kuasa.
Carta penyelesaian masalah berikut
mewakili prosedur cepat dan mudah
2 1 untuk memeriksa sistem ini untuk diri
sendiri. Walau bagaimanapun, sekiranya
1. Penyumbat motosikal anda memerlukan pembaikan,
7
2. Slot bawanya ke wakil penjual Yamaha,
yang mempunyai kakitangan yang mahir,
2. Pasang rantai pemacu ke gegancu
alat yang diperlukan, pengalaman, dan
belakang.
mengetahui untuk servis motosikal
3. Pasang penarik rantai dan locknut
dengan betul.
dan washer (cincin), kemudian men-
Gunakan bahagian alat penggantian
yesuaikan rantai. (Rujuk m/s 7-23)
yang tulen dari Yamaha. Alat ganti palsu
4. Turunkan roda belakang supaya ia
mungkin kelihatan seperti bahagian
berada di atas tanah, dan kemudian
Yamaha, tetapi kualiti rendah, mem-
turunkan tongkat sisi.
punyai jangka hayat perkhidmatan yang
5. Ketatkan nut gandar, dan kemudian
lebih pendek dan boleh membawa ke-
ketatkan bolt pendakap brek caliper
pada bil pembaikan mahal.
seperti tork yang dinyatakan.
7-35
EWA15142
AMARAN
Apabila memeriksa sistem bahan api,
dilarang merokok, dan memastikan
tidak membiarkan api terdedah atau
bunga api di kawasan itu, termasuk
lampu penunjuk dari pemanas air
atau relau. Petrol atau wap petrol
boleh menyalakan api atau meletup,
menyebabkan kecederaan teruk atau
kerosakan harta benda.
7-36
EAU42706
Carta penyelesaian masalah
Masalah menghidupkan enjin atau prestasi yang kurang berkuasa

1. Bahan api
Bahan api mencukupi. Periksa bateri.
Periksa paras bahan api
dalam tangki bahan api.
Bahan api tidak Isi Enjin tidak dapat dihidupkan.
mencukupi. bahan api. Periksa bateri.
2. Bateri Enjin hidup dengan

Bateri bagus.
cepat.
Enjin tidak dapat dihidupkan
Operasi penghidup elektrik.
Periksa sambungan plumbum bateri, Periksa pencucuhan.
Enjin hidup dengan
dan dapatkan wakil Yamaha untuk
perlahan.
cas bateri jika perlu.
7
3. Pencucuhan Keringkan dengan kain kering dan betulkan
Basah Operasi penghidup elektrik.
jarak palam pencucuh atau gantikan palam
Keluarkan palam pencucuh pencucuh.
dan periksa elektrod.
Dapatkan wakil penjual Yamaha untuk Enjin tidak dapat dihidupkan
Kering
memeriksa motosikal. Periksa tekanan.
4. Tekanan Enjin tidak dapat dihidupkan

Terdapat tekanan.
Dapatkan wakil penjual Yamaha untuk memeriksa motosikal.
Operasi penghidup elektrik.
Tiada tekanan. Dapatkan wakil penjual Yamaha untuk memeriksa motosikal.
7-37
Enjin terlampau panas
EWA10401
AMARAN
z Jangan tanggalkan penutup radiator apabila enjin dan radiator yang panas. Cecair dan wap panas mungkin
keluar dengan tekanan yang tinggi, boleh menyebabkan kecederaan yang teruk. Pastikan anda tunggu sehin-
gga enjin sejuk.
z Selepas keluarkan bolt pemegang penutup radiator, letakkan kain tebal, seperti tuala, atas penutup radiator,
dan perlahan-lahan pusingkan penutup mengikut arah lawan jam untuk menahan tekanan dalam radiator.
Apabila bunyi desiran berhenti, tekan penutup ke bawah serta pusingkanmengikut arah lawan jam, dan kemu-
dian keluarkan penutup.
Ada Dapatkan wakil penjual

kebocoran Yamaha periksa dan
Paras bahan penyejuk
membaiki sistem penyejukan.
rendah, periksa kebocoran
sistem penyejukan.
Tiada
7 Periksa paras bahan penyejuk Tambah penyejuk. (Lihat TIP.)
Tunggu sehingga kebocoran
dalam bekas simpanan dan
enjin sejuk.
radiator.
Paras bahan Hidupkan enjin, kalau ada pemanasan enjin lagi, dapatkan
penyejuk OK. wakil penjual Yamaha untuk memeriksa dan membaiki
sistem penyejukan.
TIP
Jika bahan penyejuk tidak boleh didapati, air paip boleh digunakan buat sementara waktu, dengan syarat ditukar kepada
bahan penyejuk yang disyorkan secepat mungkin.
7-38
Penjagaan dan penyimpanan motorsikal
EAU37834 EAUW0065
tetapi jangan gunakan produk ter-
Amaran pada warna malap Penjagaan sebut pada “seal”, gasket, rantai
ECA15193
Reka bentuk motosikal yang semakin pemacu dan gandar roda. Sentia-
PERHATIAN terbuka menunjukkan daya tarikan tek-
sa basuh kotoran dan minyak den-
Sesetengah model bahagian sedia nologi, tetapi ini juga menyebabkan ia
gan air.
ada dilengkapi dengan warna malap. tidak dapat menahan lasak. Walaupun
Pastikan dapatkan nasihat dari wakil komponen yang berkualiti tinggi digu- Pembersihan ECA10773
penjual Yamaha mengenai produk nakan, pengaratan dan penghakisan PERHATIAN

untuk digunakan sebelum member- tetap akan berlaku. Paip ekzos yang
sihkan motosikal. Menggunakan be- berkarat mungkin tidak dapat diperha- z Elakkan menggunakan asid yang
rus, bahan kimia keras atau mem- tikan dalam sebuah kereta, tetapi ia akankuat untuk membersih roda, ter-
bersihkan sebatian apabila member- menjejaskan imej sebuah motosikal. utama pada spoked roda. Jika
sihankan permukaan akan calar atau Penjagaan yang kerap dan betul tidak produk tersebut digunakan un-
rosak. Wax juga tidak perlu diguna- hanya mematuhi syarat-syarat jaminan, tuk menghilangkan kotoran de-
kan untuk bahagian sedia ada yang tetapi juga akan mengekalkan rupanya, gil, jangan tinggalkan pencuci
berwarna malap. melanjutkan hayat kegunaan dan meng- di tempat berkenaan lebih lama
optimumkan prestasinya. daripada yang disyorkan. Bilas
dengan rapi kawasan tersebut
Sebelum pembersihan
dengan air, keringkan dengan 8
1. Tutup saluran “muffler” dengan beg
segera dan gunakan semburan
plastik selepas enjin dalam kea-
perlindungan hakisan.
daan sejuk.
z Pembersihan yang tidak betul
2. Pastikan semua penutup dan pen-
boleh merosakkan bahagian pla-
gganding dan penyambung elektrik,
stik (seperti penutup, panel, cer-
termasuk penutup palam pencu-
min depan, kanta lampu, kanta
cuh, dipasang dengan ketat.
meter, dan lain-lain) dan “muf-
3. Buang kotoran degil, seperti min-
flers”. Gunakan kain bersih atau
yak pada peti engkal dengan men-
span yang lembut dengan air
ggunakan ejen anti-gris dan berus,
untuk membersihkan plastik. Ji-
8-1
ka bahagian plastik tidak diber- z Untuk motosikal yang dilengkapi Selepas menunggang dalam hujan atau
sihkan dengan sempurna meng- dengan pelindung angin, jangan berhampiran laut
gunakan air, cairkan bahan pen- gunakan ejen pencuci yang kuat Disebabkan garam laut akan menghakis
cuci yang lembut dengan air. atau span yang kasar dimana ia lakukan langkah-langkah berikut selepas
Pastikan anda bersihkan sisa akan mengakibatkan pudar dan setiap menunggang dalam hujan atau
bahan pencuci menggunakan air calar. Sesetengah sebatian pem- berhampiran laut.
yang banyak, kerana ia berbaha- bersih untuk plastik mungkin me- 1. Bersihkan motosikal dengan air
ya untuk bahagian plastik. ninggalkan calar terhadap pelin- sejuk dan bahan pencuci yang
z Jangan gunakan bahan kimia dungan angin. Sebelum mengg- lembut, selepas enjin sejuk.
yang keras di bahagian plastik. unakannya, cuba ejen pencuci PERHATIAN: Jangan gunakan
Elakkan dari menggunakan kain di tempat terlindung pada pelin- air panas kerana akan menam-
atau span yang tersentuh bahan dung angin. Sekiranya pelindung bahkan hakisan tindakan garam.
pencuci yang kuat, pelarut, ba- angin calar, gunakan sebatian 2. Gunakan semburan perlindungan
han api(minyak petrol), agen pe- mengilap yang berkualiti untuk hakisan pada semua logam, terma-
nanggal karat atau penyekat, menghilangkan calar. suk permukaan chrome, saduran
cecair brek, agen antibeku atau nikel, untuk mengelakkan hakisan.
elektrolit. Selepas penggunaan biasa Selepas pembersihan
8 z Jangan gunakan pembasuh te- Tanggalkan kotoran dengan air suam, 1. Kering motosikal dengan kain serap
kanan tinggi atau jet stim kera- pencuci yang lembut, dan span yang atau kain yang menyerap.
na ia akan menyebabkan resa- lembut dan bersih, dan kemudiannya 2. Segera kering rantaian pemacu dan
membilas secukupnya dengan air yang melincirkan untuk mengelakkan ia
pan air dan kemerosotan pada
d
bersih. Gunakan berus gigi atau berus daripada berkarat.
bahagian-bahagian berikut: Pe-
botol untuk tempat yang susah dicapai. 3. Gunakan pengilat krom untuk sinar-
nutup (untuk roda dan bering
Kotoran degil dan serangga akan ditan- kan krom, aluminium dan bahagian
swingarm, cabang hadapan dan yang tidak berkarat, termasuk sis-
brek), komponen elektrik (soket, ggalkan dengan mudah sekiranya ba-
hagian tersebut ditutup dengan kain ba- tem ekzos. (Peluntur warna melalui
penyambung dan lampu-lampu) terma pada bahagian bahan yang
saluran hembusan dan lubang sah untuk beberapa minit sebelum pem-
tidak berkarat sistem ekzos boleh
angin. bersihan.
ditanggalkan melalui menggilap.)
8-2
4. Untuk mengelakkan hakisan, disyor- ECA10801 EAU43204
kan menggunakan semburan per- PERHATIAN Penyimpanan

lindungan hakisan pada semua lo- t Sapukan minyak semburan dan
gam, termasuk permukaan chrome pengilap dengan berhati-hati dan Jangka masa pendek
dan saduran nikel. pastikan anda mengelap seba- Sentiasa simpan motosikal anda di te-
5. Gunakan semburan minyak sebarang lebihan. mpat yang dingin, dan kering, jika perlu,
gai pencuci sejagat untuk menge- t Jangan gunakan minyak atau pen- lindung daripada debu dengan penutup
luarkan apa-apa kotoran yang ter- gilap kepada getah dan plastik, polos. Pastikan enjin dan sistem ekzos
tinggal. tetapi memelihara dengan penja- sejuk sebelum menyimpan motosikal.
6. Baiki kerosakan cat kecil yang dise- gaan produk yang sesuai. PERHATIAN
ECA10811
babkan oleh batu-batu, dan lain-lain. t Elakkan gunakan penggilap ba-

7. Licinkan permukaan yang dicat. t Simpan motosikal dalam bilik
han kasar kerana akan meluntur-
8. Biarkan motosikal kering sebelum kurang pengudaraan atau lindu-
kan cat.
menyimpan atau menutupinya. ngi dengan tarp, jika basah, akan
EWA11132 membolehkan air dan kelemba-
TIP
AMARAN pan meresap dalam dan menye-
t Dapatkan wakil penjual Yamaha
Bahan pencemar pada brek atau ta- babkan karat.
untuk nasihat produk yang digu-
yar boleh menyebabkan kehilangan t Untuk mengelakkan berkarat, 8
nakan.
kawalan. elak bilik bawah tanah yang lem-
t Basuh dalam cuaca hujan atau lem-
t Pastikan bahawa tiada minyak bap, kandang (kerana kehadiran
bap boleh menyebabkan kanta
atau lilin pada brek atau tayar. ammonia) dan kawasan-kawasan
lampu itu kabur. Hidupkan lampu
t Jika perlu, bersihkan cakera brek di mana bahan kimia yang kuat
dan lapisan brek dengan cakera dalam tempoh yang singkat akan
disimpan.
brek atau aseton, dan membasuh membantu mengeluarkan lemba-
tayar dengan air hangat dan pen- pan daripada kanta. g masa panjang
Jangka
cuci ringan. Sebelum menungg- Sebelum menyimpan motosikal anda
ang dengan kelajuan tinggi, uji untuk beberapa bulan:
brek prestasi motosikal ini dan 1. Ikut semua manual "Penjagaan"
membelok dengan baik. dalam bab ini.
8-3
2. Isi tangki bahan api dan menam- e. Keluarkan penutup palam pen-
TIP
bah penstabil bahan api (jika ada) cucuh dari palam pencucuh, dan
Membuat sebarang pembaikan yang
untuk mengelakkan tangki minyak pasang palam pencucuh dan
perlu sebelum menyimpan motosikal.
dari berkarat dan bahan api bertam- mencetuskan penutup plug.
bah buruk. 4. Lincirkan semua kabel kawalan dan
3. Laksanakan langkah-langkah beri- titik berputar semua tindakan yang
kut untuk melindungi silinder, gela- dapat dilaksanakan dan pedal da-
ng omboh, dan lain-lain daripada ripada tongkat sisi/tongkat tengah.
berkarat. 5. Periksa dan jika perlu, betulkan te-
a. Keluarkan penutup palam pen- kanan udara tayar, dan angkat mo-
cucuh dan cetuskan palam. tosikal supaya kedua-dua roda di
b. Tuangkan satu sudu teh minyak tanah. Sebagai alternatif, hidupkan
enjin ke dalam setiap lubang roda sedikit setiap bulan untuk men-
palam pencucuh. gelakkan tayar daripada menjadi
c. Pasang penutup palam pencu- teruk pada satu tempat.
cuh ke palam pencucuh, dan 6. Tutup saluran muffler dengan beg
letakkan palam pencucuh pada plastik untuk mengelakkan kelem-
kepala silinder berasaskan elek- bapan daripada memasukinya.
8
trod. (Yang ini had mencetuskan 7. Keluarkan bateri dan cas sepenuh-
semasa langkah seterusnya.) nya. Simpan di tempat yang dingin,
d. Hidupkan enjin beberapa kali kering dan cas sekali sebulan. Jan-
dengan penghidup. (ini akan me- gan simpan bateri dalam satu tem-
mberi lapisan minyak pada pat sejuk atau panas [kurang dari-
dinding silinder.) pada 0 ° C (30 ° F) atau lebih dari-
AMARAN! Untuk mengelak- pada 30° C (90 ° F)]. Untuk maklu-
kan kerosakan atau kecede- mat lanjut untuk menyimpan bateri,
raan dari percikan api, pasti- lihat muka surat 7-29.
kan elektrod palam pencucuh
menjadikan enjin semasa lebih. 8-4
[EWA10952]
Spesifikasi
Dimensi: Sistem Penghidup: Suntikan bahan api:
Panjang keseluruhan: Penghidup elektrik Badan pendikit
1990 mm (78.3 in) Sistem pelinciran: Tanda ID:
Lebar keseluruhan: Takungan basah BK61 00
725 mm (28.5 in) Minyak enjin: Palam pencucuh:
Ketinggian keseluruhan: Jenama yang disyorkan: Pengilang / model:
1135 mm (44.7 in) YAMALUBE NGK / MR8E9
Ketinggian tempat duduk: SAE gred kelikatan: Spark plug jurang:
815 mm (32.1 in) 10W-40 0.8-0.9 mm (0.031-0.035 dalam)
Jarak roda: Disyorkan minyak enjin gred: Clutch:
1325 mm (52.2 in) Perkhidmatan API jenisSG atau Jenis Klac:
Kelegaan lantai: lebih tinggi, JASO MA atau MB Basah, pelbagai cakera
155 mm (6.1 in) Kuantiti minyak enjin: Rangkaian kuasa:
Minima pusingan radius: Penukaran minyak: Nisbah pengurangan utama:
2.8 m (9.19 kaki) 0.85 L (0.90 US qt, 0.75 Imp.qt) 3.042 (73/24)
Berat: Dengan penukaran penapis minyak Pacuan akhir:
Berat basah: 0.95 L (1.00 US qt, 0.84 lmp.qt) Rantai
137 kg (302 lb) Kuantiti penyejukan: Nisbah pengurangan kedua
Enjin: Penyejuk takungan (sehingga tahap 3.429 (48/14)
Kitaran pembakaran: maksimum): Jenis penghantaran:
4 lejang 0.20 L (0.21 US qt, 0.18 Imp.qt) 6-Kelajuan gear berterusan
Sistem penyejuk: Radiator (termasuk semua laluan): Nisbah gear
Cecair sejuk 0.49 L (0.52 US qt, 0.43 Imp.qt) ke 1:
Barisan injap: Penapis udara: 2.833 (34/12)
SOHC Elemen penapis udara: ke 2:
Bilangan silinder: Elemen kertas bersalut minyak 1.875 (30/16) 9
Silinder tunggal Bahan api: ke 3:
Sesaran: Bahan api yang disyorkan: 1.864 (30/22)
155.1 cm3 Regular petrol tanpa plumbum sahaja ke 4:
Bore × lejang: Kapasiti tangki bahan api: 1.143 (24/21)
58.0 × 58.7 mm (2.28 × 2.31 in) 11 L (2.9 US gal, 2.4 Imp.gal) ke 5:
Nisbah mampatan: Kapasiti rizab tangki bahan api: 0.957 (22/23)
11.6: 1 1.9 L (0.50 US gal, 0.42 Imp.gal) ke 6:
0.840 (21/25)
9-1
Spesifikasi
Chassis: 2 orang: Suspensi belakang:
Jenis rangka: Hadapan: Jenis:
225 kPa (2.25 kgf/cm2, 33 psi) Unit hayunan
Underbone
Belakang: Spring:
Sudut Caster: 250 kPa (2.50 kgf/cm2 , 36 psi) Spring gegelung
25.5 ° Roda hadapan:
Jejak: Penyerap kejutan:
88 mm (3.5 in) Jenis roda: Damper hidraulik
Tayar hadapan: Roda Cast Perjalanan roda:
Jenis: Saiz rim: 97 mm (3.8 in)
Tanpa tiub 17M / C x MT2.5 Sistem elektrikal:
Saiz: Roda belakang: Sistem voltan:
100 / 80-17M / C 52P Jenis roda: 12 V
Pengilang / model: Roda Cast Sistem penyalaan:
IRC / RX-01F Saiz rim: TCI
Tayar belakang: 17M / C x MT4.0 Sistem penjanaan kuasa
Jenis: Brek depan: AC magneto
Tanpa tiub Jenis: Bateri:
Saiz: Hidraulik brek cakera tunggal Model:
140 / 70-17M / C 66S Spesifikasi cecair brek: GTZ4V
Pengilang / model: DOT 3 atau 4 Voltan, kapasiti:
IRC / RX-01R Brek belakang: 12 V, 3.0 Ah (10 jam)
Loading: Jenis: Model:
Beban maksimum: Hidraulik brek cakera tunggal YTZ4V
168 kg (370 lb) Spesifikasi cecair brek: Voltan, kapasiti:
(Jumlah berat penumpang, kargo DOT 3 atau 4 12 V, 3.0 Ah (10 jam)
9 dan aksesori) Suspensi hadapan: Mentol watt:
Tekanan udara tayar (diukur ketika Jenis: Lampu depan:
tayar sejuk): Teleskopik LED
1 orang: Spring: Lampu belakang/brek:
Hadapan: Spring gegelung LED
225 kPa (2.25 kgf / cm2, 33 psi) Penyerap hentak: Lampu isyarat hadapan:
Belakang: Damper hidraulik 10.0 W
250 kPa (2.50 kgf / cm2, 36 psi) Perjalanan roda: Lampu isyarat belakang:
130 mm (5.1 in) 10.0 W
9-2
Spesifikasi
Lampu bantuan:
LED
Lampu Lesen plat:
5.0 W
Lampu meter:
LED
Lampu penunjuk neutral gear:
LED
Lampu pancaran tinggi:
LED
Lampu isyarat membelok:
LED
Lampu amaran suhu penyejuk:
LED
Masalah enjin lampu amaran:
LED
Lampu penunjuk masa peralihan:
LED
Fius (s):
Fius utama:
15.0 A
Terminal fius :
2.0 A
9-3
Maklumat pengguna
EAU26365 EAU62971 EAU26442
Nombor pengenalan Nombor pengenalan kenderaan Nombor siri enjin

Catatkan nombor pengenalan kenderaan
dan nombor siri enjin dalam ruang yang
disediakan di bawah untuk mendapat-
kan bantuan apabila membuat pesanan
alat ganti dari wakil penjual Yamaha
atau untuk rujukan dalam kes moto-
sikal yang dicuri.
NOMBOR PENGENALAN KENDERAAN:
1. Nombor pengenalan kenderaan 1. Nombor siri enjin
Nombor pengenalan kenderaan dicop Nombor siri enjin adalah dicop di kotak
pada paip kepala stereng. Catatkan engkol.
NOMBOR SIRI ENJIN: nombor ini diruang yang tersedia.
TIP
Nombor pengenalan kenderaan digu-
nakan untuk mengenal pasti kenderaan
anda dan mungkin digunakan untuk
mendaftar dengan pelesenan pihak
10 berkuasa di kawasan anda.
10-1
Maklumat pengguna
EAU74701
Laporan data kenderaan cara umum bagi tujuan penyelidikan apa-

Model ini ECU akan menyimpan data bila data tidak berkaitan dengan individu
kenderaan tertentu untuk membantu kenderaan atau pemilik
dalam diagnosis kerosakan dan pen-
yelidikan dan tujuan perkembangan.
Data ini akan dimuat naik hanya apabila
alat diagnostik Yamaha khas dilampir-
kan pada kenderaan, seperti semasa
pemeriksaan penyelenggaraan atau pro-
sedur perkhidmatan dilakukan.
Walaupun sensor dan laporan data akan

berubah mengikut model, tujuan utama
data adalah:
Status kenderaan dan data pres-
tasi enjin
Penyuntik bahan api dan data ber-
kaitan emisi
Yamaha tidak akan mendedahkan data

ini kepada pihak ketiga kecuali:
Dengan persetujuan pemilik ken-
deraan itu 10
Jika diwajibkan oleh undang-
undang
Untuk digunakan oleh Yamaha
dalam litigasi
Bagi Yamaha yang dijalankan se-
10-2
൘֯⭘䘉⭥অ䖖ԕࡽˈ䈧‫⭘֯࠶ݵ‬䘉ሿ᡻޼
使用手册
YZF155
B2S-F8199-30
EAU46091
EAU46091
EAU46091
B2S
ࡽ䀰
EAU10103
⅒䗾ᶕࡠ䳵傜૸᪙ᢈц⭼ʽ
Ⲵ䖖ѫˈ䳵傜૸儈૱䍘Ⲵӗ૱ࡦ䙐о䇮䇑ˈ䇙ᆳ䎒ᗇҶඊؑⲴ༠䂹ˈҏ䇙ᛘਇᜐҾަѠᇼⲴ㓿傼৺ᴰᯠ
䓛Ѫ YZF155
Ⲵ、ᢰˈ䈧㣡ᰦ䰤␡‫ޕ‬䰵䈫↔᡻޼ˈԕ‫ׯ‬ӛᴹYZF155ᑖ㔉ᛘᡰᴹⲴྭ༴Ǆ䖖ѫⲴ᡻޼нਚᤷሬᛘྲօ᫽֌Ựḕ઼㔤
‫؞‬ᛘⲴ᪙ᢈ䖖ˈ਼ᰦҏᤷሬᛘྲօ‫؍‬ᣔᛘ㠚ᐡ઼ަԆ⣦ߥˈ䆜ྲഠ‫ޕ‬ড䲙ᡆਇࡠՔᇣǄ
䲔↔ѻཆˈ↔᡻޼ሶᨀ‫׋‬䇨ཊᇎ⭘Ⲵሿᨀ⽪ᑞࣙᛘⲴ᪙ᢈ䖖༴Ҿᴰ֣⣦ᘱǄྲ᷌ᛘᴹԫօ⯁䰞ˈ䈧∛ᰐ⣩䊛ൠ㚄㔌ᛘⲴ䳵
傜 ૸᪙ᢈ㓿䬰୶Ǆ
䳵傜૸‫ޘ‬փഒઈ⾍ᝯᛘᴹњᆹ‫ޘ‬ф᜹ᘛⲴ᪙ᢈ҈僁Ǆഐ↔㾱䇠ᗇˈᆹ‫ޘ‬ㅜаʽ䳵傜૸ሶ䱶㔝Ⲵ᧒㍒ᴹ‫ޣ‬ӗ૱䇮䇑оࡦ䙐ᯩ
䶒ⲴᱻॷᵪՊǄѪ↔ˈ↔ঠࡧवਜ਼⵰ᰦлᴰᖃࡽⲴӗ૱䍴䇟ˈնᛘⲴ᪙ᢈ䖖о↔᡻޼ҏՊᴹቁ䇨ᐞᔲǄྲ᷌ᴹԫօ‫ޣ‬Ҿ↔
᡻޼Ⲵ⯁䰞ˈ䈧૘䈒䳵傜૸᪙ᢈ㓿䬰୶Ǆ
EWA10032
䈧൘᫽֌↔᪙ᢈ䖖ѻࡽ‫ݸ‬ሿᗳᒦᆼᮤൠ䰵䈫↔᡻޼
᡻޼䟽㾱䍴䇟
EAU10134
↔᡻޼ᱟԕԕлⲴ䇠ਧᶕ४࠶䟽㾱Ⲵ䍴ᯉ˖
䘉ā⮉᜿ᆹ‫ޘ‬āⲴㅖਧ⭘᜿ᱟā⌘᜿āʽ䈧䆖ᜅ֐Ⲵᆹ‫ޘ‬ʽ
ᘭ⮕䘉ā䆖੺āⲴᤷ⽪ˈਟ㜭Պሬ㠤᪙ᢈ僁༛ˈઘതⲴӪˈỰḕᡆ‫⭥↔⨶؞‬
অ䖖ⲴӪѕ䟽ᦏՔᡆ↫ՔǄ
⌘᜿ 䘉Ā⌘᜿āⲴ⭘᜿ᱟĀᗵ享䟷ਆ⢩࡛⌘᜿Ⲵ↕僔ԕ䱢→᪙ᢈ䖖ਇࡠᦏՔāǄ
ᨀ⽪ Āᨀ⽪āᱟᨀ‫׋‬㋮㾱Ⲵ䍴䇟ԕ‫ׯ‬䇙֯⭘↔ሿ᡻޼ⲴӪᴤ␵ᾊᡰ㾱⌘᜿Ⲵ↕僔Ǆ
ӗ૱઼㿴Ṭྲᴹਈᴤˈᚅнਖ㹼䙊⸕Ǆ
᡻޼䟽㾱䍴䇟
EAUV0012
YZF155
ࡍ⡸ᒤᴸ
ⴞᖅ
䟽㾱ḷㆮⲴս㖞 ᫽֌઼䟽㾱Ⲵ僁㹼⛩ Ựḕ⋩䰘ᢺ᡻

≄䰘䰤䳉
ᆹ‫ؑޘ‬᚟ ѪҶᛘⲴᆹ‫ޘ‬᫽֌ࡽ 䖞㛾
ᴤཊᆹ‫ޘ‬僁䖖⛩
ཤⴄ ⲴỰḕ 䬨䙐䖞
੟ࣘਁࣘᵪ 䈳㢲⿫ਸಘᵶ㠚⭡䰤䳉
䈤᰾ ਈ䙏
ᐖ㿶മ Ựḕࡽਾࡩ䖖⡷
䱽վ⋩㙇Ⲵᢰᐗ
ਣ㿶മ Ựḕࡦࣘಘ⏢ս
᧗ࡦ઼Ԛಘ ਁࣘᵪ⼘ਸ
Րࣘ䬮ᶮᕋ
‫ڌ‬䖖
Ԛಘ઼᧗ࡦ࣏㜭䈤᰾ ␵⌱ᒦ⏖━Րࣘ䬮
ѫᔰ‫ޣ‬䖜ੁ䬱 Ựḕᒦ⏖━⭥㔶
䫕ॉⴆ
ѪҶᛘⲴᆹ‫ޘ‬᫽֌ Ựḕᒦ⏖━⋩䰘ᢺ᡻
ᤷ⽪⚟઼䆖੺⚟
ཊ࣏㜭ᱮ⽪ቿ ࡽỰḕ ઼⭥㔶
䖖ᢺᔰ‫ޣ‬ ᇊᵏ㔤ᣔ઼䈳ᮤ ⏖━ࡽਾࡦࣘᵶ
⿫ਸಘᵶ ᐕާव
ᦒẓ䐿ᶯ Ựḕ઼⏖━ѝ䰤᭟઼ᷦ
ࡦࣘᵶ ᧂ᭮᧗ࡦ㌫㔏Ⲵᇊᵏ㔤ᣔ㺘 ‫ח‬䶒᭟ᷦ
ࡩ䖖䐿ᶯ 㔤ᣔ઼⏖━മ
⏖━᩷㟲᷒䖤
⋩㇡ⴆ ᣶ন઼ᆹ㻵ᮤ⍱㖙઼䶒ᶯ
⟳⋩ Ựḕࡽ৹
Ựḕ⚛㣡ຎ
ۜॆ䖜ॆಘ Ựḕ䖜ੁ
ᓗս ਁࣘᵪᵪ⋩઼└⋩ಘ
ཤⴄᷦ ߧত⏢ Ựḕ䖞⇲䖤᢯
‫ח‬ᷦ 䈳ᮤਁࣘᵪᙐ䙏 ⭥⊐
⛩⚛എ䐟࠷ᯝ㌫㔏 ᴤᦒ‫؍‬䲙э
ⴞᖅ
བྷ⚟
䖵ࣙ⚟⌑
ቮ⚟ࡩ䖖⚟
ᴤᦒ䖜ੁ⚟⚟⌑
᭟ᤱ᪙ᢈ䖖
ࡽ䖞
ਾ䖞
⯁䳮䀓ㆄ
━ᶯ䖖ᣔ⨶઼ۘᆈ
ᣔ⨶
ᆈۘ
㿴Ṭ
⎸䍩㘵ؑ᚟
㍒ᕅ
䟽㾱ḷㆮⲴս㖞
䰵䈫৺Ҷ䀓ᡰᴹ൘⭥অ䖖ⲴḷㆮǄᆳवਜ਼Ҷᆹ‫⺞↓઼ޘ‬᫽֌Ⲵ䟽㾱䍴䇟Ǆ䈧н㾱 EAU10385
1
᫅ᦹ⭥অ䖖ⲴԫօḷㆮǄྲ᷌ḷㆮਈᗇ⁑㋺Ҷᡆᶮ㝡ˈਟԕࡠ䟾傜૸ԓ⨶୶亶ਆᴯԓḷㆮǄ
1 2 3
1-1
䟽㾱ḷㆮⲴս㖞
1
1 2
൘֯⭘䘉⭥অ䖖ԕࡽˈ
䈧‫⭘֯࠶ݵ‬䘉ሿ᡻޼Ǆ 100kPa=1bar kPa, psi kPa, psi
䲀䖭 225, 33 220, 36
䫙ᆀ˖.Jᓗսⴂᆀ˖.J
ࡽ㇡˖.J 225, 33 250, 36
1-2
1- ᆹ‫ؑޘ‬᚟
EAU1028B
z ࠷य᫽֌⋑ᴹ䘲ᖃⲴษ䇝ᡆᤷሬⲴ᪙ᢈ
䖖Ǆԕањษ䇝䈮〻Ǆࡍᆖ㘵ᓄ䈕Ӿ᧕
ᡀѪањ䍏䍓ԫⲴ䖖ѫ ਇษ䇝ਸṬⲴᮉᐸǄ㚄㌫ᦸᵳ᪙ᢈ䖖㓿
2 䓛Ѫ᪙ᢈ䖖Ⲵ䖖ѫˈᛘᴹ䍓ԫᆹ‫઼ޘ‬ᚠ 䬰୶˛⅑ࠪᴹ‫ޣ‬ษ䇝䈮〻ᴰ䘁֐Ǆ
ᖃ᫽֌ᛘⲴ᪙ᢈ䖖Ǆ
᪙ᢈ䖖ᱟঅ䖘Ӕ䙊 ഐ↔˖
ᐕާǄަᆹ‫⭘֯ޘ‬о᫽֌ᴹ䎆Ҿ↓⺞҈ Ǆ䓛クаԦ㢢ᖙ勌㢣Ⲵཆ྇Ǆ
僁ㅹ਼Ҿу䰘ᢰ㜭᫽֌ӪઈǄ⇿њ᫽֌ Ǆ⇿ᖃᛘ䶐䘁઼クờӔ৹䐟ਓ䈧ᛘṬ
㘵൘҈僁↔᪙ᢈ䖖ѻࡽᗵ享⸕䚃ԕлᤷ ཆሿᗳˈഐѪӔ৹䐟ਓᱟ᪙ᢈ䖖ᴰ
⽪˖ ᆹ‫҈ޘ‬僁 ᑨਁ⭏Ӕ䙊᜿ཆⲴൠᯩǄ
Ԇᡆྩᓄ䈕˖
൘⇿⅑ᛘ֯⭘↔Ӕ䙊ᐕާࡽ䘋㹼ֻ㹼Ự Ǆ҈僁ᰦ⺞‫ަ؍‬Ԇ᪙ᢈ僁༛ਟԕⴻࡠ
ḕԕ⺞‫ަ؍‬༴Ҿᆹ‫Ⲵޘ‬ ᫽
֌Ǆ
⣦ߥ ᛘ ˈ䚯‫ ҈ݽ‬僁 ൘ ަԆ 傮䖖Ӫ༛Ⲵ
ǄӾ喀‫Ⲵޘ‬ᶕⓀѝ㧧ᗇᴹ‫ޣ‬᪙ᢈ䖖᫽֌䈖
ᰐ⌅ᴹ᭸Ựḕᡆ‫ޫ؍‬Ӕ䙊ᐕާሶՊᨀॷ ⴢ⛩ս㖞Ǆ
ᛵⲴ䈤᰾
Ǆ䙊䗷↔֯⭘᡻޼⌘᜿ަ䆖੺о㔤‫؞‬㾱≲ ᜿ཆਁ⭏Ⲵਟ㜭ᙗо䇮༷ᦏൿ䈧৲㘳
Ǆ㧧ᗇਸṬⲴᆹ‫ޘ‬ษ䇝઼ᚠᖃⲴ҈僁ᢰᵟ ㅜ 亥䘋㹼ֻ㹼ỰḕⲴ␵অǄ t ≨䘌н㾱‫؍‬ᤱањ᪙ᢈ䖖ྲ
Ǆ൘֯⭘᡻޼㧧ᗇуъᢰᵟᴽ࣑Ⲵ⸕䇶઼ ᷌⋑ᴹ䘲ᖃⲴ⸕䇶Ǆ㚄㌫ᦸ
ᡆ൘ᵪỠ⣦ߥ䴰㾱ᰦ֌ࠪ৲㘳Ǆ Ǆ ↔᪙ᢈ䖖Ⲵ䇮䇑ਟ⭘ԕ䘀䘱᫽֌Ӫઈ ᵳⲴ᪙ᢈ䖖㓿䬰୶੺⸕֐ส
઼҈ᇒǄ ᵜ᪙ᢈ䖖㔤‫؞‬ǄḀӋ㔤‫؞‬ਚ
Ǆ᪙ᢈ僁༛ᵚᴹሏ㿹઼䇶࡛൘‫ޜ‬䐟㹼傦㜭䙊䗷䇔䇱ⲴӪઈ䘋㹼Ǆ
ᰦⲴ᪙ᢈ䖖ᱟӔ䙊᜿ཆਁ⭏ᴰѫ㾱Ⲵ
৏ഐǄ䇨ཊӔ䙊᜿ཆਁ⭏Ҿ⊭䖖ਨᵪ
⋑ᴹⴻࡠ᪙ᢈ䖖ǄѪҶ߿ቁ↔㊫Ӕ䙊
᜿ཆⲴਁ⭏ᴰᴹ᭸ⲴⲴᯩ⌅ᱟ֯㠚ᐡ
ケࠪᱮ⧠Ǆ
2-1
1- ᆹ‫ؑޘ‬᚟
Ǆ䇨ཊ᜿ཆਁ⭏⎹৺ᯬᰐ㓿傼Ⲵ᫽֌㘵 Ǆ൘䖜ᕟᡆ䖜ᦒᯩੁࡽ㓿ᑨ㔉Ҹؑ
t 䱢ᣔᴽ
Ǆһᇎкˈ⎹৺Ӕ䙊᜿ཆⲴ᫽֌㘵⭊ ਧ⚟ԕ⺞‫ަ؍‬Ԇ᪙ᢈ僁༛ਟԕⴻ ཤ䜘䟽ࡋᱟ᪙ᢈ䖖᜿ཆਁ⭏Ⲵѫ㾱↫ഐǄ
㠣⋑ᴹ傮➗Ǆ ࡠᛘǄ
ᆹ‫ޘ‬㻵༷Ⲵ֯⭘ᱟѪҶ䚯‫ݽ‬ф߿ቁཤ䜘 2
tǄ⺞‫؍‬ᛘᱟਸ ṬⲴ᫽֌㘵
фᛘਚ
ُ
ᛘ
Ⲵ Ǆ᫽֌㘵઼҈ᇒⲴ҈僁ု࣯ᱟሩᆼᮤⲴ
z
᧗ࡦ䶎ᑨ䟽㾱㾱ⲴǄ ਇࡋǄ
᪙ᢈ䖖㔉ަԆ
ਸṬⲴ
᫽
֌
㘵
Ǆ
ǄҶ䀓ᛘⲴᢰᵟ઼䲀ࡦˈ‫⮉ڌ‬൘ᛘⲴ䲀 Ǆ㓿ᑨ֙ᡤਇ䇔ਟⲴཤⴄǄ
t
ࡦ㤳ത޵ᴹࣙҾᛘ䚯‫⎹ݽ‬৺Ӕ䙊᜿ཆ tǄ൘᫽֌ᵏ䰤ˈ᫽֌㘵ᗵ享‫؍‬ᤱৼ Ǆᡤ䶒㖙ᡆᣔⴞ䮌Ǆ
Ⲵਁ⭏Ǆ ᡻༴Ҿ䖖ᢺ઼ৼ㝊༴Ҿ䐿ᶯк ˈ
Ǆ ԕ‫؍‬ᤱ᪙ᢈ䖖Ⲵ᫽᧗Ǆ ൘࡞仾ᰦᴹࣙҾ‫؍‬ᣔᛘⲴ⵬ⶋ઼໎ᕪ㿶
tᡁԜᔪ䇞ᛘ൘Ӕ䙊∄䖳н㑱ᘉⲴᰦ⇥ 㓯ԕ䚯‫ݽ‬ᔦ䘏ⴻࡠড䲙ⲴᛵߥǄ
ᇎҐᛘ᪙ᢈ䖖ⴤࡠᛘ䶎ᑨ⟏ᚹҾᛘ᪙ t ҈ᇒᗵ享ᨑ⵰᫽֌㘵ǃᓗᑝᑖᡆ
ᢈ䖖ᯩ䶒Ⲵ᧗ࡦǄ Ǆཆ྇ǃ䟽䶤ǃ㼔ᆀǃ᡻྇ㅹⲴ֯⭘ਟ
ᣃᢺྲᴹ㻵䝽˅Ǆ ҈ᇒᗵ䴰‫ ؍‬ᤱ 䱢→ф߿ቁᬖՔᡆࢢՔǄ
ৼ ᡻പ ᇊ
઼ৼ㝊༴Ҿ҈ᇒⲴ䐿ᶯ
䇨ཊӔ䙊᜿ཆⲴਁ⭏Ⓚ㠚Ҿ᪙ᢈ䖖 Ǆ࠷यクᇭᶮⲴ㺓ᴽˈ੖ࡉᆳԜ঑൘᧗
Ǆ䈧 ࠷य䖭䘱҈ᇒˈ䲔䶎Ԇᡆྩ
᫽֌㘵Ⲵ⮿ᘭˈަѝањިරⲴ⮿ ࡦᶐᵶˈ㝊䐿ᶯᡆ䖖䖞ሶՊ䙐ᡀՔᇣ
ਟԕっ ᇊ Ⲵ䐿൘㝊䐿 ᶯǄ
ᘭᱟ᫽֌㘵൘䖜ᕟᰦ䎵䎺㠚ᐡⲴ䐁 ઼᜿ཆਁ⭏Ǆ
䚃ˈަ৏ഐᱟ᫽֌㘵䎵䙏ᡆ䖜ᕟн z ҈ 僁᪙ᢈ䖖ᰦ࠷य侞⭘䞂㋮ᡆᱟ┕ Ǆ㓿ᑨ䓛ク䱢ᣔᴽ㾶ⴆ⵰ᛘⲴৼ㝊ˈ㝊
ཏ˄нཏ䖜ᕟ䀂ᓖ˅Ǆ ⭘∂૱Ǆ 䑍ˈᒦ㝊Ǆ᫽֌ਾᕅ᫾ᡆᧂ≄㌫㔏Պ
Ǆ㓿ᑨ䚥ᆸ䖖䙏Ⲵ䲀ࡦᒦн䎵䙏Ǆ z 䘉᪙ᢈ䖖ᱟуѪ‫ޜ‬䐟кਚ֯⭘Ǆᆳ ਈᗇᖸ✝ˈᒦሬ㠤✗ՔǄ
t
н䘲ਸሩҾ䎺䟾⭘䙄Ǆ
Ǆ҈ᇒҏᗵ享䚥ᆸк䘠Ⲵᆹ‫᧚ޘ‬ᯭ
2-2
ᆹ‫ؑޘ‬᚟
䱢→а≗ॆ⻣Ⲵѝ∂
䈧࡛൘᧕䘁ᔪㆁ⢙Ⲵᇔཆ䎧ࣘᕅ᫾ ᖃ൘䘉њ䟽䟿䲀ࡦ䍏㦧ˈ䈧䇠տԕлࠐ
ᡰᴹਁࣘᵪᧂ≄㌫㔏वਜ਼㠤ભⲴ≄փ˖ ˈഐѪᕅ᫾Ⲵᧂ≄ਟԕ䙊䗷オ⍎ֻ ⛩˖
а≗ॆ⻣Ǆ੨䘋а≗ॆ⻣ਟ䙐ᡀཤⰋǃ ྲ˖デਓ઼䰘ᡧ㘼䘋‫ޕ‬ᔪㆁ⢙޵Ǆ
2 ᢃⶼⶑǃઅੀǃ䘧ҡǃ㘼ሬ㠤ᴰ㓸↫ӑǄ
䍗⢙઼䝽ԦⲴ䟽䟿ᓄ‫؍‬ᤱ䖫‫઼ׯ‬ቭ
а≗ॆ⻣ᱟа⿽ᰐણᰐ㢢Ⲵ≄փˈণ֯ ਟ㜭䍤䘁᪙ᢈ䖖ˈᒦᆹ‫ޘ‬ൠव㻵ᛘ
ᛘⴻнࡠˈ䰫нࡠԫօਁࣘᵪⲴᧂ≄ˈ 㻵䖭˖
↔≄փҏਟ㜭ᆈ൘Ǆа≗ॆ⻣㠤ભ≤ᒣ 䱴࣐䝽Ԧᡆ䍗⢙ᯬᛘⲴ᪙ᢈ䖖ਟѕ䟽ᖡ ᴰ䟽Ⲵ⢙૱ྲ᧕䘁ަ䖖䖶Ⲵ䟽ᗳᒦ
ᱟᆳਟ䗵䙏᭦䳶նҏਟԕ䗵䙏‫ݻ‬ᴽˈ⭊ ૽ަっᇊᙗ઼᫽᧗ˈഐѪ᪙ᢈ䖖䟽䟿Ⲵ ⺞‫؍‬൷रⲴ࠶䝽㠣᪙ᢈ䖖Ⲵ䟽䟿Ⲵ
㠣੨ਾᰐ⌅㻛᤟ᮁǄ↔ཆˈ൘ሱ䰝ᡆオ ࠶ᐳᐢ᭩ਈǄѪҶ䚯‫ݽ‬᜿ཆਁ⭏Ⲵਟ㜭 є䗩ԕ߿վнᒣ㺑઼нっᇊǄ
≄н⍱䙊Ⲵൠᯩа≗ॆ⻣㠤ભ≤ᒣਟԕ ᙗˈᖃᛘ䱴࣐䍗⢙ᡆ䝽ԦᯬᛘⲴ᪙ᢈ䖖
ˈ䈧Ṭཆ䉘᝾Ǆ 䖜〫䟽䟿ਟԕᕅ䎧ケ❦䰤Ⲵнᒣ㺑
㤏ᔦࠐњሿᰦᡆࠐཙǄྲ᷌ᛘᴹа≗ॆ
Ǆ⺞‫؍‬䝽Ԧ઼䍗⢙Ⲵᆹ‫ޘ‬䳦኎൘҈
⻣ѝ∂Ⲵ⯷⣦ˈ䈧・࡫⿫ᔰ䈕ൠ४ˈ৫ ⇿ᖃᛘ҈僁ᐢ䱴࣐Ҷ䍗⢙ᡆ䝽ԦⲴ᪙ᢈ
僁᪙ᢈ䖖ѻࡽǄ㓿ᑨỰḕ䝽Ԧ҈඀
બ੨ᯠ勌Ⲵオ≄ˈণੁ५⭏≲䇺Ǆ 䖖ˈ䈧ᛘṬཆሿᗳǄ൘↔ˈྲ᷌ᛘⲴ᪙
઼䍗⢙Ⲵ䲀ࡦǄ
䈧н㾱൘ᇔ޵䎧ࣘᕅ᫾Ǆণ֯ᛘቍ ཊ䖖ᴹ㻵к䖭䍗㇡ˈԕлⲴ䝽Ԧ䍴ᯉᱟ
䈅⭘仾ᡷᡆᢃᔰデᡧ઼䰘ᶕᧂ৫ᕅ а㡜享䚥ӾⲴᤷই˖ Ь䘲ᖃ䈳ᮤᔦ㕃ᛘⲴ㻵䖭ˈᒦỰḕᛘ
᫾ᓏ≄ˈа≗ॆ⻣Ⲵᢙᕐ‫❦׍‬ਟ䗵 ᫽֌㘵ǃ҈ᇒǃ䝽Ԧ઼䍗⢙ᙫ䟽䟿аᇊ 䖞㛾Ⲵ⣦ߥ઼঻࣋Ǆ
䙏䗮ࡠড䲙≤ᒣǄ н㜭䎵ࠪᴰ儈Ⲵ䍏㦧䲀ࡦǄ䎵䖭ⲴӔ䙊 Ьн㾱൘䖖ᢺǃࡽ৹ᡆࡽᥑ⌕ᶯ䱴࣐
൘䜘࠶ሱ䰝ᡆ䙊仾н㢟Ⲵൠᯩֻ ᐕާⲴ䘀㹼ਟ㜭Պሬ㠤᜿ཆⲴਁ⭏Ǆ ԫօབྷරᡆ䟽රⲴ⢙փˈ䘉Ӌ⢙փ
ྲ˖ԃᓃǃ䖖ᓃᡆ䖖ᡯˈ䈧࡛੟ࣘ ǃަѝवᤜ䍗⢙ǃⶑ㺻ǃ㹼ᵾ㺻ᡆ
ᴰབྷ䍏䖭˖ ᑀ㈧ˈਟԕᕅ䎧нっᇊⲴ᫽᧗ᡆվ
ᛘⲴᕅ᫾Ǆ 168 ‫ޜ‬ᯔ (370 ⻵)
䙏䖜ੁ৽ᓄǄ
2-3
ᆹ‫ؑޘ‬᚟
↔Ӕ䙊ᐕާⲴⴞⲴн䘲⭘Ҿᤆ᣹䖖 ୞ਾ䝽Ԧˈ䱴Ԧ઼‫؞‬᭩ Ь䝽Ԧᆹ㻵൘䖖ᢺᡆ䗱ᔪ४ฏਟԕ
ᡆ䱴࣐䗩䖖Ǆ 㲭❦ᛘਟ㜭Պਁ⧠୞ਾⲴӗ૱㊫լо↓ ᕅнᖃⲴ䟽䟿࠶ᐳᡆオ≄⍱ࣘ࣋
⡸䳵傜૸Ⲵ䝽Ԧˈ䇶࡛ḀӋ୞ਾ䝽Ԧᡆ Ⲵਈॆ㘼ᕅ䎧нっᇊǄྲ᷌䝽Ԧ
2
‫؞‬᭩ሶေ㛱ᛘᡆԆӪⲴᆹ‫ޘ‬Ǆᆹ㻵୞ਾ 䱴࣐൘䖖ᢺᡆࡽ৹ս㖞ˈᆳԜа
↓⡸䳵傜૸䝽Ԧ
ӗ૱㠣ᛘⲴ᪙ᢈ䖖ᡆަԆ‫؞‬᭩ǃ᭩ਈԫ ᇊ㾱ᱟ䖫䟿㓗Ⲵᒦфቭਟ㜭‫؍‬ᤱ
ѪᛘⲴ᪙ᢈ䖖ᛜ⵰ྭⲴ䝽Ԧᱟњ䟽㾱Ⲵ
օ᪙ᢈ䖖Ⲵ䇮䇑ᡆ᫽֌⢩ᖱਟԕԔ֐֐ ൘ᴰվ䲀ᓖǄ
ߣᇊǄᛘਚਟ൘䳵傜૸䬰୞୶㧧ᗇ↓⡸
઼ަԆӪ䶒ѤᴤབྷⲴѕ䟽Քᇣᡆ↫ӑⲴ Ь⭡Ҿオ≄⍱ࣘ࣋Ⲵᖡ૽ˈㅘ䟽ᡆ
䳵傜૸Ⲵ䝽Ԧˈᡰᴹ䝽Ԧ䜭㓿⭡䳵傜૸
ড䲙Ǆᛘᴹ䍓ԫ䍏䍓᪙ᢈ䖖Ⲵ᭩ਈᡰ䙐 བྷරⲴ䝽Ԧਟ㜭ѕ䟽ᖡ૽᪙ᢈ䖖
䇮䇑ˈ⍻䈅઼ᢩ߶ԕ‫׋‬ᛘⲴӔ䙊ᐕާᡰ
ᡀⲴՔᇣǄ Ⲵっᇊˈབྷ仾ਟ㜭Պ੩䎧᪙ᢈ䖖
֯⭘Ǆ
䈧㍗䇠ԕл߶ࡉ ↓ྲ൘ᖃᆹ㻵䱴Ԧᰦ ᡆ൘Ӕ৹Ⲵ仾ᰦ᪙ᢈ䖖Պਈᗇн
䇨ཊᰐ䘎᧕Ҿ䳵傜૸Ⲵ‫ޜ‬ਨᡰࡦ䙐Ⲵ䴦っᇊǄ൘㓿䗷བྷර䍗䖖ᰦᡆ㻛㓿
Ԧ઼䝽ԦᡆᱟѪᛘⲴ䳵傜૸䖖䖶ᨀ‫׋‬ԫ Ā㻵䖭āѝᡰᨀ‫Ⲵ׋‬䍴ᯉ˖
䗷ᰦˈ䘉Ӌ䝽Ԧਟ㜭Պ䙐ᡀнっ
օ‫؞‬᭩ⲴǄ䳵傜૸ᱟнՊ⍻䈅Ā୞ਾᐲ ᇊǄ
൪ā‫ޜ‬ਨᡰ⭏ӗⲴӗ૱Ǆഐ↔ˈ䳵傜૸ ƽ࠷यᆹ㻵䝽Ԧᡆᩪᑖ䍗⢙ˈሶᦏᇣ
ᛘ᪙ᢈ䖖Ⲵᙗ㜭Ǆ൘֯⭘ࡽˈԄ㓶 ЬḀӋ䝽Ԧਟԕਆԓަ↓ᑨⲴ҈僁
ᱟн䎎ᡀᡆнᔪ䇞֯⭘㘵֯⭘н൘䳵傜
ൠỰḕ䝽Ԧԕ⺞‫؍‬ᆳ൘ԫօᛵߥл Ⲵս㖞Ǆ䘉н䘲ਸⲴս㖞Պ֯᫽
૸ࠪ୞Ⲵ䝽Ԧᡆԫօ⋑ᴹ㓿⭡䳵傜૸Ṩ
нՊ߿ቁൠ䶒Ⲵ䀓䀖ᡆ䖜ᕟⲴൠ䶒 ֌㘵൘ᴹࡦⲴ㠚⭡オ䰤᫽֌઼ਟ
߶Ⲵ‫؞‬᭩ˈণ֯ᱟ⭡䳵傜૸㓿䬰୶ࠪ୞
᧕䀖ǃ߿䴷ಘⲴ〫ࣘ䲀ࡦˈ䖜ੁᵪ 㜭Պ䲀ࡦަ᧗ࡦ㜭࣋ˈഐ↔䘉㊫
ᡆᆹ㻵ⲴǄ
ᶴⲴ䖜ࣘᡆ᧗ࡦǃਜ਼㋺н␵Ⲵ⚟ᡆ 䝽Ԧн㻛᧘㦀Ǆ
৽‫ݹ‬䮌Ǆ ƽᖃ䝽Ԧ࣐‫ޕ‬ᰦ㾱ሿᗳ֯⭘⭥ᆀӗ૱
Ǆྲ᷌⭥ᆀ䝽Ԧ䎵ࠪ᪙ᢈ䖖⭥ᆀ㌫
㔏Ⲵᇩ䟿ਟ㜭Պሬ㠤⭥ᆀ᭵䳌ˈ䘉
Պ䙐ᡀ⚟‫ݹ‬ᡆᕅ᫾ࣘ࣋䖜ᕡⲴড䲙
Ǆ
2-4
ᆹ‫ؑޘ‬᚟
EAU57610
୞ਾ䖞㛾઼䖞䖻 ᡆ䖜ੁ⚟ˈᡆ䜘Ԧਟԕᢃ⹤Ǆ Ь➎䖖Ⳟਟ㜭൘⍇䖖ᰦᔴ⒯Ǆᖃ⍇ᆼ

ᛘⲴ᪙ᢈ䖖Ⲵ䖞㛾઼䖞䖻䇮䇑ᱟѪҶ䝽䘹ᤙ䘲ਸ㛙ᑖⲴս㖞Ԅ㓶ᡰԕ ਾˈ傮傦ࡽ䈧Ựḕ➎䖖ಘǄ
ਸᙗ㜭㺘⧠ˈᒦᨀ‫׋‬Ҷ᫽᧗ǃ➎䖖઼㡂㛙ᑖሶ䪸ሩ⋩┶㺘䶒൘䘀䗃䗷
2 Ьᙫᱟク⵰䫒ⴄǃ᡻྇ǃ㼔ᆀ˄ᢺ㻆
䘲Ⲵᴰ֣㓴ਸǄަԆ䖞㛾ˈ䖞䖻ˈབྷሿ 〻ѝнᬖǄ ਓ઼㝊Ⲵઘതᣈ䎧ˈԕ䱢伈ࣘ˅઼
઼㓴ਸਟ㜭нՊ䘲ᖃⲴǄ䈧৲䰵ㅜ z䈕ᛜ⎞⏢ᓄᴹᡰ⭡㌫⮉㻛঻㕙 аԦ᰾ӞⲴᖙཀྵ‫ݻ‬Ǆ
亥˖䖞㛾㿴Ṭ઼ᴤཊؑ᚟ᶕᴤᦒ䖞㛾Ǆ ˈྲ᷌ਟ㜭Ⲵ䈍ˈ䘉ṧⲴᵪࣘ Ьн㾱ᩪᑖཚཊ㹼ᵾˈԕ‫ݽ‬ᖡ૽っᇊ
Ҽ䖞䖖нՊ൘䘀䗃䗷〻ѝ䗷࠶ ᙗǄ
䘀䘱᪙ᢈ䖖 ൠ৽ᕩǄ
⺞‫؍‬䘀䘱᪙ᢈ䖖൘ਖа䖶䖖ࡽˈ㿲ሏ 䘋а↕Ⲵᆹ‫ޘ‬㾱⛩
л䶒Ⲵ䈤᰾Ǆ Ьᖃ䴰㾱䖜ᕟᰦˈ䈧⺞‫ࠪ֌؍‬᰾⺞␵
zਆл᪙ᢈ䖖Ⲵᡰᴹ⢙૱ᶮࣘǄ ᾊⲴ䇟ਧ
zỰḕ⟳⋩ᔰ‫ྲ˄ޣ‬᷌䝽༷˅༴ Ь൘▞⒯Ⲵ䚃䐟➎䖖ᱟ䶎ᑨ䳮ⲴǄ䚯
‫ݽ‬ཚ⭘࣋Ⲵ➎䖖ˈԕ‫ق━ݽ‬Ǆᖃ൘
Ҿ‫ޣ‬䰝ս㖞ˈᒦф⋑ᴹ⟳⋩⋴
▞⒯ⲴൠᯩˈᓄធធⲴ䑙ࡩ䖖ಘ➎
┿Ǆ
䖖Ǆ
z⛩ࡽ䖞↓ࡽᯩⲴᤆ䖖ᡆ঑䖖ᓅ Ь൘᧕䘁䖜ᕟ༴ᰦˈ᭮ធ䙏ᓖǄ䖜ᕟ
ⴈˈᒦઋᆳ൘ањ䫱䐟ˈԕ䱢 ਾˈ᡽ធធⲴ࣐䙏Ǆ
→䘀ࣘǄ Ьᖃ㓿䗷‫⋺ڌ‬༴ᰦˈ享ሿᗳ䖖䖶Ǆᖃ
zᦒẓ喯䖞ⲴՐࣘ㻵㖞˄⭘Ҿ⁑ ਨᵪᢃᔰ䰘ᰦˈԆн㜭൘ᛘⲴ䐟ᖴ
රо᡻ࣘਈ䙏ಘ˅Ǆ ⴻ㿱ᛘǄ
z⺞‫؍‬о㌫⮉ᡆ䱴䇮ҾᵪࣘҼ䖞 Ь䫱䐟⁚䎺ˈ䐟䶒⭥䖖ḿᵶǃ䚃䐟ᔪ
䖖Ⲵപփԭˈ䈨ྲᑗᡆкࡽ৹ ㆁѝᗳⲴ䫱⻏ᆀ઼㔤‫؞‬ᐕӪ਼‫؍‬ᣔ
й䟽ཀྵ䫣ਸ䘲㛼ᑖ᪙ᢈ䖖˄㘼 ⴆᖃ▞⒯ᰦᖸᇩ᱃━‫ق‬Ǆ᭮ធ䙏ᓖ
нᱟˈֻྲˈԕₑ㜦ᆹ㻵䖖ᢺ ˈሿᗳ䖖䖶৺‫؍‬ᤱ⭥অ䖖ⴤ・ˈԕ
‫ق━ݽ‬Ǆ

2-5
1- ᆹ‫ؑޘ‬᚟
EAUN0532
ཤⴄ ↓⺞⭘⌅ t ॺ亦ᔿᆹ‫ޘ‬ᑭ䘲Ҿվ㠣ѝ䙏傮傦
ᩪᑖн㧧ᢩ߶Ⲵ᪙ᢈ䖖ཤⴄ㓿㩕䘉䖶䖖
ሶ໎࣐֐Ⲵཤ䜘ѕ䟽ਇՔᡆ↫ӑⲴһ᭵
ᵪՊǄ᪙ᢈ䖖һ᭵Ⲵ↫ӑཊᮠ䜭ᱟཤ䜘 2
ਇՔⲴ㔃᷌Ǆഐ↔֯⭘ᆹ‫ޘ‬ᑭⲴᱟ亴䱢
ᡆ߿ቁཤ䜘ਇՔⲴањᴰ䟽㾱Ⲵഐ㍐Ǆ
䘹ᤙ㓿ᢩ߶Ⲵ᪙ᢈ䖖ཤⴄ
൘䘹ᤙ᪙ᢈ䖖㾱⌘᜿ԕлࠐ⛩Ǆ ZAUU0005
t ཤⴄᗵ享ㅖਸĀ6,5,0āⲴᆹ‫ޘ‬ḷ߶ ZAUU0003
t ཤⴄབྷሿᗵ享о僁䖖ӪཤⲴቪረ⴨ 䭉䈟⭘⌅
३䝽
t ࠷य֯ཤⴄ䟽ᓖߢࠫ t ॺ㖙ᔿᆹ‫ޘ‬ᑭ䘲Ҿѝ㠣儈䙏傮傦
↓⺞Ⲵᡤཤⴄ
࿻㓸䘎᧕л亼ᑖǄྲ᷌л亼ᑖ䘎᧕ˈ൘
ਁ⭏һ᭵Ⲵᛵߥлཤⴄ㝡㩭ⲴⲴᵪՊՊ
ቁᗇཊǄ
ZAUU0007 ZAUU0006
2-6
ᾲ㾱
EAU10411
左图
1,2 3 4 5 6 7
9 8
བྷ⚟˄ㅜ亥˅ ᦒẓ䐿ᶯ˄ㅜ亥˅
䖵ࣙ⚟˄ㅜ亥˅
⋩㇡ⴆ˄ㅜ亥˅
オ≄└␵ಘ‫ݳ‬Ԧ˄ㅜ亥˅
⭥⊐˄ㅜ亥˅
‫؍‬䲙э˄ㅜ亥˅
ᡰᴹ㘵ᐕާ྇Ԧ˄ㅜ亥˅
‫ח‬㿶˄ㅜ亥˅
3-1
概要
右图 EAU10421
1 2 3
8 7 65 4
ਾ䖜ੁ⚟˄ㅜ亥˅
ਾࡩ䖖⚟˄ㅜ亥˅
ࡦࣘ⏢ۘ⏢ಘ˄ㅜ亥˅
ࡽ䖜ੁ⚟˄ㅜ亥˅
ਁࣘᵪᵪ⋩└␵ಘ㓴Ԧ˄ㅜ亥˅
⏖━㜲˄ㅜ亥˅
ࡦࣘ䐿ᶯ˄ㅜ亥˅
ਾࡦࣘ⏢ۘ⏢ಘ˄ㅜ亥˅
3-2
概要
1 2 3 4 5 6 7
ਾࡩ䖖᡻ᷴ˄ㅜ亥˅
ᐖ䖖ᢺᔰ‫˄ޣ‬ㅜ亥˅
ཊ࣏㜭Ԛ㺘অ‫˄ݳ‬ㅜ亥˅
ѫᔰ‫˄ޣ‬ㅜ亥˅
ਣ䖖ᢺᔰ‫˄ޣ‬ㅜ亥˅
⋩䰘ᢺ᡻˄ㅜ亥˅
ࡽࡩ䖖᡻ᷴ˄ㅜ亥˅
3-3
Ԛ㺘৺᫽㓥ಘ
EAU68550
ѫᔰ‫ࡦޣ‬䖜ੁ䬱 ᨀ⽪㾱䀓䬱ⶓሬ
t Ԛ㺘➗᰾ᶕᖃ䫕ॉ䖜ࡠĀāкǄ
OFF ON t ⟳⋩⌥ਟੜ㿱൘䫕ॉ㻛䖜ࡠĀāǄ
1 2
‫ޣ‬ 4
ᡰᴹ⭥ᆀ㌫㔏᫽֌‫→ڌ‬᫽֌ˈ䬱ॉ᡽ਟ
LOCK ԕ᤯ࠪǄ
警告 Ǆ᧘Ǆ
ᢃᔰǄ
ѫᔰ‫ࡦޣ‬䖜ੁ䬱䲔Ҷ᧗ࡦ⛩⚛઼⚟‫ݹ‬㌫ t 当电单车正在行驶时，严禁将锁匙转
㔏ཆˈ䘈ᴹ⭘Ҿ䬱㍗䖜ੁᵪᶴ઼ᢃᔰᓗ 到 “关”或“锁”，否则的话，电子系统 ˊሶᨑᢺ䖜ࡠᴰᐖ䗩Ǆ
ᑝǄ਴њᔰ‫࣏Ⲵࡦޣ‬㜭ྲлǄ 将被中断以及可能导致失控或意外。 ˊӾĀāⲴս㖞ሶ䬱ॉ᧘䘋ˈធ
ធൠᶮᔰа⛩ˈ❦ਾ৽ᰦ䫏ᯩੁ䖜
ࡠĀāⲴս㖞Ǆ
ᨀ⽪ ˊሶ䬱ॉ᤯ࠪǄ
ѫᔰ‫ࡦޣ‬䱴ᴹањ䬱ॉᆄᣔⴆǄ˄ḕⴻ
亥ⲴĀ䬱ॉᆄᣔⴆāⲴᔰ‫↕ޣ‬僔˅Ǆ 䬱
䖜ੁᵪᶴ䬱⵰ᰦˈа࠷⭥ᆀ㌫㔏ሶ㻛࠷ ᨀ⽪
ᯝǄ䬱ॉ᡽ਟԕ᤯ࠪǄ ྲ᷌䖜ੁ㻵㖞н䬱ᇊˈ䈧ቍ䈅ሶᢺ᡻
䖫䖫ੁਣ䖜Ǆ
ᔰ
ᡰᴹⲴ⭥䐟䜭ᑖᴹᵳ࣋ˈਟԕ੟ࣘਁࣘ
ᵪǄ䈕䫕ॉн㜭㻛᫔䲔
4-1
Ԛ㺘৺᫽㓥ಘ
㾱䀓䬱ⶓሬ 䬱⵬ⴆ ‫ޣ‬䰝䬱ॉᣔⴆ
1
4
Ǆ᧘Ǆ ⛩⚛䫕ॉ
Ǆ䖜Ǆ ᆹ‫ޘ‬䫕ॉ ྲമᡰ⽪ሶ䫕ॉཤᨂ‫ޕ‬䫕ॉᆄⴆᨂᓗˈ
❦ਾੁᐖ䖜ࣘ䫕ॉሶⴆ‫ޣ‬䰝
᧘䘋ᯠⲴᇶ䫕ˈ❦ਾᢺᆳ䖜ॆѪ ᢃᔰ䬱ॉᆄᣔⴆ
Ā‫ޣ‬āˈ਼ᰦ䘈᧘ࣘᆳǄ
ZAUU0591
ᨂ‫ޕ‬ᣔⴆ䬱ॉࡠ䬱ॉᆄᣔⴆⲴᨂᓗ䟼
˄ྲമ˅ˈ᧕⵰ᢺ䬱ॉ䖜ੁᐖ䗩ቡᢃ
ᔰᣔⴆǄ
4-2
仪表及操纵器
指示灯和警示灯远光指示灯“ ”
t 若引擎过热，看7-38页。
当远光被开着时，远光指示灯将亮起。
4
发动机故障警示灯“ ”
冷却器温度警告“ ” 引擎监视器故障时，此警示灯将亮起或
3 5 闪灯。
2 6 若故障，请联络雅马哈代理检查自我诊
1 引擎太热时，此警告灯将亮起。当发生
4
时，马上停止引擎及让引擎冷却。断系统。
转锁匙去“ ”，以检查警告灯的电路系转锁匙去“ ”，以检查警告灯的电路系
统。若在几秒之后，警告灯没亮着，请统。若在几秒之后，警告灯没亮着，请
ਁࣘᵪ᭵䳌䆖⽪⚟Āā
ߧত⏢⑙ᓖ䆖੺⚟Āā 雅马哈代理商检查电路系统。雅马哈代理商检查电路系统。
ѝᙗᤷ⽪⚟Āā
䖜ࣘᤷ⽪⚟ 注意䖜ᦒᤷ⽪⚟
ᢃᔰؑਧᤷ⽪⚟Āā 䈕ᤷ⽪⚟ਟԕ䇮㖞Ѫ൘ਁࣘᵪ䖜䙏ᰦᢃ
䘌‫⚟ݹ‬ᤷ⽪⚟Āā 若引擎过热，请别操作引擎。 ᔰᡆ‫ޣ‬䰝ˈ䘉ሩҾ䙊⸕傮傦ઈ‫ޣ‬Ҿሶẓ
սᦒẓ㠣ᴤ儈࣐䙏ᓖⲴᰦ䰤ᱟᴹ࡙Ⲵ઼
注 ᴹ⭘ⲴǄ˄ᴹ‫ޣ‬ᤷ⽪⚟Ⲵ䈖㓶䈤᰾ˈ䈧
空档指示灯“ ” ৲䰵ㅜ亥Ǆ˅
t 装有散热器风扇的摩托车，散热器
当变速器在空档时，这指示灯将亮起。风扇将根据散热器的冷却温度自动
开关。
转向指示灯 “ ”
⴨ᓄⲴᤷ⽪⚟䰚⛱ᰦˈ䖜ੁؑਧᔰ‫᧘ޣ‬
ࡠᐖ‫ח‬ᡆਣ‫ח‬Ǆ
4-3
仪表及操纵器
䙊䗷ሶ⛩⚛䫕ॉ䖜ࡠĀāս㖞ᶕỰ 多功能仪表
ḕ↔䆖⽪⚟Ⲵ⭥䐟Ǆ䆖੺⚟нᓄӞࠐ
。䫏ˈ❦ਾ➴⚝Ǆྲ᷌⛩⚛䫕ॉ‫⅑׍‬
7 6 请在停车时才更改多功能仪表的设定。
行驶时改设定会分散驾驶着的注意，然
䖜ࡠĀāս㖞ˈᡆ㘵䆖੺⚟Ӟ䎧ˈ
而增加车祸风险。
䆖੺⚟нӞˈ䈧㾱≲䳵傜૸㓿䬰୶Ự
ḕᛘ䖖䖶Ⲵ⭥䐟Ǆ 5
8 4 多功能仪表装置一下：
Ь䙏ᓖ䇑
Ь⟳⋩㺘
1 2 3
4 Ь99$ᤷ⽪ಘ
Ь䖜䙏䇑
Ā䘹ᤙā᤹䫞 Ьਈ䙏㇡ẓսᱮ⽪
Ā༽սā᤹䫞
䖖䙏㺘 Ьཊ࣏㜭ᱮ⽪ಘ
⟳⋩㺘 Ьਈ䙏ಘẓսᤷ⽪⚟
99$˄ਟਈ≄䰘傡ࣘ˅ᤷ⽪ಘ Ь㠚䇺ᯝ㻵㖞
䖜䙏䇑
ਈ䙏㇡ẓսᱮ⽪ಘ
ཊ࣏㜭ᱮ⽪ಘ 䙏ᓖ䇑
1
䙏ᓖ䇑
4-4
仪表及操纵器
速度表显示了车辆的行驶速度。 99$ᤷ⽪ಘ 䖜䙏㺘
1 2
⋩䟿㺘
1 䖜䙏㺘
1. VVA（可变气门致动）指示器
䖜䙏㓒㢢४ฏ
䈕රਧ䝽༷Ҷਟਈ≄䰘傡ࣘ˄99$˅ˈ൘ 䖜䙏䇑‫ݱ‬䇨僁䖖ⴁ⍻ਁࣘᵪ䖜䙏઼
⋩䟿㺘 վ䙏઼儈䙏㤳ത޵䜭ާᴹ㢟ྭⲴ⟳⋩㓿 ᨀ‫׋‬Ҷ⨶ᜣⲴ࣏⦷㤳ത޵‫؍‬ᤱᆳǄ
⟳⋩㺘ᤷ⽪⟳⋩㇡ѝⲴ⟳⋩䟿Ǆ䲿⵰⟳ ⍾ᙗ઼࣐䙏ᙗǄᖃਟਈ≄䰘㠤ࣘ㌫㔏࠷
⌘᜿
ᦒࡠ儈䙏㤳തᰦˈ99$ᤷ⽪⚟Ӟ䎧Ǆ
ᯉ⏢սⲴ䱽վˈ⟳⋩㺘Ⲵᱮ⽪䜘࠶Ӿ
Ā)ā˄┑˅ᵍĀ(ā˄オ˅⎸ཡǄᖃᴰ н㾱᫽֌ਁࣘᵪ൘䖜䙏㺘Ⲵ㓒㢢४ฏǄ
ਾањ⇥ᔰ࿻䰚⛱ᰦˈቭᘛ࣐⋩Ǆ
㓒४˖䖜࠶ԕкⲴᰦ䫏
ᖃѫᔰ‫ޣ‬ᢃĀāᰦˈ⟳ᯉ䇑Ⲵᡰᴹ
ᱮ⽪⇥ሶࠪ⧠ࠐ。䫏ˈ❦ਾ⟳ᯉ䇑ᱮ⽪
ᇎ䱵⟳ᯉ≤ᒣǄ
4-5
Ԛ㺘৺᫽㓥ಘ
ਈ䙏㇡ẓսᱮ⽪ ཊ࣏㜭ᱮ⽪ቿ䝽༷ԕл䇮༷˖
Ā75,3)āᒦᔰ࿻䇑㇇Ӿ䈕⛩ᔰ࿻
2 Ь䟼〻㺘
㹼傦Ⲵ䐍⿫Ǆ൘䘉⿽ᛵߥлˈ᤹л
Ьєњ⍻䐍Ԛ
ᐖ‫ח‬䇮㖞᤹䫞ਟ᤹ԕл亪ᒿ࠷ᦒ਴
Ь⟳ᯉ༷ۘ㹼〻㺘
⿽㹼〻㺘ˈ䟼〻㺘ˈⷜᰦ⋩㙇઼ᒣ
Ьᰦ䫏
1 ൷⋩㙇⁑ᔿѻ䰤Ⲵᱮ⽪˖
Ьᖃࡽ⟳⋩⎸㙇ᱮ⽪
Ьᒣ൷⟳ᯉ⎸㙇
75,3)J&/2&.JNP/RU/
NPJ$9(BBBNP/RU$9(B
᤹лᐖ‫ח‬䇮㖞᤹䫞ਟ൘䟼〻㺘⁑ᔿ
Ր䗃㻵㖞ᱮ⽪ቿ BB/NPJBBNPKJ2'2
ѝᙗᤷ⽪⚟Āā Ā2'2āˈ㹼〻㺘⁑ᔿĀ75,3ā
4 J75,3J75,3J75,3)
઼Ā75,3āˈᰦ䫏⁑ᔿĀBB˖B
䈕ቿᒅᱮ⽪䘹ᤙⲴẓսǄѝᙗս㖞 Bāˈⷜᰦ⋩㙇⁑ᔿĀNP/āᡆ
㾱䟽㖞⍻䐍Ԛˈ᤹лĀ6(/(&7ā᤹
⭡Āāˈԕ৺⭡オẓᤷ⽪⚟ᤷ Āᒣ൷⋩㙇⁑ᔿĀ$9(BBNP/ā
䫞䘋㹼䘹ᤙˈ❦ਾ᤹Ā5(6(7ā᤹
⽪Ǆ ᡆĀ$9(BB/NPāˈᒣ൷
䫞㠣ቁа。䫏Ǆ
䙏ᓖ⁑ᔿĀ$9(BBNPKā᤹ԕ
ཊ࣏㜭ᱮ⽪ ྲ᷌ᛘ⋑ᴹ᡻ࣘ༽ս⟳⋩༷ۘ㹼〻
л亪ᒿᧂࡇ˖
㺘ˈᆳՊ㠚ࣘ༽սˈᒦф൘࣐⋩ᒦ
2
㹼傦‫ޜ‬䟼ਾᱮ⽪ቿ䘄എࡠ‫ࡽݸ‬
'2J 75,3J 75,3J &/2&.
⁑ᔿǄ
J NP/RU/NPJ $9(BBB
NP/RU$9(BBB/NPJ $9(
BBBNP/J 2'2
1 ྲ᷌⟳⋩⋩ս䆖੺ᤷ⽪ಘᒦᔰ࿻⟳
ཊ࣏㜭ᱮ⽪ ⋩㺘Ⲵᐖ‫ח‬䜘࠶䰚⛱ᰦˈᱮ⽪ቿՊ
㠚ࣘ࠷ᦒࡠ⟳⋩ۘᆈ㹼〻㺘⁑ᔿ
4-6
Ԛ㺘৺᫽㓥ಘ
䟼〻㺘⁑ᔿ 䐣䰨㺘ᱮ⽪㠚к⅑༽սਾⲴᙫ㹼〻Ǆ 䇮㖞ᰦ䫏
㾱䟽㖞⍻䐍Ԛˈ䈧᤹Ā5(6(7ā᤹䫞 ࠷ᦒࡠᰦ䫏⁑ᔿǄ
㠣ቁа。䫏Ǆ ൘ᰦ䫏⁑ᔿлˈ᤹л
Ā䘹ᤙā᤹䫞઼Ā༽սā᤹䫞㠣ቁє。
ᨀ⽪䫏Ǆ
Ь䟼〻㺘ሶ䬱ᇊ൘ˈн㜭༽սǄ ᖃ֐ᔰ࿻⚠ॆᰦˈ֯⭘Ā5(6(7ā
Ьࡠ䗮ਾˈ䐣䰨㺘ሶ༽սᒦ㔗㔝 ᤹䫞䇮㖞ሿᰦǄ
᤹лĀ䘹ᤙā᤹䫞є。䫏ˈ࠶䫏ሶᔰ
䇑ᮠǄ㾱༽ս䐣䰨㺘ˈ൘ᱮ⽪ᰦˈ᤹ 4
࿻⚠ॆǄ
лĀ5(6(7ā᤹䫞㠣ቁа。䫏Ǆ ֯⭘Ā5(6(7ā᤹䫞䇮㖞࠶䫏Ǆ
1
᤹տĀ5(6(76(/(&7ā᤹䫞є。䫏
䟼〻㺘
ԕ੟ࣘᰦ䫏Ǆ
䐣䰨⁑ᔿ ᰦ䫏 ⷜᰦ⟳⋩⎸㙇⁑ᔿ
1
1
1
䐣䰨 ᰦ䫏 ⷜᰦ⟳⋩⎸㙇
ᰦ䫏֯⭘ሿᰦᰦ䰤㌫㔏Ǆ ⷜᰦ⟳⋩⎸㙇ᱮ⽪ਟԕ䇮㖞ѪĀNP/ā
ᡆĀ/NPāǄ

4-7
Ԛ㺘৺᫽㓥ಘ
㾱൘ⷜᰦ⟳⋩⎸㙇ᱮ⽪䇮㖞ѻ䰤࠷ᦒˈ ᒣ൷⟳⋩⎸㙇⁑ᔿ 㾱䟽㖞ᒣ൷⟳⋩⎸㙇ˈ䈧᤹лĀ5(6(7
䈧᤹лĀ5(6(76(/(&7ā᤹䫞а。䫏 6(/(&7ā᤹䫞㠣ቁа。䫏Ǆ
Ǆ
ЬĀNP/ā˖ᱮ⽪൘ᖃࡽ㹼傦ᶑԦл ᨀ⽪
/⟳ᯉਟ㹼傦Ⲵ䐍⿫Ǆ
t ൘䟽㖞ᒣ൷⟳ᯉ⎸㙇ѻਾˈሶᱮ⽪
ЬĀ/‫ޜ‬䟼ā˖ᱮ⽪൘ᖃࡽ僁㹼
ĀBBBāˈⴤࡠ䖖䖶㹼傦‫ޜ‬䟼
ᶑԦл㹼傦‫ޜ‬䟼ᡰ䴰Ⲵ⟳ᯉ䟿Ǆ
˄㤡䟼˅Ǆ
1
t ᒣ൷⟳ᯉ⎸㙇⁑ᔿՈ䘹ӵ⭘֌а㡜
4 ᨀ⽪ ᒣ൷⟳⋩⎸㙇ᱮ⽪ ৲㘳Ǆн㾱⭘↔ᶕՠ䇑⋩㇡޵Ⲵ⟳
Ьྲ᷌ԕվҾ‫ޜ‬䟼ሿᰦⲴ䙏ᓖ㹼 ⋩䟿ਟ䗮ࡠⲴ䐍⿫Ǆ
↔ᱮ⽪ቿᱮ⽪㠚к⅑༽սਾⲴᒣ൷⟳
傦ˈࡉᱮ⽪ĀBBBāǄ
⋩⎸㙇Ǆᒣ൷⟳ᯉ⎸㙇ᱮ⽪ਟԕ䇮㖞
Ьⷜᰦ⟳ᯉ⎸㙇䟿Ո䘹ӵ⭘֌а㡜
ѪĀNP/āᡆĀ/NPāǄ ᒣ൷䙏ᓖ⁑ᔿ
৲㘳Ǆн㾱⭘↔ᶕՠ䇑⋩㇡޵Ⲵ
ЬĀNP/ā˖ᱮ⽪ॷ⟳⋩ਟ㹼
⟳⋩䟿ਟ䗮ࡠⲴ䐍⿫Ǆ
傦Ⲵᒣ൷䐍⿫Ǆ
ЬĀ/‫ޜ‬䟼ā˖ᱮ⽪㹼傦‫ޜ‬
䟼ᡰ䴰Ⲵᒣ൷⟳ᯉ䟿Ǆ
1
ᒣ൷䙏ᓖ⁑ᔿᱮ⽪
4-8
Ԛ㺘৺᫽㓥ಘ
ᱮ⽪㠚к⅑䟽༽᪙ᢈ䖖ԕᶕⲴᒣ൷䙏ᓖǄ Ь◰⍫⛩˖䈕࣏㜭‫ݱ‬䇨ᛘ䘹ᤙ◰⍫ᤷ Ь䰚⛱˖◰⍫ᰦᤷ⽪⚟䰚⛱Ǆ˄ᖃᤷ
㾱ᒣ൷䟽㖞䙏ᓖᱮ⽪ˈ䈧᤹տĀ5(6(7ā ⽪⚟Ⲵਁࣘᵪ䖜䙏Ǆ ⽪⚟⇿。䰚⛱ഋ⅑ᰦˈ↔䇮㖞㻛䘹
᤹䫞ⴤࡠᒣ൷䙏ᓖ䰚⛱ˈ❦ਾ޽⅑᤹л Ьਆ⎸◰⍫⛩˖䈕࣏㜭‫ݱ‬䇨ᛘ䘹ᤙ‫ڌ‬ ѝǄ˅
䈕䭞Ǆ ⭘ᤷ⽪⚟Ⲵᵪಘ䙏ᓖǄ Ь➴⚝˖⾱⭘ᤷ⽪⚟ˈᦒਕ䈍䈤ˈн
ЬӞᓖ˖↔࣏㜭ਟ䇙ᛘ䈳ᮤᤷ⽪⚟Ⲵ ᢃᔰᡆ䰚⛱Ǆ˄ᖃᤷ⽪⚟⇿є。䰚
〫սᤷ⽪⚟ ӞᓖǄ ⛱а⅑ᰦˈ↔䇮㖞㻛䘹ѝǄ˅
᤹лĀ䘹ᤙā᤹䫞⺞䇔ᡰ䘹Ⲵ䰚⛱
1 䇮㖞䖜ᦒᤷ⽪⚟ ⁑ᔿǄᦒẓᤷ⽪⚟ਈѪ◰⍫⁑ᔿǄ
ሶ⛩⚛䫕ॉ䖜ࡠĀāս㖞Ǆ 4

᤹տĀ6(/(&7ā᤹䫞Ǆ 䖜䙏㺘ሶᱮ⽪◰⍫⛩⁑ᔿ઼‫Ⲵ⛩⭘ڌ‬ᵪ
ሶ⛩⚛䫕ॉ䖜ࡠĀāս㖞ˈ ಘ䙏ᓖ䇮㖞Ǆ
❦ਾ൘ӄ。䫏ਾ䟺᭮Ā6(/(&7ā
᤹䫞Ǆѻਾˈ޽⅑᤹лĀ6(/(&7ā 䇮㖞ᦒẓᔰ‫⛩ޣ‬
᤹䫞Ǆ⧠൘ਟԕ䇮㖞ᦒẓᤷ⽪⚟Ǆ
2 䇮㖞䰚⛱⁑ᔿ ᨀ⽪
䖜ᦒᤷ⽪⚟ ᤹лĀ5(6(7ā᤹䫞䘋㹼䘹ᤙԕ ᦒẓᤷ⽪⚟Ⲵ੟ࣘ⛩ਟԕ䇮㖞൘
ᱮ⽪Ӟᓖ䈳ᮤ л䰚⛱⁑ᔿ䇮㖞ѻа˖ USP㠣USPѻ䰤Ǆᤷ⽪⚟ਟԕԕ
ЬӞ䎧˖ᤷ⽪⚟‫؍‬ᤱӞ䎧ᖃ㻛◰ USPⲴ໎䟿䘋㹼䈳ᮤǄ
䖜ᦒᤷ⽪⚟ᴹഋ⿽ਟ䈳ᮤ䇮㖞Ǆ ⍫ᰦǄ˄ᖃᤷ⽪⚟‫؍‬ᤱ⛩Ӟᰦ
Ь䰚⛱⁑ᔿ˖࣏㜭‫ݱ‬䇨ᛘ䘹ᤙᤷ⽪⚟ᱟ 䘹ᤙ↔䇮㖞Ǆ˅
੖Ӟ䎧ˈԕ৺◰⍫ᰦ䰚⛱ᡆ‫؍‬ᤱӞ䎧Ǆ
4-9
Ԛ㺘৺᫽㓥ಘ
᤹лĀ5(6(7ā᤹䫞䘹ᤙᡰ䴰Ⲵਁࣘ 䈳ᮤӞᓖ
ᵪ䖜䙏ԕ◰⍫ᤷ⽪⚟Ǆ ᤹лĀ5(6(7ā᤹䫞ᒦ䘹ᤙ〫սᤷ⽪
᤹Ā䘹ᤙā᤹䫞⺞䇔ᡰ䘹ᵪಘⲴ䙏ᓖǄ⚟ⲴӞᓖ㓗࡛Ǆ
᧗ࡦ⁑ᔿ࠷ᦒࡠ‫⛩⭘ڌ‬䇮㖞⁑ᔿǄ ᤹лĀ6(/(&7ā᤹䫞⺞䇔Ӟᓖ㓗࡛Ǆ
Ӿᦒᥑ᧗ࡦ⚟䘰ࠪᱮ⽪ᒦ䘄എḷ߶ཊ
䇮㖞‫⛩⭘ڌ‬ ࣏㜭ᱮ⽪⁑ᔿǄ
ᨀ⽪
Ьঐオᤷ⽪⚟᭮⭥ᤷ⽪⚟ⲴӞ⛩ਟԕ
䇮㖞൘USP઼USPѻ䰤Ǆ ᤹Ā6(/(&7ā᤹䫞а。䫏ˈ⺞䇔ᡰ䘹
ᤷ⽪⚟ਟԕԕUSPⲴ໎䟿䘋㹼 ᤙⲴᆇㅖǄㅜҼњᆇㅖሶᔰ࿻䰚⛱Ǆ
4
䈳ᮤǄ ⅒䗾ቿᒅ
ᡰᴹ‫ޝ‬њᆇㅖሶ䟽༽↔䗷〻Ǆᖃㅜ‫ޝ‬
Ь࣑ᗵሶ‫⛩⭘ڌ‬䇮㖞Ѫ∄䎧⛩ᴤ儈Ⲵ ᖃ䫕ॉ䖜ࡠĀā⅒䗾ቿᒅሶ᱐‫ޕ‬
њᆇㅖ䇮㖞ਾˈᡰᴹⲴᆇㅖሶ䰚⛱є
ਁࣘᵪ䖜䙏ˈ੖ࡉ䖜ᦒᰦᤷ⽪⚟ Ā+L%XGG\ā઼ĀāǄ⭘ᡧ਽
⅑ˈ䇮ᇊ⁑ᔿሶ㠚ࣘ㔃ᶏǄ
нӞǄ Ā%XGG\ā㻛䇮㖞Ѫࠪল唈䇔٬ˈնᆳ
ਟԕ㻛䇮㖞Ѫ֐Ⲵ਽ᆇǄ
㠚䇺ᯝ㻵㖞
᤹Ā5(6(7ā᤹䫞䘹ᤙᡰ䴰Ⲵਁࣘ 䘉њ⁑ර䝽༷ᴹ㠚䇺ᯝ㻵㖞ˈ⭘Ҿ਴⿽
㾱䇮㖞⭘ᡧ਽
ᵪ䖜䙏ԕ‫ޣ‬䰝ᤷ⽪⚟Ǆ ⭥≄⭥䐟Ǆ
ሶ䫕ॉ䖜ࡠĀā
᤹Ā䘹ᤙā᤹䫞⺞䇔ᡰ䘹ᵪಘⲴ ྲ᷌൘ަѝԫօ⭥䐟Ự⍻ࡠ䰞仈ˈਁࣘ
᤹տĀ6(/(&7ā᤹䫞
䙏ᓖǄ᧗ࡦ⁑ᔿᴤ᭩ѪӞᓖ䈳ᮤ ᵪ᭵䳌䆖੺⚟ሶӞ䎧ˈᱮ⽪ቿՊᱮ⽪䭉
ሶ䫕ॉ䖜ࡠĀāˈഋ。䫏ਾ䟺᭮
⁑ᔿ 䈟ԓ⸱Ǆ
Ā䘹ᤙā᤹䫞Ǆ
ᖃㅜањᆇㅖᔰ࿻䰚⛱ˈ᤹Ā䘹ᤙā
᤹䫞ˈ᤹➗ԕл亪ᒿᴤ᭩ᆇㅖǄ
4-10
Ԛ㺘৺᫽㓥ಘ
䈳‫ݹ‬ᔰ‫ޣ‬Āā
⌘᜿ 䖖ᢺᔰ‫ޣ‬ᐖ ሩҾ儈ሶ↔ᔰ‫ޣ‬䇮㖞ѪĀā
ྲ᷌ᱮ⽪ቿᱮ⽪䭉䈟ԓ⸱ˈᓄቭᘛỰḕ ‫ݹ‬ᶏᒦԕĀāѪվ‫ݹ‬ᶏǄ
䖖䖶ˈԕ䚯‫ࣘਁݽ‬ᵪᦏൿǄ ᐖ ѪҶ➗ሴབྷ⚟ˈ䈧᤹л‫ח‬䶒
1 ᖃࡽ⚟ӞᰦˈĀ3$66āᔰ‫ޣ‬
㻛⭘֌ᕡ‫ݹ‬Ǆ
2 䖜ੁؑਧᔰ‫ޣ‬Āā 4
ؑਧਣ᡻䖜ᕟˈ᤹л↔ᔰ‫ޣ‬Āā
3 Ǆؑਧᐖ᡻䖜ˈ᧘↔ᔰ‫ޣ‬ѪĀā
Ǆᖃ䟺᭮ᰦˈᔰ‫ޣ‬䘄എࡠѝᗳս㖞Ǆ
䈳‫ݹ‬ᔰ‫ޣ‬Ā3$66ā
ᢃᔰؑਧᔰ‫ޣ‬Āā 㾱ਆ⎸Ⲵ䖜ੁؑਧ⚟ˈ᧘ࣘᔰ‫ޣ‬൘ਾ
ஷਝᔰ‫ޣ‬Āā ᆳᐢ㓿䘄എࡠѝᗳս㖞Ǆ
ਣ䗩 ஷਝᔰ‫ޣ‬Āā
1 ᤹л↔ᔰ‫᤹ޣ‬ஷਝǄ
ਁࣘᵪ‫→ڌ‬ᔰ‫ޣ‬Āā
ሶ↔ᔰ‫ޣ‬㖞ҾĀāᔰ࿻ѻࡽᕅ᫾Ǆ
ሶ↔ᔰ‫ޣ‬䇮㖞ѪĀā㠣൘㍗ᙕᛵ
ߥл‫ࣘਁ→ڌ‬ᵪˈֻྲᖃ䖖䖶㘫‫ق‬ᰦ
2
ᖃ⋩䰘⭥㔶঑տᰦǄ
3
ਁࣘᵪ‫→ڌ‬ᔰ‫ޣ‬Āā
ড䲙ᔰ‫ޣ‬Āā
੟ࣘᔰ‫ޣ‬ĀĀ
4-11
仪表及操纵器
EAU12722
੟ࣘᔰ‫“ ޣ‬ " ᡻⢉ᵶ ᦒẓ䐿ᶯ
᧘㘼↔ᔰ‫ޣ‬ᓄ⭘ࡽᯩ઼ਾᯩⲴਁࣘᵪᴢ
䖤➎䖖о䎧ࣘǄ㿱䎧࿻亥ᤷ⽪ѻࡽ
੟ࣘਁࣘᵪǄ
1
ড䲙⚟ᔰ‫ޣ‬Āā
ড䲙䆖⽪⚟˄਼ᰦᤷ⽪⚟˅⭘Ҿ㍗ᙕ
ᛵߥлˈֻྲᖃᛘⲴ᪙ᢈ䖖‫ڌ‬൘ਟ㜭
ሬ㠤Ӕ䙊ড䲙Ⲵൠᯩᰦˈᨀ䟂ަԆਨ
4 ᵪǄ 1
ሶ↔᤹䫞䇮㖞ѪĀāሶަᢃᔰˈ ᡻⢉ᵶ ᦒẓ䐿ᶯ
ሶ᤹䫞䇮㖞ѪĀāǄ
᡻⢉ᵶᱟսҾᐖ᡻ᨑᢺǄ㾱ᶮᔰ⢉䰘ˈ
ᦒẓ䐿ᶯսҾᐖ‫ח‬᪙ᢈ䖖Ⲵ‫ח‬䶒ˈᒦ
ቡ᣹䛓⢉ᵶࡠᨑᢺ༴ⲴᯩੁǄ⴨৽Ⲵˈ
⭘Ҿо⿫ਸಘᵶᰦ㓴ਸ〫ࣘ䙏ᚂⲴ
㾱䬱㍗⢉䰘ˈቡ᭮ᶮ⢉ᵶǄ⢉ᵶᓄᘛ
䙏Ⲵ᣹ն᭮ᶮⲴᰦ‫ى‬ቡធធԕ⺞‫ᦒ؍‬
喯䖞ஞਸՐࣘ䝽༷к䘉⿽᪙ᢈ䖖Ǆ
⢉Ⲵ䗷〻亪࡙Ǆ
⿫ਸಘᵶ䝽༷ᴹ⿫ਸಘᔰ‫ˈޣ‬ᆳᱟሶ
⛩⚛Ⲵа䜘࠶⭥䐟࠷ᯝ㌫㔏Ǆ˄㿱ㅜ
˅Ǆ
4-12
仪表及操纵器
ࡦࣘᶐᵶ ࡦࣘ䐿ᶯ ⟳⋩㇡ⴆ
1 2
1
1 4
⋩㇡ⴆ
1。制动杠杆 Ǆࡦࣘ䐿ᶯ 䀓䬱Ǆ
ࡦࣘᵶᱟ൘սҾਣᨑᢺкǄ㾱᫽֌ ࡦࣘ䐿ᶯᱟսҾ⭥অ䖖Ⲵᴹ㝊лˈ
ࡦࣘಘˈቡᢺࡦࣘᵶ᣹ੁᨑᢺⲴᯩ 䐿лࡦࣘ䐿ᶯቡ㜭᫽֌ਾࡦࣘಘǄ 㾱ᔰ⋩㇡ⴆ
ੁǄ ᢃᔰ⋩㇡ⴆ䬱ⴆǄ
ሶ䫕ॉᨂ‫ޕ‬䬱ѝ亪ᰦ䪸᯻䖜സǄ
䬱ሶ㻛䟺઼᭮⋩㇡ⴆਟԕ᣶лǄ
㾱㻵㖞⋩㇡ⴆ
ሶ⋩㇡ⴆ᧘‫ࡠޕ‬սо䫕ॉᨂ‫ޕ‬䬱Ǆ
4-13
仪表及操纵器
䘶ᰦ䪸᯻䖜䫕ॉ㠣৏࿻ս㖞ˈ❦ ⟳⋩ 2
ਾሶަਆлǄ ⺞‫⋩؍‬㇡޵Ⲵ⟳⋩ᱟ䏣ཏⲴǄ 1
‫ޣ‬䰝䬱ⴆǄ
ᨀ⽪䆖੺
䲔䶎䫕ॉ൘䬱ѝˈ੖ࡉн㜭ᆹ㻵⋩ 汽油和汽油蒸汽是极易燃物品。请根据
㇡ⴆǄਖཆˈྲ᷌ⴆᆀᵚ↓⺞ᆹ㻵以下指示以避免在加油时燃烧或爆炸以
઼䬱ᇊˈ䫕ॉሶᰐ⌅᣶䲔Ǆ 及受伤。
1. 加油前，熄灭引擎及确保座垫上没 Ǆ⟳⋩㇡⌘⋩㇑
4 ᴰབྷ⟳⋩䟿
人。请勿在加油时抽烟。确保附近
没有火花。
ᬖᤝԫօ・ণ⒵ࠪⲴ⟳⋩Ǆ
䆖੺ 2. 请勿让油箱溢出。在加油时，请确䈧・࡫⭘ᒢ߰৺Ḅ䖟Ⲵᐳ
⌘᜿
保泵喷嘴进入油箱填充孔。在燃油 ᢺ⒵ࠪⲴ⟳⋩ᤝ৫ˈ⟳⋩Պ֯ᴹ
⺞‫⋩؍‬㇡ⴆᱟ࣐⌘⟳ᯉਾ↓⺞‫ޣ‬ 抵达油箱填充孔时停止加油。因为 ┶Ⲵ㺘䶒ᡆກ㜦ਈ䍘Ǆ[ECA10072]
䰝Ǆ⋴┿Ⲵ⟳⋩ᕅ䎧⚛⚮Ǆ 汽油遇热会扩充，引擎或太阳的热 аᇊ㾱ᆹ‫ޘ‬ൠ‫ޣ‬䰝⟳ᯉ⋩㇡ⴆǄ
能会导致汽油溢出。
EWA15152
䆖੺
汽油是有毒及会造成伤害或死亡的。请
小心处理。请勿用嘴巴虹吸汽油。若不
小心吸取汽油或大量的汽油蒸汽，马上
看医生。
4-14
仪表及操纵器
ۜॆ䖜ᦒಘϔ 注意
᧘㦀⊭⋩˖ ↔䖖Ⲵᧂ≄㌫㔏䝽༷ۜॆ䖜ᦒಘǄ
Ո䍘ᰐ䫵⊭⋩ 只能使用无铅汽油。使用有铅汽油会导
致催化转换器的永久损坏。
⋩㇡ᇩ䟿˖ ϔ
11公升 (1.2US gal, 1.0 Imp.gal)
⟳ᯉ༷ۘ䟿˖ WARNING
/˄86JDO˅˄,PSJDO˅ ᧂ≄㌫㔏൘᫽֌ਾሶՊᖸ✝ǄѪҶ䱢→
⚛⚮ᡆ✗Ք˖
⌘᜿ t н㾱䶐䘁‫ڌ‬᭮䖖䖶ਟ㜭Ⲵ⚛⚮䳀
z 4
ᛓˈྲ㥹ᡆަԆᶀᯉᇩ᱃⟳✗Ǆ
z ‫ޜ‬ഝⲴൠᯩ䖖䖶ަѝˈ㹼Ӫᡆ‫ݯ‬
ㄕнཚਟ㜭᧕䀖ࡠ✝ᧂ≄㌫㔏Ǆ
z ᵚ֌ԫօ㔤‫؞‬ᐕ֌ᰦˈ䈧⺞ᇊᧂ≄
㌫㔏ᐢߧতҶǄ
z н㾱䇙ਁࣘᵪᙐ䙏䘀䖜䎵䗷ࠐ࠶
䫏ԕкǄ䮯ᙐ䙏ਟሬ㠤〟㚊✝䟿Ǆ
4-15
仪表及操纵器
ᓗս
⭘㷪⇽ᆹ㻵ᓗἵǄ
ᆹ㻵ກᯉⴆǄ
䖖᡻ᓗս
҈ᇒᓗս
ਆл僁᡻ᓗս
1
Ԛಘ઼᧗ࡦ࣏㜭৫䲔҈ᇒᓗս
ሶ䫕ॉᨂ‫ޕ‬䫕ॉᓗˈ❦ਾ亪ᰦ䪸᯻䖜
ਆлກᯉⴆ
1
4 1
㷪⇽
ᆹ㻵҈ᇒᓗἵ 2
ྲമᡰ⽪ˈሶᓗἵ↓䶒Ⲵケ䎧ᨂ‫ޕ‬
ᓗἵ᭟ᷦǄ
ກᯉⴆ 1
ᤗл㷪⇽ˈྲമᡰ⽪নлᓗἵǄ
䖖ᓗ
ᢃᔰ
ᆹ㻵僁᡻ᓗս
ྲമᡰ⽪ሶᓗἵ↓䶒Ⲵࠨࠪ䜘࠶ᨂ
2 ‫ޕ‬ᓗἵѝˈ❦ਾሶᓗἵᆹ㻵ࡠ৏ᶕ
Ⲵս㖞Ǆ
ᓗἵ↓䶒
ᓗἵ᭟ᷦ 4-16
仪表及操纵器
1 䫒ⴄ䫙 1
1
2 2
4
Ǆ᭟ᷦ
Ǆᓗᑝ䬱 Ǆ䫒ⴄ䫙
Ӿ䫒ⴄ䫙кਆࠪ䫒ⴄ
ਆл䫕ॉǄ 䫒ⴄ䫙༴൘ᓗᑝᓅлǄ ᢃᔰᓗᑝˈӾ䫒ⴄ䫙кਆࠪ䫒ⴄˈ❦ਾ
‫ޣ‬к䈕ᓗᑝǄ
ᨀ⽪
_
ᆹ᭮䫒ⴄ൘䫒ⴄк
⺞‫؍‬ᓗᑝᆹ‫Ⲵޘ‬㻛䬱ྭǄ ǄᢃᔰᓗᑝǄϔ
Ǆ䫒ⴄ䫙кਾˈሶᓗᑝ‫ޣ‬кǄ䆖੺ʽ
ॳз࡛൘䫒ⴄ䘈൘䫒ⴄ䫙кⲴᛵߥ
㹼傦䘉ਟ㜭Պሬ㠤ཡ᧗৺᜿ཆǄ
4-17
仪表及操纵器
䎧ࣘ⭥䐟࠷ᯝ㌫㔏
‫ח‬ᷦḡ
䎧ࣘ⭥䐟࠷ᯝ㌫㔏˄वᤜᡰ䘠⿫ਸಘᔰ
‫ח‬ᷦḡ༴Ҿ䖖ᷦⲴᐖ䗩Ǆ⭘㝊ሶ‫ח‬ᷦḡ
‫઼ޣ‬オẓᔰ‫˅ޣ‬䱢→䎧ࣘᰦਈ䙏ಘ༴Ҿ
ᨀॷᡆ䱽лˈ਼ᰦ඲ⴤൠᨑ⵰ᛘⲴ⭥অ
喯䖞઼⿫ਸಘᵶн㻛᣹Ǆ
䖖Ǆ
᤹➗ԕл〻ᒿᇊᵏỰḕ䎧ࣘ⭥䐟࠷ᯝ㌫
㔏Ⲵ᫽֌Ǆ
䆖੺ ᨀ⽪
⭥অ䖖㔍н㜭൘‫ח‬ᷦḡੁлᰦˈᡆ⋑㻛 ྲ᷌⭘᳆ᵪਁࣘᵪ䘋㹼䘉⿽Ựḕᱟᴰਟ
ᆼᮤൠ˄ᡆ⋑㻛ᨀ䎧˅Ⲵᛵߥл㹼傦ˈ 䶐
4 ੖ࡉሶՊ⻠䀖ൠ䶒৺䱢⺽僁༛ˈ৺䙐ᡀ
ཡ᧗Ǆ
4-18
Ԛ㺘઼᧗᫽㓥ಘ
൘ਁࣘᵪ‫ޣ‬䰝˖
ሶ䫕ॉ䖜ࡠ21ս㖞Ǆ
〫սࡠѝ・ս㖞ⲴՐ䗃Ǆ 若发现故障，请联络雅马哈代理检查系统。
᤹л੟ࣘᔰ‫ޣ‬Ǆ
ᒦ൘ਁࣘᵪ੟ࣘ˛
是否空挡开关可能故障。
摩托车不该行驶直到雅马哈代理检查。 4
4.关闭发动机。
5.移位到齿轮传动。
6.保持拉动离合器杆。
7.按下启动开关。
并在发动机启动？
离合器开关可能故障。
是否摩托车不该行驶直到雅马哈代理检查。
系统安好。摩托车可以行驶。
4-19
Ѫᆹ‫ޘ‬䎧㿱ᵟࡽỰḕ
㾱⺞‫⭥؍‬অ䖖Ⲵᆹ‫ޘ‬᫽֌ˈᗵ享⇿ᰦ⇿࡫ỰḕᛘⲴ⭥অ䖖Ǆᓄᑨ‫➗׍‬Ā֯⭘᡻޼āⲴỰḕ৺‫↕ޫ؍‬僔઼ઘᵏ㺘Ǆ
⋑㓿䗷ྭྭⲴỰḕᡆ‫ޫ؍‬ሶՊ໎࣐᜿ཆᡆ䇮༷ᦏൿⲴਟ㜭ᙗǄ䈧н㾱᫽֌ᛘⲴ⭥অ䖖ྲਁ⧠ᴹԫօ䰞仈Ǆྲ‫➗׍‬Ā֯⭘᡻޼
āⲴ↕僔䘈ᱟн㜭㓐↓Ⲵ䰞仈ˈ䈧䇙䟾傜૸ԓ⨶୶ỰḕᛘⲴ⭥অ䖖
5 ᫽֌ࡽ䈧Ựḕԕл㾱⛩˖
s
s 4-14
s
s 7-11
s
s
s 7-14
s
s
s
s
ࡽࡩ䖖 s 7-21, 7-21
s
s
s
5-1
s
s
s
ਾࡦࣘ s 7-21, 7-21
s
s
s
s
s ⏖━⭥㔶ˈྲ᷌ᗵ㾱ⲴǄ
᡻⢉ᵶ 7-20
s
s
s 5
s 7-17, 7-25
s
s
s
7-25
s
s
s 7-23, 7-25
s
s
s
7-18, 7-19
s
s
s
ࡦ઼ࣘᦒᥑ䐿ᶯ 7-26
s
ࡩ䖖઼⿫ਸಘᶐᵶ s
7-26
s
s
s 7-27
5-2
Ь⺞‫؍‬ᡰᴹⲴ㷪⇽ˈ㷪ṃ઼㷪䪹ᱟ੖㍗പ࿕ழǄ
ᓅⴈ㍗പԦ Ьᤗ㍗ˈྲ᷌ᗵ㾱ⲴǄ —
ЬỰḕ㹼ࣘǄ
Ҁಘˈ⚟‫ؑˈݹ‬ਧ઼ᔰ‫ޣ‬ —
Ь↓⺞Ⲵˈྲ᷌ᗵ㾱ⲴǄ
5-3
᫽֌৺䟽㾱㹼傦㾱⛩
ሿᗳⲴ䰵䈫֯⭘᡻޼ԕ⟏ᚹ‫ޘ‬䜘Ⲵ᫽ ⌘᜿ 䎧ࣘਁࣘᵪ
᧗Ǆྲ᷌ᛘਁ⧠ᴹнҶ䀓Ⲵ᫽᧗ᡆ࣏
н㾱僁䗷␡≤ˈ੖ࡉՊᦏൿਁࣘᵪǄ 㤕㾱੟ࣘ⛩⚛⭥䐟࠷ᯝ㌫㔏ˈᗵ享䚥
㜭ˈ䈧а૘䈒䟾傜૸ԓ⨶୶Ǆ ᆸԕлԫօањᶑԦ˖
䚯‫≤ݽ‬ඁˈഐѪᆳԜਟ㜭Պ∄亴ᵏ
zਈ䙏㇡༴Ҿオẓս㖞Ǆ
ᴤ␡Ǆ
zਈ䙏ಘᐢ‫ޕ‬ẓն᤹⵰⿫ਸಘᵶˈ
ᒦфᢺ‫ח‬ㄉ᭦䎧ᶕǄ
ᵚ㜭⟏ᚹ䈕᧗Ԧਟሬ㠤ཡ᧗ˈ䘉ਟ㜭ሬ㠤һ
ᴹ‫ޣ‬ᴤཊؑ᚟ˈ䈧৲㿱ㅜ亥Ǆ
᭵ᡆՔᇣ
ᢺ䫕ॉ䖜ࡠĀāᒦ⺞䇔ਁࣘ
ᵪ‫→ڌ‬ᔰ‫ޣ‬䇮㖞ѪĀāǄ
੟ࣘᕅ᫾‫ڌ‬ᵪᔰ‫ޣ‬㻛䇮ᇊѪǄ 6
⌘᜿˖ྲ᷌䆖⽪⚟ҏнՊ➴⚝ˈ
ᴹ䳵傜૸㓿䬰୶Ựḕަ⭥䐟Ǆ
ᖃਈ䙏㇡ᦒ㠣オẓⲴս㖞ˈオẓ
ᤷ⽪⚟ᓄӞ䎧Ǆྲ᷌ᨀ⽪⚟⋑Ӟ
䎧ˈ䈧㚄㔌䳵傜૸㓿䬰୶ᶕỰḕ
⭥䐟Ǆ
᤹੟ࣘਁࣘᵪ੟ࣘᔰ‫ޣ‬Ǆྲ᷌ਁ
ࣘᵪ⋑ᴹᔰ࿻ˈቍ䈅޽⅑о㢲⍱
ᣃᔰ᭮സ˄∛㊣˅Ǆ⇿ᔰ
࿻ቍ䈅ᓄቭਟ㜭⸝䎺ྭˈԕ‫؍‬ᤱ
⭥⊐Ǆ
ϔ
6-1
⌘᜿
⌘᜿ ᦒ䙏
ѪҶᴰབྷ䲀ᓖൠᔦ䮯ᕅ᫾Ⲵ֯⭘ሯભˈ ণ֯ਈ䙏㇡൘オẓⲴս㖞ˈ䈧य
z
䈧य൘ᕅ᫾༴Ҿվ⑙⣦ᘱᰦᕪࡦᙗ࣐ ൘ᕅ᫾⋑੟ࣘⲴᛵߥл䮯ᰦ䰤━
䙏ʽ 6 㹼ˈᒦфн䮯䐍⿫ᤆ㹼᪙ᢈ䖖Ǆ
5 ਈ䙏㇡ਚ൘ᕅ᫾੟ࣘⲴᛵߥлᗇ
4 ࡠ↓⺞Ⲵ⏖━Ǆн䏣ཏⲴ⏖━ሶ
3
2 Պሬ㠤ਈ䙏㇡ᦏൿǄ
2 N zᴤᦒẓਧᰦ֯⭘⿫ਸಘˈԕ䚯‫ݽ‬
1 1 ᦏൿᕅ᫾ˈਈ䙏㇡ˈ઼ࣘ࣋Րࣘ
㌫㔏ˈഐѪ䘉Ӌ䴦Ԧᰐ⌅᢯ਇᕪ
Ǆਈ䙏䐿ᶯ ࡦ〫սⲴ䴷ࣘǄ
6 Ǆオẓ
ᨀ⽪
ᦒ䙏䐿ᶯⴤࡠ㔃ᶏˈ❦ਾ〽ᗞ
ᨀ䎧ᶕᢺਈ䙏ಘ
6-2
ᕅ᫾Ⲵ䈅䘀䖜 ‫ޜ‬䟼˄㤡䟼˅ᡆԕк
䖖䖶⧠൘ਟԕ↓ᑨᐕ֌Ǆ
Ӿ䴦㠣‫ޜ‬䟼˄㤡䟼ᱟᛘ⭥
অ䖖ሯભᴰ䟽㾱ⲴᰦᵏǄഐ↔ˈᛘ
䈕ሿᗳൠ䰵䈫ԕлⲴ䍴ᯉǄ⭡Ҿ䘉 ⌘᜿
ᕅ᫾ᱟ‫ޘ‬ᯠⲴˈ䈧࡛䇙ᆳ൘俆
‫ޜ‬䟼˄㤡䟼˅䍏㦧䗷䟽Ǆ൘↔ᰦ z‫؍‬ᤱᕅ᫾䖜䙏൘䖜䙏㺘Ⲵ㓒㢢
ᵏ޵ˈ䮯ᰦ䰤Ⲵ‫ޘ‬䙏᫽֌ᡆԫօਟԕ ४ฏཆǄ
ሬ㠤ᕅ᫾䗷✝Ⲵ⣦ߥ䜭䈕䚯‫ݽ‬Ǆ zྲ᷌ᕅ᫾⼘ਸᵏࠪ⧠ԫօᕅ᫾
᭵䳌ˈ・࡫ࡽᖰ䳵傜૸㓿䬰୶
Ựḕ᪙ᢈ䖖Ǆ
6
‫ޜ‬䟼˄㤡䟼˅
䚯‫ݽ‬䮯ᰦ䰤᫽֌к䶒䖜࠶Ǆ
⌘᜿˖‫ޜ‬䟼˄㤡䟼˅Ⲵ᫽֌
䗷ਾˈᵪ⋩аᇊ㾱ᴤᦒǃᵪ⋩䗷└ಘ
ҏ㾱ᴯᦒǃԕ৺ᵪ⋩ۘᆈ㕨㾱␵⍇Ǆ
EAU17103
̢‫ޜ‬䟼˄㤡䟼˅
䚯‫ݽ‬䮯ᰦ䰤᫽֌к䶒䖜࠶Ǆ
6-3
‫⋺ڌ‬
൘‫⋺ڌ‬ᰦˈ‫→ڌ‬ᕅ᫾ˈ❦ਾӾѫᔰ
‫ࡦޣ‬᤯ࠪ䬱ॉǄ
⭡Ҿᕅ᫾৺ᧂ≄㌫㔏ਟ㜭Պ䶎ᑨ
✝ˈ䈧‫⋺ڌ‬൘ᗂ↕㘵৺‫ݯ‬ㄕ᧕䀖
нࡠⲴൠᯩ㘼㻛✗⇱Ǆ
࡛‫⋺ڌ‬൘ᯌඑᡆḄ䖟Ⲵൠ䶒ˈ੖
6 ࡉ⭥অ䖖ਟ㜭Պ㘫‫ق‬໎࣐Ⲵ⟳
ᯉ⋴┿઼⚛⚮ড䲙Ǆ
н㾱䶐䘁‫ޜ‬ഝ㥹ൠᡆަԆ᱃⟳ᶀ
ᯉਟ㜭⵰⚛Ǆ
6-4
䙊⌘
䘲ᖃⲴ⭘⌅৺㔤‫؞‬ਟԕ֯аᷦ⭥অ䖖ᗇࡠнቁྭ༴Ǆ
Ǆ亮ᇒԜ䜭㜭ӛᴹॱ‫ॱޘ‬㖾Ⲵ䟾傜૸⭥অ䖖Ǆ Ǆ⇿䖶⭥অ䖖ਟԕᔦ䮯㢟ྭ㺘⧠㜭࣋ⲴᰦᵏǄ
ሩਁࣘᵪ䴦Ԧ⼘ᦏⲴ∄䖳⍫ຎˈ⍫ຎ⧟ˈ
ᆼ㖾Ⲵᢗ㹼ᛵߥ
≄㕨ㅹ
㾶ⴆ䐍⿫
˄‫ޜ‬䟼˅ ਁࣘᵪབྷ‫ˈ؞‬䮇㕨ˈ⍫ຎ⧟ਈॆㅹ
6-5
Ǆ⟳⋩઼㔤‫؞‬䍩⭘ਟԕ߿ࡠᴰվⲴ䲀ᓖǄ Ǆᖃ⭥অ䖖䖜䇙ᰦˈᆳᱟаᷦਟԕ㧧ᗇᖸྭӔ᱃
ԧⲴӗ૱
⟳⋩⎸㙇
ᴹ㔤‫؞‬
100%
㾶ⴆ䐍⿫˄‫ޜ‬䟼˅
ᇒᡧⲴ䘀㹼ᡀᵜ˄⟳ᯉᡀᵜ࣐‫઼ޫ؍‬㔤‫؞‬䍩⭘˅
6 S ᰐ㔤‫؞‬
䖳儈Ⲵ㔤‫؞‬䍩⭘ wong solo
ᴹ㔤‫؞‬
㾶ⴆ䐍⿫˄‫ޜ‬䟼˅
6-6
䖖ѫⲴᐕާव
ᇊᵏỰḕǃ䈳ᮤо⏖━ሶ䇙֐Ⲵ᪙ᢈ
䖖༴Ҿᴰᆹ‫ޘ‬ǃᴰᴹ᭸Ⲵ⣦ᘱǄᆹ‫ޘ‬
ᙗᱟᡰᴹ䖖䖶ᤕᴹ㘵傮傦ઈⲴѹ࣑Ǆ 䘋㹼㔤ᣔᰦ࣑ᗵ‫ޣ‬䰝ᕅ᫾ˈ䲔䶎ਖᴹ
䖖䖶Ựḕǃ䈳ᮤ઼⏖━Ⲵ㾱⛩ሶ൘л 㿴ᇊǄ
z↓൘䘀㹼Ⲵᕅ᫾䘀ࣘ䜘Ԧਟሩ䓛փ
亥䶒ѝԄ㓶䈤᰾Ǆ
ᇊᵏ㔤ᣔമ㺘Ⲵᰦ䰤䰤䳄ᓄ䈕㻛㿶Ѫ 䜘սᡆ㺓ᴽ䙐ᡀаᇊⲴՔᇣˈ⭥ಘ
↓ᑨ僁㹼ᶑԦла㡜ᤷሬǄ❦㘼ˈਆ 䜘Ԧҏਟ㜭ሬ㠤⭥ࠫᡆ⚛⚮Ǆ
z൘㔤‫؞‬ᰦ䘀㹼ᕅ᫾ˈਟ㜭Պሬ㠤⵬
ߣҾཙ≄ǃൠᖒǃൠ⨶ս㖞઼њӪ֯ 1
⭘ˈ㔤ᣔ䰤䳄ਟ㜭䴰㾱㕙⸝Ǆ 䜘ਇՔˈ✗Քˈ⚛⚮ᡆа≗ॆ⻣ѝ
∂̢ഐ↔䙐ᡀ↫ӑǄᴤཊ‫ޣ‬Ҿа
≗ॆ⻣Ⲵؑ᚟ˈ䈧৲㿱ㅜ亥Ǆ 1 䖖ѫⲴᐕާव
’
䖖ѫⲴᐕާव㖞ҸᓗᑝлⲴۘ㯿४ Ǆ
ᰐ⌅↓⺞ൠ㔤ᣔ᪙ᢈ䖖ᡆᢗ㹼㔤ᣔ⍫ ˄৲㘳亥˅ 7
ࣘнᖃሶՊ໎࣐֐ⲴՔᇣᡆ↫ӑⲴ仾 ᐕާ㇡޵Ⲵሿ޼ᆀᡰ䈤᰾Ⲵ䍴ᯉˈᱟ
䲙ˈᡆ൘֯⭘᪙ᢈ䖖ᰦ䙐ᡀՔӑǄྲ у‫׋‬䖖ѫ䘋㹼亴䱢㔤‫઼؞‬ሿ‫؞‬ᱟ㘳⭘
᷌֐н⟏ᚹ᪙ᢈ䖖㔤‫ˈ؞‬䈧ࡽᖰ䳵傜 Ǆ↔ཆˈਖཆᴹᢝ⸙ᢣ᡻ˈᱟ‫׋‬䘲ᖃ
WARNING
૸㓿䬰୶䘋㹼㔤‫؞‬Ǆ Ⲵᤗ㍗㷪⇽઼㷪ṃ⭘ Ǆ
ࡩ䖖ⴈˈࡩ䖖䫣ˈ啃઼޵㺜൘֯⭘䗷
〻ѝӗ⭏བྷ䟿✝㜭ǄѪҶ䚯‫⚬ݽ‬Քˈ ᨀ⽪
࣑ᗵ䇙ࡩ䖖㓴Ԧᮓ✝ਾ޽䀖᪨ᆳԜǄ ྲᛘ⋑ᴹᐕާᡆ㔤‫Ⲵ؞‬㓿傼ˈਟင⭡
䳵傜૸ԓ⨶୶ԓ࣎Ǆ
7-1
ᇊᵏ㔤ᣔ઼䈳ᮤ
ᨀ⽪
_
ƽ⇿ᒤⲴỰḕᱟᗵ㾱Ⲵˈ䲔䶎ᱟᐢ㓿‫ڊ‬Ҷപᇊ䖖〻Ⲵ‫ޫ؍‬
ƽྲᐢ䗷Ҷ‫ޜ‬䟼ˈ䈧⇿䳄‫ޜ‬䟼ቡ‫ڊ‬ᇊᵏ‫ޫ؍‬Ǆ
ƽḷᴹþ ÿਧⲴ亩ⴞਚ㜭⭡䳵傜૸ԓ⨶୶䘋㹼㔤‫ˈ؞‬ഐѪ䘉䴰㾱⢩࡛Ⲵᐕާˈ䍴ᯉ৺ᢰᵟǄ
_
ᇊᵏሩᧂ᭮᧗ࡦ㌫㔏㔤ᣔ㺘
䟼〻㺘䈫ᮠ˄ԕ‫ࡠݸ‬㘵Ѫ߶˅
㕆ਧ 亩ⴞ Ựḕᡆ㔤ᣔъ ‫ޜ‬䟼 ‫ޜ‬䟼 ‫ޜ‬䟼 ‫ޜ‬䟼 ‫ޜ‬䟼
㾱Ѹ 㾱Ѹ 㾱Ѹ 㾱Ѹ
ᒤỰ
㾱Ѹ
њᴸ њᴸ њᴸ њᴸ њᴸ
⟳⋩㇑ ЬỰḕ⟳⋩㇑৺ⵏオ㇑ᱟ੖ᴹ㻲ⰅǄ
⟳⋩☮␵ಘ ЬỰḕᛵߥǄ ⇿‫ޜ‬䟼˄㤡䟼˅

7
ЬỰḕᛵߥǄ
⚛㣡ຎ Ь␵⨶ᡆᴤ᭩オ䳉Ǆ

ЬᴯᦒǄ ⇿‫ޜ‬䟼˄㤡䟼˅
4 * ⍫䰘 ЬỰḕ⍫䰘䰤䳄Ǆ ⇿‫ޜ‬䟼˄㤡䟼˅
Ьྲᴹᗵ㾱䈳ᮤǄ
Ь䈳ᮤオ䖜䙏ᓖǄ

5 * ⟳⋩ತሴ Ь␵⌱ˈỰḕ௧⋩䟿
઼௧ሴಘⲴ䀂ᓖǄ ⇿‫ޜ‬䟼˄㤡䟼˅
ᧂ≓㌫㎡ Ь ⃒ḕᱟ੖ᴹ⍙┿Ǆ
Ь ྲᴹᗵ㾱ˈᬠ㏺Ǆ

Ь ᴤᨋ຺സ˄⅑˅ˈྲ᷌ᴹᗵ㾱
Ⲵ䂡Ǆ
7-2
㔤‫━⏖઼؞‬മ㺘
䟼〻˄‫ޜ‬䟼˅
㕆ਧ 亩ⴞ Ựḕᡆ㔤ᣔъ 㾱Ѹ 㾱Ѹ 㾱Ѹ 㾱Ѹ 㾱Ѹ ᒤỰ
ᴸ ᴸ ᴸ ᴸ ᴸ
Ь֯⭘Ǆᢗ㹼ࣘᘱỰḕ䳵傜૸䇺
䇺ᯝ㌫㔏ḕ
ᯝᐕާǄ
ЬỰḕ䭉䈟ԓ⸱Ǆ
Ь␵⍇Ǆ
オ≄└␵ಘ‫ݳ‬㍐
ЬᴤᦒǄ ⇿‫ޜ‬䟼˄㤡䟼˅
ЬỰḕ⭥঻Ǆ
㫴⭥⊐
Ьྲ䴰㾱ˈᴤᦒ⭥⊐Ǆ
ЬỰḕ᫽֌Ǆ
⿫ਸಘᵶ
Ь䈳ᮤǄ
7
ЬỰḕ᫽֌ˈ⏢փⲴ≤ᒣ઼অ䖖

᡻⢉ᵶ ЬⲴ⏢փⓒ┿Ǆ
Ьᴤᦒࡩ䖖⡷Ǆ ⇿ᖃ⼘ᦏࡠᶱ䲀
ЬỰḕ᫽֌ˈ⏢փⲴ≤ᒣ઼অ䖖
ࡽࡦࣘಘ ЬⲴ⏢փⓒ┿Ǆ
Ьᴤᦒࡩ䖖⡷Ǆ ⇿ᖃ⼘ᦏࡠᶱ䲀
ЬỰḕᱟ੖ᴹ㻲㓩ᡆᦏൿǄ
ЬỰḕᱟ੖ᴹ↓⺞Ⲵ䐟⭡઼
ਾࡦࣘಘ
ཀྵ㍗Ǆ
ЬᴤᦒǄ ⇿ᒤ
7-3
ᴸ ᴸ ᴸ ᴸ ᴸ
ࡦࣘ⏢ ЬᴤᦒǄ ⇿ᒤ
䖞 ЬỰḕᒣ㺑ᓖ઼ᦏൿǄ
ЬỰḕ㷪喯␡ᓖ৺ᦏൿᛵߥǄ
Ьྲᴹᗵ㾱ˈᴤᦒǄ
䖞㛾 ЬỰḕ≄঻
Ьྲᴹᗵ㾱ˈ䈧ᴤ↓Ǆ
䖖䖞᢯ ЬỰḕ䖞᢯ᱟ੖ᶮᕋᡆᦏൿǄ
s Ựḕ᫽֌৺ཊ։⑨䳉Ǆ
਺㟲
s 䬲ⲲѪѫ㾱━㜲⏖━Ǆ ⇿‫ޜ‬䟼˄㤡䟼˅
ЬỰḕ䬮ᶑᶮᕋˈ䈳ᮤ઼ᶑԦǄ
7 ⇿‫ޜ‬䟼˄㤡䟼˅઼⍇᪙ᢈ䖖ˈ僁൘䴘ѝᡆѻਾ
䖜ࣘ䬮 Ь䈳ᮤ઼⏖━䬮ᑖ⢩↺Ⲵ2ර⧟
僁൘▞⒯Ⲵൠᯩ
䬮⏖━ࡲᖫᓅǄ
s Ựḕ䖤᢯Ⲵᶮᕋᓖ઼䖜ੁᵪ

ᶴⲴḄ━ᓖǄ
䖜ੁ䖤᢯
s ԕ䬲ⲲѪѫࡲⲴ━㜲⏖━Ǆ ⇿‫ޜ‬䟼˄㤡䟼˅
7-4
ᴸ ᴸ ᴸ ᴸ ᴸ
s ⺞‫؍‬ᡰᴹⲴ㷪⇽ˈ㷪ṃ઼㷪
䖖䓛㻵䝽㍗ᓖ
э䜭㻛䬱㍗Ǆ
ࡩ䖖ᵶ᷒䖤 Ь֯⭘⹵㜲⏖━
ࡩ䖖䐿ᶯ᷒䖤 Ь֯⭘䬲Ⲳส⏖━㜲⏖━
⿫ਸಘᵶ᷒䖤 Ь֯⭘䬲Ⲳส⏖━㜲⏖━
ᦒᥑ䐿ᶯ᷒䖤 s֯⭘䬲Ⲳส⏖━㜲⏖━
s Ựḕ᫽֌Ǆ
‫ח‬᭟ᷦ s ⏖━Ǆ 7
ࡽ৹ s Ựḕ᫽֌઼┿⋩Ǆ
߿䴷ಘ㻵䝽 s Ựḕ᫽֌৺䴷ࣘಘǄ
s ᴯᦒǄ
ᵪ⋩
s Ựḕ⋩ս৺অ䖖┿⋩Ǆ
ᵪ⋩䗷└ಘ s
7-5
ᴸ ᴸ ᴸ ᴸ ᴸ
ЬỰḕߧত⏢⏢ս৺⭥অ䖖ߧ

ত⏢⏢┿Ǆ
ߧত㌫㔏
ЬᴯᦒǄ ⇿ᒤ
ࡽਾࡦࣘಘ ЬỰḕ᫽֌Ǆ
〫ࣘ䜘ս઼㔶㓯 Ь⏖━Ǆ
ЬỰḕ᫽֌઼⑨䳉Ǆ
⋩䰘᡻ᢺ Ьྲᴹᗵ㾱ˈ䈳ᮤ⋩䰘ᡰ⑨䳉Ǆ
Ь⏖━⋩䰘㍒Ǆ
7
⚟‫ˈݹ‬䇟ਧ઼ަԆ ЬỰḕ᫽֌Ǆ
⭥ࡦ Ь
7-6
EAU62401
ᨀ⽪
⏢঻ࡦࣘಘ‫ޫ؍‬
s
s
s
7-7
2.
নл઼ᆹ㻵䶒ᶯ
ᱮ⽪Ⲵ䶒ᶯ䴰㾱ࡐ䲔᡽㜭ᢗ㹼ᵜㄐ
ӻ㓽ⲴḀӋ㔤ᣔᐕ֌Ǆ⇿⅑䴰㾱᣶ 1
ন઼ᆹ㻵䶒ᶯᰦ䈧৲䰵ᵜ㢲Ǆ
3
3
4
1
2
3 2 1 2 3
3 ᮤ⍱㖙$
ᣅᖡᮤ⍱㖙
ᆄ
ᮤ⍱㖙$
㷪ṃ
7
ᘛ䙏㷪э䪹 ᆹ㻵㷪䪹ˈᘛ䙏㍗പԦ઼㷪ṃǄ
㷪э
ᆹ㻵䶒ᶯ$ˈ%઼&˄䈧৲䰵ㅜ
4 亥˅
$㓴
%㓴㾱ᆹ㻵ᮤ⍱㖙
&㓴
ᮤ⍱㖙$
ሶᣔ㖙кⲴケࠪ䜘࠶ᆹ㻵ࡠ 䶒ᶯ$
EAU77170
ᆄѝǄ
ᮤ⍱㖙$ নл䶒ᶯ
᣶лഋњᘛ䙏㍗പԦ઼ањ㷪ṃˈ
㾱〫䲔䶒ᶯ ❦ਾনл䶒ᶯǄ
নл䶒ᶯ$ˈ%઼&˄䈧৲䰵ㅜ亥˅Ǆ
7-8
3
2
2
1 3
2 1
1
3 4
ᘛ䙏㍗പԦ ሿ㓴%
ᘛ䙏㍗പԦ
㷪э ᣅᖡ䶒ᶯ
䶒ᶯ$
മ% ᆄ
㷪ṃ
㷪ṃ
ᆹ㻵䶒ᶯ ᆹ㻵䶒ᶯ&˄䈧৲䰵ㅜ亥˅Ǆ
7
ሶ䶒ᶯ᭮൘৏࿻ս㖞ˈ❦ਾᆹ㻵㷪 ਆлᘛ䙏㍗പԦˈ㷪ṃ઼ᤗ㍗ˈ ᆹ㻵҈ᇒ઼傮傦ઈᓗἵ˄䈧৲䰵
䪹઼㷪ṃǄ ❦ਾਆлᮤ⍱㖙Ǆ ㅜ亥˅
䶒ᶯ% ᆹ㻵䶒ᶯ 䶒ᶯ&

ሶᣅᖡ䶒ᶯ᭮‫ޕ‬ᆄѝˈ❦ਾᆹ
নл䶒ᶯ 㻵㷪䪹ˈ㷪ṃ઼ᘛ䙏㍗പԦǄ নл䶒ᶯ
᣶л҈ᇒᓗἵ઼傮傦ઈᓗἵ˄䈧 ᣶л҈ᇒᓗսǄ䈧৲䰵ㅜ亥˅
৲䰵ㅜ亥˅ নл㷪ṃ઼㷪䪹ˈ❦ਾনл䶒ᶯǄ
নл䶒ᶯ&˄䈧৲䰵ㅜ亥˅Ǆ
7-9
1 3 Ựḕ⚛㣡ຎ
⚛㣡ຎᱟᕅ᫾Ⲵ䟽㾱䜘Ԧѻаˈ㘼фᇩ
᱃ỰḕǄสҾ✝㜭઼⊹〟Պ䙐ᡀ⚛㣡ຎ 1
䙀⑀‫ץ‬㲰ˈഐ↔⚛㣡ຎᗵ享ṩᦞᇊᵏ㔤
‫━⏖؞‬㺘᣶䲔৺ỰḕǄਖཆˈ⚛㣡ຎ
Ⲵ⣦ߥՊᴍ䵢ᕅ᫾Ⲵ⣦ߥǄ
2 2
㷪э ⚛㣡ຎᢣ᡻
㷪ṃ ᣶䲔⚛㣡ຎ 㷪э࠰
䶒ᶯ&
࡚䲔ᮤ⍱㖙$˄৲㘳̢亥˅ ྲമ⽪ˈ࡙⭘ᐕާ㇡䟼Ⲵ⚛㣡ຎᢝ
ᆹ㻵䶒ᶯ ⸙ᢣཤ᣶䲔⚛㣡ຎǄϔ
7 Ựḕ⚛㣡ຎ
ᆹ㻵䶒ᶯˈ❦ਾᆹ㻵㷪䪹઼㷪ṃǄ
ᆹ㻵҈ᇒᓗἵǄ˄䈧৲䰵ㅜ亥˅ 1 Ựḕ⚛㣡ຎ⭥ᶱѝᗳഋઘⲴⲭ⬧䜘
࠶ᱟ੖ᱮ⽪哴㽀㢢൘↓ᑨⲴ㹼傦
⣦ᘱлⲴḷ߶仌㢢Ǆ
ᨀ⽪
ྲ᷌⚛㣡ຎ੸⧠᰾ᱮаṧⲴ仌㢢ˈਟ㜭
ᖡ૽ᕅ᫾ᦏൿǄн㾱㠚㹼䘋㹼䰞仈䇺ᯝ
Ǆ䈧ራ≲䟾傜૸ԓ⨶୶Ựḕ䈕䖖ᆀǄ
⚛㣡ຎ䳉
᡽ᔰ⚛㣡ຎⴆ
7-10
Ựḕ⚛㣡ຎ⭥ᶱⲴ㞀㲰઼〟⛝ᡆ ᆹ㻵⚛㣡ຎ ਁࣘᵪ⋩઼⋩䗷└ಘ
ަԆᵲ⢙Ǆ㤕䴰㾱ˈ䈧ᴯᦒǄ ␵䲔ෛ⡷Ⲵ㺘䶒઼䲔৫㷪㓩䜘⊑ ᵪ⋩⋩սᓄᖃ൘⇿а⅑㹼傦ࡽỰḕǄ
ᤷᇊ⚛㣡ຎ˖ ⛩Ǆ 㘼фˈᵪ⋩ᗵ享ṩᦞᇊᵏ㔤‫━⏖؞‬
NGK/MR8E9 ᤗ㍗㠣ḷ߶࣋⸙˖ 㺘ᴤᦒǄ
Ựḕᵪ⋩⋩ս
ᤗ㍗࣋⸙˖
Ǆᢺ䖖ᆀ‫〫ڌ‬кѫᷦḡǄ
࡙⭘㓯㿴⍻䟿⚛㣡ຎ䳉ˈྲᴹᗵ㾱ˈ ⚛㣡ຎ˖
䈳ᮤѪ㿴ᇊ٬Ǆ ⢋亯‫ޜ‬ቪ˄‫ޜ‬ቪ‫ޜ‬ᯔ࣋ Ǆਁࣘᕅ᫾ˈ亴✝ᮠ࠶䫏ˈ❦ਾ᚟
㤡ቪ⻵࣋˅ ᦹǃᕅ᫾Ǆ
Ǆㅹᖵࠐ࠶䫏ˈᖵ⋩ᒣ᚟ˈ❦ਾỰ
ᨀ⽪ ḕ⋩ս䙊䗷սҾỰḕデਓ൘ਣл
ྲᛘᆹ㻵⚛㣡ຎᰦ⋑⭘ᢝᢣཤˈ↓⺞Ⲵ ‫Ⲵח‬ᴢ䖤㇡Ǆ
ᢝ⸙ਟ⭘᡻ᤷ䖜ࡠ㠣സˈᶕ֌
ྭ亴㇇Ǆ❦㘼ˈ⚛㣡ຎᓄቭᘛ䈳ᮤ㠤ḷ 7
߶ᢝ⸙Ǆ
㻵к⚛㣡ຎⴆǄ
⚛㣡ຎ䳉
㻵к፼ᶯǄ
⚛㣡ຎ䳉˖
̢Y∛㊣˄̢਻）
7-11
‫⋩ྲٷ‬ս൘ᡆվҾᴰվ⋩սˈ␫
࣐䏣ཏⲴ᧘㦀⭘⋩㠣↓⺞Ⲵ⋩սǄ 4
ᢺ䟿⋩ቪ᭮‫⋩ޕ‬ຎᆄѝˈ❦ਾᢺ
3
⋩ຎ䬱㍗Ǆ
2
㾱ᴤ᭩ਁࣘᵪ⋩઼␵⌱Ⲵ⋩䗷└ಘ 1
ਁࣘᕅ᫾ˈ亴✝ᮠ࠶䫏ˈ❦ਾ᚟
ZAUE0033
1 ᦹᕅ᫾Ǆ ZAUE0672 5
Ǆᵪ⋩ຎ Ǆ᭮㖞൘ਁࣘᵪ⋩ᓅ༣᭦䳶ᓏ⋩Ǆ Ǆᵪ⋩⋴⋩㷪䪹
Ǆ᣶䲔⋩ຎ઼⋴⋩ຎˈᢺ⋩Ӿᴢ䖤 Ǆ2സ
ᨀ⽪ Ǆᕩ㉗
㇡䟼⋴ࠪǄ⌘᜿˖ᖃਆࠪ᭮⋩㷪
Ǆ└ಘ
ṃਁࣘᵪˈ2ර⧟ˈ঻㕙ᕩ㉗ˈ
Ǆ⋩ⴆ
7 ⋩䗷└ಘՊᦹлᶕǄ⌘᜿н㾱ཡ
৫䘉Ӌ䜘࠶Ǆ[ECA11002]
⭘ⓦࡲ␵⌱ਁࣘᵪ⋩└㖁
1
ᨀ⽪
2
3
Ǆ
ZAUE1300
ਁࣘᵪ⋩ቪ
ᴰབྷ〻ᓖḷ䇠
ᨀ⽪ਁࣘᵪ⋩ቪⲴ
7-12
࣋⸙˖ ᧘㦀ᵪ⋩˖
⋩└ಘⴆ㷪䪹˖ 䈧৲䰵亥Ǆ
2 ⢋亯‫ޜ‬ቪ˄‫ޜ‬ቪ‫ޜ‬ᯔˈ ⋩䟿˖
㤡ቪǃ⻵ǃ࣋˅ ⋑ᴹ⋩└ಘᴯᦒ
1 ‫ ˄ॷޜ‬㖾ഭཨ㝡˅
˄ ᑍഭཨ㝡˅
ᨀ⽪ ⋩└ಘᴯᦒ
⺞‫؍‬2സᆹ㻵↓⺞Ǆ ‫˄ॷޜ‬㖾ഭཨ㝡˅
˄ ᑍഭཨ㝡˅
_
ZAUE1217
Ǆᆹ㻵ᕅ᫾⋩└ಘˈᕩ㉗ˈ2സ઼ᕅ ⌘᜿
Ǆ㷪䪹 ᫾⋴⋩㷪䪹ˈ❦ਾ䖜㍗ᕅ᫾⋴㷪䪹
Ǆ⋩└㭺ⴆ 㠣ᤷᇊ࣋⸙Ǆ Ѫ䚯‫⿫ݽ‬ਸಘ━ࣘ˄ᵪ⋩ҏՊ⏖━
⿫ਸಘ˅ˈ࡛␧ਸԫօॆᆖ␫࣐ࡲǄ
Ǆ O- ࣋⸙˖ нਟ⭘Ā&'āḷ߶Ⲵᵪ⋩˄Ḥ⋩ᵪ
ᕅ᫾⋴⋩㷪䪹˖ ⭘Ⲵ˅ᡆ儈㓗䗷ᤷᇊḷ߶Ⲵᵪ⋩Ǆ
⢋亯‫ޜ‬ቪ˄‫ޜ‬ቪ‫ޜ‬ᯔˈ 䲔↔ѻཆˈн㜭⭘ḷᴹā(1(5*< 7
1 㤡ቪǃ⻵ǃ࣋˅ &216(59,1*,,ᡆᴤ儈Ⲵᵪ⋩Ǆ
⺞‫⋑؍‬ᴹᔲ⢙䘋‫ޕ‬ᵪ⋩㇡Ǆ
Ǆ␫࣐ᤷᇊ䟿Ⲵ᧘㦀ᵪ⋩ˈ❦ਾᆹ㻵
৺䬱㍗ᕅ᫾⌘⋩㇑ⴆǄ Ǆ䎧ࣘᕅ᫾ˈ䇙ᆳ䰝⵰ࠐ࠶䫏ˈ਼ᰦ
Ựḕᱟ੖┿⋩Ǆ㤕┿⋩ˈ傜к‫ޣ‬ᵪˈ
2 Ựḕ৏ഐǄ
ZAUE0104
Ǆ‫ޣ‬кᕅ᫾ˈỰḕ⋩սǄ㤕䴰㾱ˈ䈧
1 ᭩↓Ǆ
2
Ǆᆹ㻵⋩└ಘⴆ઼㷪䪹ˈ❦ਾ䖜㍗ᆳ
㠣ᤷᇊ࣋⸙Ǆ 7-13
ߧতࡲ 䙊䗷Ựḕߧত⏢⏢սỰḕデਓǄ
ߧতࡲⲴ≤ᒣᓄ൘⇿⅑ỰḕⲴ᯵〻Ǆ
↔ཆˈߧত⏢ᗵ享᭩ਈ൘ᇊᵏ‫઼ޫ؍‬
ᨀ⽪
⏖━മ㺘㿴ᇊⲴᰦ䰤䰤䳄Ǆϔ
ߧতࡲѻ䰤ᓄᴰվ઼ᴰ儈≤ᒣⲴḷ
㾱Ựḕߧতࡲ≤ᒣ ᘇǄ
1
ሶ䖖䖶᭮൘≤ᒣ䶒кǄ
᣶лᮤ⍱㖙$˄䈧৲䰵ㅜ亥˅
ሶ䖖䖶ㄆⴤ᭮㖞ս㖞
ߧত⏢ۘ⏢ಘⴆ
ᨀ⽪
1 ␫࣐ߧতࡲⲴᴰ儈≤ᒣḷ䇠ˈ❦ਾ
t ≤ᒣⲴߧত⏢ᗵ享Ựḕ൘ањሂ FULL
ᆹ㻵ۘᑭǄ⌘᜿˖ྲ᷌⋑ᴹߧত
2
ߧⲴਁࣘᵪоਁࣘᵪⲴ≤ᒣˈഐ 3
LOW
ࡲˈਟԕ⭘㫨便≤ᡆ㠚ᶕ≤ᶕԓᴯ
7
Ѫ⑙ᓖਈॆǄϔ Ǆ䈧н㾱֯⭘ᓄ≤ᡆⴀ≤ഐѪԆՊ
t ⺞‫؍‬䖖䖶Ⲵս㖞ⴤ㓯кॷᰦˈỰ Քᇣᕅ᫾Ǆྲ᷌ᐢ㓿֯⭘Ҷ㠚ᶕ≤
Ǆߧত⏢⏢սỰḕデਓ
ḕߧতࡲⲴ≤ᒣǄ䖫ᗞⲴ‫ٮ‬ᯌࡠ Ǆᴰ儈≤սḷ䇠 ˈᓄ䈕ቭᘛൠᴤǄ[EWA15162]
а䗩ਟ㜭ሬ㠤㲊‫ٷ‬䈫ᮠǄ Ǆᴰվ㓗࡛ḷᘇ
ᦒߧতࡲԕ䚯‫ݽ‬ᕅ᫾Ⲵߧত㌫㔏н
㜭䗮ࡠ↓ᑨⲴߧত࣏᭸Ǆ㤕ߧতࡲ
Ǆྲ᷌ߧতࡲᱟ൘ㅹҾᡆվҾᴰվ㓗 ␧ਸҶ␵≤ᡆ㫨便≤ˈ䈧ቭᘛငᢈ
࡛Ⲵḷ䇠ˈ৫䲔ਣൠᶯෛ᣹ੁкǄ 䳵傜૸ԓ⨶୶ỰḕߧতࡲⲴ䱢㔃ߠ
⢙䍘Ⲵ࠶䟿ԕ䚯‫ߧݽ‬ত࣏᭸ᖡ૽Ǆ
[ECA10473]
7-14
オ≄└␵ಘⲴ␵⨶
ߧত‭ᇩ䟿˄㠣ᴰ儈㓗࡛ḷ䇠˅
/˄86TWˈ,PSTW˅ オ≄└␵ಘᗵ享‫➗׍‬ᇊᵏ‫ޫ؍‬ԕ৺⏖
━㺘ᶕ␵⨶Ǆ㤕ᛘᰦᑨ൘‫▞┑ݵ‬⒯ᡆ
ᆹ㻵ᮤ⍱㖙Ǆ ቈෳⲴൠ४㹼傦ˈ䈧㓿ᑨ␵⨶オ≄└
␵ಘǄ
নл䖖᡻ᓗսǄ˄䈧৲䰵ㅜ亥˅ 1
ᴤᦒߧতࡲ ᣶лᮤ⍱㖙$˄䈧৲䰵ㅜ亥˅
ߧতࡲᓄ‫׍‬ᇊᵏ㔤‫؞‬৺䖞━ḷⲴ䰤䳄ᵏ Ӿѝਆࠪ㷪䪹઼㷪ṃ⋩㇡ⴆǄ
‫ڊ‬ᴤᦒǄ䈧ငᢈԓ⨶୶ᴤᦒ⭥অ䖖Ⲵߧ Ӿ⟳⋩㇡к᣶л㷪ṃǄ Ǆ オ≄└␵ಘ‫ݳ‬Ԧ
তࡲǄ ᣹ࣘ⟳⋩⌥䖟㇑ˈ㙖ਸಘ⟳⋩⌥
䆖੺ʽᖃᕅ᫾൘✝Ⲵᛵߥлˈॳзнਟ Ǆ䖫䖫ൠᮢᢃオ≄└␵ಘᡀԭԕ‫ׯ‬৫
઼⋩㇡䖟㇑᣹ࣘӾ⋩㇡䟼ࠪᶕǄ
ᢃᔰᮓ✝ಘⲴⴆǄ 䲔བྷ䜘࠶ⲴቈෳǄ❦ਾ⭘঻㕙オ≄
Ǆ᣶䲔㷪э઼ཀྵ䫣ԕ‫ׯ‬᣶䲔オ≄└ ᶕ੩ᦹ࢙։ⲴቈෳǄྲオ≄└␵ಘ
␵ಘ㇡ⴆǄ❦ਾ᣹ࠪオ≄└␵ಘ ᴹᦏൿ˗䈧ᴯᦒǄ 7
‫ݳ‬ԦǄ
Ǆ オ≄└␵ಘ‫ݳ‬Ԧ
7-15
Ǆᢺオ≄└␵ಘᡀԭ㻵‫ޕ‬オ≄└␵ಘ オ䖜䙏ᓖⲴ䈳ᮤ ᨀ⽪
ಘ㇡Ǆ ᕅ᫾オ䖜䙏ᓖᗵ享㿱Ựḕˈྲᴹᗵ㾱ˈ ྲ᷌ᕅ᫾オ䖜䙏ᓖᰐ⌅ྲ䈤᰾㧧ᗇˈ䇙
ṩᦞᇊᵏ㔤‫━⏖؞‬㺘䈳ᮤǄ 䳵傜૸ԓ⨶୶‫ࠪڊ‬䈳ᮤǄ
⌘᜿˖⺞‫⇿؍‬њオ≄└␵ಘᡀԭ䜭䘋㹼䘉њ䈳ᮤࡽᕅ᫾ᗵ享‫ݸ‬亴✝Ǆ
↓⺞ൠᆹ㻵൘㇡ᆀ䟼Ǆᕅ᫾㔍ሩн Ựḕᕅ᫾Ⲵオ䖜䙏ᓖǄ㤕䴰㾱䖜ࣘ⋩䰘
㜭ᰐ└␵ಘⲴᆹ㻵ᛵߥл᫽֌ˈ੖ ‫→ڌ‬㷪э㠣ᡰ享オ䖜䙏ᓖǄ㾱໎࣐ᕅ᫾
ࡉ⍫ຎ৺≄㕨ሶՊѕ䟽ᦏൿǄ オ䖜䙏ᓖˈ䖜㷪эᖰᯩੁDǄ㾱߿ቁオ
䖜䙏ᓖˈ䖜㷪эᖰᯩੁEǄ
Ǆᆹ㻵㷪э઼ཀྵ䫣ԕᆹ㻵オ≄└␵ಘ
㇡Ǆ
ᨀ⽪
㤕オ≄└␵ಘỰḕ㇑㚊Ҷቈෳᡆ≤࠶ˈ (b)
ᶮᔰཀྵ䫣❦ਾ᣶䲔⚛㣡ຎᶕ␵⨶Ựḕ
(a)
㇑Ǆ
7
പᇊ⟳⋩䖟㇑ˈ䘎᧕ಘ⟳⋩⌥઼⋩
㇡䖟㇑Ǆ 1
ᆹ㻵⋩㇡ᒦᤗ㍗㷪ṃǄ オ䰢䈳㢲㷪䪹
❦ਾᆹ㻵⋩㇡ⴆᤗ㍗ᵪಘӪ઼㷪эǄ
ᆹ㻵ᮤ⍱㖙Ǆ ᕅ᫾オ䖜䙏ᓖ˖
ᆹ㻵҈ᇒᓗսǄ ̢ സ࠶䫏
7-16
Ựḕ⋩䰘ᣃ᡻㠚⭡䘀ࣘ ǄѪҶ໎࣐⋩䰘㍒Ⲵ⑨䳉ˈ䈧 ⍫䰘オ䳉

⍻䟿㢲≄䰘ᣃ᡻㠚⭡䘀㹼ˈྲമᡰ⽪Ǆ 䈳ᮤ㷪⇽ᖰᯩੁDǄѪҶ߿ ⍫䰘オ䳉ሶ䲿⵰֯⭘㘼ᴹᡰ᭩ਈǄ䙐
ቁ⋩䰘㍒Ⲵ⑨䳉ˈ䈧䈳ᮤ㷪 ᡀн൷㺑Ⲵオ≄⟳⋩␧ਸ઼ᡆᕅ᫾స
⇽ᖰᯩੁEǄ 丣ǄѪҶ䱢→䘉Ӌһਁ⭏ˈ⍫䰘オ䳉
ᗵ享⇿䳄а⇥⢩ᇊᰦᵏˈṩᦞᇊᵏ‫؍‬
ޫ৺⏖━㺘ˈ⭡䟾傜૸ԓ⨶୶䈳ᮤǄ
1
(a)
ZAUE0593
1 2 (b)
⋩䰘ᨑ㠚⭡ਁᥕ
⋩䰘ᨑ㠚⭡ਁᥕ䈳㢲㷪⇽ 7
䬱㍗㷪⇽
㢲≄䰘㠚⭡⑨ᠿ˖
PP˄㤡ረ˅
Ǆ䬱㍗䱢ᶮ㷪⇽Ǆ
ᇊᵏỰḕ㢲≄䰘ᣃᨑ㠚⭡ᓖˈྲ᷌ᴹ
ᗵ㾱ˈ䈧ᴹ䳵傜૸㓿䬰୶䈳ᮤǄ䟼〻
㺘⁑ᔿ
ᨀ⽪
ᕅ᫾オ䖜䙏ᓖᗵ享൘ᵚỰḕ৺䈳ᮤ
⋩䰘㍒⑨䳉ࡽ‫ࠪڊ‬䈳ᮤǄ
ᶮᔰ䬱㍗㷪⇽Ǆ
7-17
䖞㛾䖞㛾Ựḕ
䖞㛾ѻ䰤Ⲵୟа㚄㌫䖖䖶઼䚃䐟Ǆ൘ 䖞㛾≄঻˄ߧত⣦ᘱл⍻䟿˅
਴⿽ᶑԦлⲴᆹ‫Ⲵޘ‬僁ਆߣҾ⴨ሩሿ ࡽ䖞˄Ӫ˅˖
䶒〟Ⲵ䐟䶒᧕䀖Ǆഐ↔ˈᆳᗵ享‫؍‬ᤱ ॳᑅ˄‫ޜ‬ᯔ࣋ᒣᯩৈ㊣ˈSVL˅
㢟ྭⲴ䖞㛾ᶑԦ൘ԫօᰦ‫ى‬ᴤᦒ൘䘲 ਾ䖞˄Ӫ˅˖
ᖃⲴᰦ䰤оᤷᇊⲴ䖞㛾Ǆ ॳᑅ˄ॳ‫࣋ݻ‬ৈ㊣ˈSVL˅
ࡽ䖞˄Ӫ˅˖
䖞㛾≄঻ ॳᑅ˄‫ޜ‬ᯔ࣋ᒣᯩৈ㊣ˈSVL˅
䖞㛾≄঻ᗵ享Ựḕˈྲᴹᗵ㾱ˈ൘⇿ ਾ䖞˄Ӫ˅˖
⅑㹼傦ࡽ䈳ᮤǄ ॳᑅ˄ॳ‫࣋ݻ‬ৈ㊣ˈSVL
䖞㛾‫ח‬໱
ᴰ儈䍏㦧 ˖
䖞㛾⼘ᦏᤷ⽪ಘ
‫ޜ‬ᯔ˄⻵˅
䖞㛾㣡㓩␡ᓖ
䈕䖖䖶нᖃⲴ᫽֌䖞㛾঻࣋ਟ㜭Պᕅ
䎧ѕ䟽ⲴӪ䓛Քᇣᡆ↫ӑⲴᦏཡ᧗ࡦǄ 僁༛ǃ҈ᇒǃ㹼ᵾ৺䝽ԦⲴᙫ䟽䟿Ǆ
7 䖞㛾ᗵ享൘⇿⅑㹼傦ࡽỰḕǄྲ᷌䖞㛾
䖞㛾≄঻Ựḕ৺䈳ᮤᗵ享൘䖞㛾㣡㓩੸⧠⁚ੁ㓯˄ᴰվ㣡㓩␡ᓖ˅ˈᡆ
ߧতⲴ⣦ᘱл˄ֻྲ˖䖞㛾Ⲵ⑙ ᴹ䫱䪹ᡆ⧫⪳൘䟼䶒ˈᡆ䖞㛾‫ח‬䶒ᴹ㻲
ᓖ઼ཙ≄Ⲵ⑙ᓖᱟаṧⲴ˅ Ⰵˈ・ণራ≲䳵傜૸ԓ⨶୶ᴯᦒ䖞㛾Ǆ
䖞㛾≄঻ᗵ享ṩᦞᵜරਧᡰᢩ߶
Ⲵ僁༛ǃ҈ᇒǃ㹼ᵾ৺䝽ԦⲴ䟽 ࠷य䎵䖭Ⲵ䖖䖶Ǆሩ䎵䖭䖖䖶Ⲵ䘀㹼ਟ 䖞㛾ᴰվ㣡㓩␡ᓖ˄ࡽ䖞оਾ䖞˅˖
䟿䘋㹼䈳ᮤǄ 㜭ሬ㠤һ᭵Ǆ ∛㊣㤡ረ
7-18
䆖੺ 䖖䖞
ѪҶ㔤ᤱ⭥অ䖖Ⲵᴰ֣㺘⧠ǃ㙀⭘ᙗ
㙇ᦏⲴ䖞㛾Պ䙐ᡀড䲙Ǆᖃ㛾㓩 ࡽ䖞оਾ䖞Ⲵࡦ䙐о䇮䇑ᓄᖃаṧˈ
৺᫽֌ᆹ‫ˈޘ‬䈧⌘᜿ԕлࠐ⛩ᴹ‫ޣ‬䖞
ᐢᔰ࿻⼘ᦏࡠᤷ⽪㓯ˈ䈧傜к䍘 ੖ࡉ⭥অ䖖Ⲵ᫽֌⢩ᙗн㜭㻛‫؍‬䇱Ǆ
ᆀⲴ߶ࡉǄ
䈒䳵傜૸ԓ⨶୶ᴯᦒǄࡦࣘಘˈ 㓿䗷ᒯѿ⍻䈅ˈਚᴹԕлࡇࠪⲴ䖞㛾
䖞㛾઼䖞⇲Ⲵ⴨‫ޣ‬䜘Ԧᴤᦒ䘈ᓄ 㻛<DPDKD0RWRU&R/WGᢩ߶䘲⭘
൘⇿⅑֯⭘⭥অ䖖ѻࡽˈᗵ享Ự
䈕⮉㔉䳵傜૸㓿䬰୶Ǆ Ҿᵜරਧ
ḕ䖞സᱟ੖ᴹ㻲㕍ˈᕟᡆ㘈ᴢ઼
ᡰᴹ䖞ᆀ઼ࡦࣘ⴨‫Ⲵޣ‬䴦Ԧᴯᦒ ࡽ䖞㛾˖ 䗀᷍Ⲵᶮ㍗˄䗀䖞Ⅾᔿ㘼ᐢ˅ˈ
ˈवᤜ䖞㛾ˈᓄӔ⭡ᤕᴹуъ⸕ ቪረ˖ ᡆᦏൿǄྲ᷌ԫօਁ⧠ᦏᇣˈ䈧
䇶৺㓿傼Ⲵ䳵傜૸ԓ⨶୶Ǆ 100/80-17M/C 52P
ࡠ䳵傜૸㓿䬰୶ᴤᦒ䖖䖞Ǆн㾱
ࡦ䙐୶රਧ˖
IRC/RX-01F ቍ䈅‫ˈ༽؞‬ণ֯ᱟᴰሿⲴ㔤‫؞‬ᐕ
䖞㛾䍴䇟 ਾ䖞㛾˖ 〻Ǆਈᖒᡆ⹤㻲Ⲵ䖖䖞аᇊ㾱ᴤ
↔᪙ᢈ䖖䝽༷ᰐ޵㛾䖞㛾ˈ䖞㛾Ⲵオ≄䰰 ቪረ˖ ᦒǄ
઼ᣅ䖖䖞Ǆ 140/70-17M/C 66P
䖞㛾Ⲵᒤ喴ˈণ֯ԆԜ⋑ᴹ㻛֯⭘ᡆਚ㻛 ࡦ䙐୶රਧ˖ ᰐ䇪ᱟ䖞㛾ᡆ䖖䖞ᐢਈᴤᡆᴤᦒˈ7
‫ڦ‬ቄ֯⭘Ǆ㻲ॆ㛾䶒઼‫ח‬໱Ⲵₑ㜦ˈᴹᰦ IRC/RX-01R 䖖䖞ᓄ䈕ᱟ‫؍‬ᤱᒣ㺑ᙗⲴǄнᒣ
դᴹ㜤փਈᖒˈᱟ䇱ᦞ㘱ॆǄᰗ઼㘱ॆⲴ 㺑Ⲵ䖖䖞ਟ㜭Պሬ㠤ᙗ㜭н֣ˈ
䖞㛾ᓄ䙊䗷䖞㛾уᇦˈԕ⺞ᇊỰḕަ䘲ਸ
㔗㔝֯⭘Ǆ
н㢟Ⲵ᧗ࡦ⢩㢢ˈᒦ㕙⸝䖞㛾Ⲵ
ሯભǄ
7-19
䈳ᮤ᡻⢉ᵶ⑨䳉㤕㾱໎࣐᡻⢉ᵶⲴ⑨䳉ˈቡ㾱ᢺ ໎࣐䴒ਸಘắ㠚⭡Ⲭ᨞Ⲵᯩੁ˄D˅
䈳ᮤර㷪⇽䖜ੁD༴ˈ⴨৽Ⲵˈ
䃯ᮤ㷪⇽Ǆ⛪Ҷ⑋ቁ䴒ਸಘắ㠚⭡
ྲമᡰ⽪⍻䟿⿫ਸಘ㠚⭡䰤䳉㾱߿ቁ᡻⢉ᵶⲴ⑨䳉ˈቡ㾱ᢺ䈳 Ⲭ᨞ˈ䕹अ䃯ㇰ㷪⇽ᯩੁ˄E˅Ǆ
ᮤර㷪⇽䖜ੁEǄ ᤗ㍗㷪⇽൘ᴢ䖤㇡Ǆ
2 (a) ᨀ⽪ ᤗ㍗⿫ਸಘкⲴ䬱㍗㷪⇽❦ਾ━ࣘ
3 1
ྲ᷌ᤷᇊⲴ⿫ਸಘᵶ㠚⭡ਁᥕྲкᡰ䘠 ₑ㜦㾶ⴆࡠ৏ᶕⲴս㖞Ǆ
ˈн㜭ᗇࡠԕкⲴ↕僔ྲлǄ
4
(b)
ᆼ‫ޘ‬䕹अ䃯ㇰ㷪ṃ൘ᯩੁ˄D˅Ⲵ䴒
ਸಘ ắ⍋἞Ⲵ䴒ਸಘ᣹㐊Ǆ
儶䮻䧆㏺㷪⇽൘ᴢ䔨㇡
ₑ㜦ሱ䶒
⿫ਸಘ᡻ᷴ㠚⭡ਁᥕ䈳㢲㷪⇽
䬱㍗㷪⇽ (a)
7 ⿫ਸಘᵶ㠚⭡ਁᥕ
⿫ਸಘᵶ㠚⭡ਁᥕ
˄ረ˅ 1
(b)
ᗵ享Ո‫ݸ‬Ựḕ᡻⢉ᵶ⑨䳉ˈྲ䴰㾱ˈ
2
ṩᦞԕл↕僔䈳ᮤᆳ˖
ሶₑ㜦ⴆ━എ⿫ਸಘᵶǄ
䬱㍗㷪⇽
ᶮᔰ䬱㍗㷪⇽Ǆ ⿫ਸಘ᡻ᷴ㠚⭡ਁᥕ䈳㢲㷪⇽
7-20
Ựḕࡽࡩ䖖⡷ˈਾࡦࣘ䑴 ਾࡦࣘ䑴 EAU36721

Ựḕࡦࣘ⏢⏢ս
ࡽᯩ઼ਾᯩࡩ䖖⡷ࡦࣘ䑴ᗵ享Ựḕク൘ᇊᵏ‫؍‬
ޫ઼⏖━മ㺘㿴ᇊⲴᰦ䰤䰤䳄Ǆ 㹼傦ࡽˈỰḕࡦࣘ⏢⺞‫؍‬൘ᴰվ⏢ս
䇠ਧԕкˈྲᴹн䏣ˈ䈧㺕‫ݵ‬Ǆ
1 1
ࡽࡩ䖖⡷
EAU22432
ࡽࡦࣘ
ਾࡦࣘ䑴⼘ᦏᶱ䲀㓯
1 ਾࡦࣘ䑴⼘ᦏᤷ⽪ಘ
1
ਾࡦࣘ䑴䱴ᴹ‭⼘ᦏᤷ⽪ಘˈԕ‫ׯ‬䇙
֐޽н⭘᣶䲔ࡦࣘಘⲴᛵߥлỰḕࡽ 7
ࡦࣘෛ㙇ᦏ〻ᓖǄ㾱Ựḕਾࡦࣘ䑴Ⲵ
㙇ᦏ〻ᓖˈሏⴻ⼘ᦏᤷ⽪ಘ൘䘀⭘ࡦ ᴰվ⏢ս䇠ਧ
ࣘಘᱟⲴս㖞Ǆྲ᷌ਾࡦࣘ䑴⼘ᦏࡠ
ࡦࣘෛ‭⼘ᦏᤷ⽪ಘ Ҷ⼘ᦏᤷ⽪ಘⲴ⼘ᦏᶱ䲀㓯ˈራ≲䳵
⇿ࡽࡩ䖖ෛ⼘ᦏᤷ⽪ಘᨀ‫׋‬Ҷࠩ‭ˈᆳ 傜૸ԓ⨶୶ᴯᦒаᮤ྇Ⲵਾࡦࣘ䑴Ǆ
‫ݱ‬䇨֐Ựḕˈ㘼нᗵ᣶নࡦࣘࡩ䖖⡷Ⲵ
⼘ᦏǄ㾱Ựḕࡩ䖖⡷⼘ᦏˈỰḕ⋏‭⼘
ᦏᤷ⽪ಘǄྲ᷌ࡩ䖖⡷ᐢ⼘ᦏࡠ⋏‭Ⲵ
⼘ᦏᤷḷࠐѾ⎸ཡ⛩ˈᴹ䳵傜૸㓿䬰୶
ᴤᦒѪа㓴Ⲵࡩ䖖⡷
7-21
ਾࡩ䖖 Ь ࣐⋩ᰦˈн㾱䇙≤䘋‫ۘ⏢ࣘࡦޕ‬ ࡦࣘෛⲴ㙇ᦏ䙊ᑨՊ䙐ᡀࡦࣘ⏢≤ᒣ
⏢ಘǄ≤Պᱮ⵰䱽վ⍱փⲴ⋨⛩ˈ ᙕ僔л䱽Ǆվࡦࣘ⏢⏢սਟԕ㺘᰾⼘
ᒦਟ㜭ሬ㠤㫨≄䬱Ǆ ᦏⲴࡦࣘෛ઼ᡆࡦࣘ㌫㔏⑇┿ഐ
Ь Ѫ䱢→⊑ḃˈ൘᣶নѻࡽᓄ␵⌱ ↔ˈаᇊ㾱Ựḕࡩ䖖⡷Ⲵ⼘ᦏ઼ࡦࣘ
ۘ⏢㖀઼࣐⌘ਓⴆǄӵ֯⭘ᶕᇶ ㌫㔏ᴹᰐ⋴┿Ǆྲ᷌ࡦࣘ⏢սл䱽ケ
1 ሱᇩಘⲴᯠ勌ࡦࣘ⏢Ǆ ❦ˈᴹањࡽ䳵傜૸㓿䬰୶Ựḕ৏ഐ
Ь ӵ֯⭘ᤷᇊⲴࡦࣘ⏢Ǆ֯⭘н਼ 䘋а↕僁傜Ǆ
Ⲵࡦࣘ⏢ਟ㜭ሬ㠤ᴹᇣⲴॆᆖ৽
ᓄˈਟ㜭ሬ㠤ₑ㜦ᇶሱԦ࣓ॆᡆ
ሬ㠤ࡦࣘ㌫㔏Ⲵ޵䜘⭏䬸
ᴰվ⏢ս䇠ਧ
⌘᜿
ᤷᇊⲴࡦࣘ⏢˖
DOT 3 or DOT 4 ࡦࣘ⏢Պ䙐ᡀ⋩┶㺘䶒ᡆກ㜦ԦⲴ‫ץ‬
7 㲰Ǆণਟᣩ߰ⓒࠪⲴࡦࣘ⏢Ǆ
н↓ᖃⲴ㔤‫؞‬Պ䙐ᡀࡩ䖖ཡ⚥Ǆ䈧⌘
᜿ԕлһ亩˖
t ࠶䟿н䏣Ⲵࡦࣘ⏢ሶሬ㠤オ≄䘋
‫ࡩޕ‬䖖㌫㔏ˈഐ↔䱽վࡩ䖖ᙗ㜭
Ǆ
Ь н䏣Ⲵࡦࣘ⏢ਟ‫ݱ‬䇨オ≄䘋‫ࡦޕ‬
ࣘ㌫㔏ˈ䱽վࡦࣘᙗ㜭Ǆ

7-22
ᴤᦒࡦࣘ⏢
䈧ራ≲䳵傜૸ԓ⨶୶൘ᇊᵏ㔤‫⭥⭘֯ ━⏖؞‬অ䖖ࡽˈ䈧ỰḕՐࣘ䬮Ⲵᕐ࣋ˈ
㺘Ⲵ⌘䀓㺘ࡇࠪⲴ䰤䳄ᵏᴤᦒࡦࣘ⏢Ǆ ྲᴹᗵ㾱ˈ䴰䈳ᮤǄ
ਖཆˈ൘лࡇⲴ䰤䳄ᵏᡆԫօᦏൿᡆ
⋴┿ᰦᴯᦒࡦࣘᙫ⌥Ⲵ⋩ሱ઼঑ቪԕ ỰḕՐࣘ䬮Ⲵᕐ࣋
৺ࡦࣘ䖟㇑˖
ሶ᪙ᢈ䖖᭮൘‫ח‬䶒ṩᦞ〻ᒿ䈧৲䰵
ㅜ亥
ᨀ⽪
Րࣘ䬮ᶑᶮᕋ
൘Ựḕ઼䈳ᮤᰦ傡ࣘ䬮ᶮᕋˈᓄ䈕⋑ᴹ
൘᪙ᢈ䖖кⲴ䟽䟿Ǆ
ྲ᷌傡ࣘ䬮ᶑᶮᕋн↓⺞ˈྲл䈳ᮤǄ
Ǆ䈳ᮤਈ䙏ಘ㠣オẓⲴս㖞Ǆ 7
Ǆ⍻䟿Րࣘ䬮Ⲵᶮᕋྲമᡰ⽪Ǆ 䈳ᮤՐࣘ䬮Ⲵᕐ࣋
ᶮᔰ䖤㷪⇽઼ਾ䜘঑䫣᭟ᷦ㷪ṃ൘ਣ
Րࣘ䬮Ⲵᕐ࣋
∛㊣ ረ ‫ח‬᩶㟲Ⲵа‫ח‬Ǆ
7-23
ᨀ⽪
䈳ᮤਾ䖞ᰦˈ䈧֯⭘䖤ሩ߶ḷ䇠ˈ
֯⺞‫؍‬єњՐࣘ䬮䖖ཛ൘Ѫ䘲ᖃⲴ䖖䖞Ⲵ ԕ‫؍ׯ‬ᤱ↓⺞䖤Ⲵሩ߶Ǆ
⴨਼ս㖞ሩ喀Ǆ
1
1 2 (b)
䬱㍗㷪⇽
Ǆ䬱㍗Րࣘ䬮ˈ᯻䖜㖞൘਺㟲ቮㄟⲴ (a)
䈳ᮤ㷪⇽ᖰᯩੁ˄D˅ǄᤗᶮՐࣘ 3
䬮Ǆ᯻䖜㖞൘਺㟲ቮㄟⲴ䈳ᮤ㷪⇽
7
ᖰᯩੁ˄E˅ˈ❦ਾᢺਾ䖞᧘ࡽǄ
⌘᜿˖н↓⺞Ⲵ䬮ᕐ࣋Պ֯ਁࣘ
ᵪ৺ަԆ䜘ս䎵䗷䍏㦧Ǆഐ↔а 䖖䖤㷪⇽
ᇊ㾱‫؍‬ᤱ㿴ᇊԕ޵Ⲵᕐ࣋Ǆ 傡ࣘ䬮ᶑᶮᕋ䈳㢲㷪ṃ
䬱㍗㷪⇽
ᤗ㍗䖤㷪⇽ˈࡉ䬱㍗㷪⇽ԆԜᤷᇊ
Ⲵᢝ⸙Ǆ
ᢝ⸙˖
⢋亯‫ޜ‬ቪ˄‫ޜ‬ቪ‫ޜ‬ᯔˈ㤡ቪǃ⻵ǃ࣋
䬱㍗㷪⇽˖
⢋亯‫ޜ‬ቪ˄‫ޜ‬ቪ‫ޜ‬ᯔˈ㤡ቪǃ⻵ǃ࣋
7-24
Րࣘ䬮Ⲵ␵⨶৺⏖━ ㍒ⲴỰḕ৺⏖━ ⋩䰘᥿᡻৺㍒ⲴỰḕ৺⏖━
Րࣘ䬮享⇿䳄а⇥⢩ᇊⲴᰦ䰤ˈᖃ‫➗׍‬
ᇊᵏ‫ޫ؍‬৺⏖━㺘㻛␵⨶৺⏖━Ǆ㤕н ֯⭘⭥অ䖖ࡽˈ䈧Ựḕ‫ޘ‬䜘᧗ࡦ㍒৺㍒
䘲ᖃⲴ㔤ᣔˈՊ࣐ᘛ⼘ᦏǄሩҾ㓿ᑨ㹼 Ⲵ⣦ߥǄ㤕ᴹᗵ㾱ˈ⏖━㍒઼㍒ቮㄟˈ
֯Ҿቈෳཊ઼▞⒯ⲴൠᯩǄՐࣘ䬮‫ޫ؍‬ 㤕㍒ਇᦏᡆн㜭亪⭵〫ࣘˈ䈧㚄㔌䳵傜
ྲл˖ ૸ԓ⨶୶ỰḕᡆᴤᦒǄ 㢲≄䰘⭥㔶䝽༷ᴹањₑ㜦ⴆǄ⺞‫؍‬ሱ
䆖੺ʽ㍒Ⲵཆ྇ᦏൿਟ㜭Պᒢᢠࡠ㍒Ⲵ 䶒ᆹ㻵⢒പǄণ֯ⴆⲴᆹ㻵ᱟ੖↓⺞ˈ
᫽֌৺䙐ᡀ޵㍒⭏䬸Ǆ䈧ቭᘛᴤᦒᐢᦏ ᆳнᆼ‫؍ޘ‬ᣔ≤⭥㔶ᶑⴞǄഐ↔ˈ֯⭘
⭥অ䖖㻛␵⍇ᡆ൘䴘ཙ㹼傦ਾˈՐࣘ䬮 ൿⲴ㍒ˈԕ䱢→нᆹ‫Ⲵޘ‬ᛵߥਁ⭏Ǆ ᰦ⌘᜿н㾱‫┤᧕ⴤ≤ޕق‬൘ⴆᡆ⭥㔶ᰦ
ᗵ享㻛⏖━Ǆ ˈ␵⍇䖖䖶Ǆྲ᷌⭥㔶ᡆⴆਈ㜿ˈ䈧⭘
ᒢ߰Ⲵ⒯ᐳǄ
␵⌱傡ࣘ䬮ᶑо➔⋩઼ањሿ䖟ࡧǄ ᧘㦀⏖━⋩˖
䬲Ⲳส⏖━㜲
⌘᜿˖Ѫ䱢→ᦏൿ2රസˈнᒢ߰
Ⲵ傡ࣘ䬮ᶑ㫨⊭੨ቈಘˈ儈঻ෛസ
7
ᡆнਸ䘲ⓦࡲǄ
ᬖᤝ傡ࣘ䬮ᶑᒢ⠕Ǆ⌘᜿˖ѪҶ䱢
→ᦏൿ2ᖒസˈ‫ڊ‬н␵⌱Րࣘ䬮㫨
⊭␵⌱ಘˈ儈঻ෛസᡆн䘲ᖃⲴⓦ
ࡲǄ
ᖫᓅ⏖━傡ࣘಘ䬮⢩↺Ⲵ2ර⧟䬮
⏖━ࡲǄ
7-25
Ựḕᒦ⏖━ࡩ䖖઼ᦒᥑ䐿ᶯ ᧘㦀⏖━⋩˖ ⏖━Ⲵࡽ䜘઼ਾ䜘ࡦࣘᶐᵶ
䬲Ⲳส⏖━㜲 ࡦࣘᵶⲴ᷒䖤⛩ᓄ᤹ᇊᵏ㔤‫━⏖؞‬㺘Ⲵ
ࡩ䖖઼ᦒẓⲴ᫽֌䐿ᶯࡽᓄỰḕ⇿⅑
僁㹼ˈԕ৺䐿ᶯ᷒䖤ᓄ䈕ᗵ㾱ᰦ䘋㹼 ⢩ᇊ䰤䳄ᵏ䘋㹼⏖━Ǆ
⏖━Ǆ
ࡦࣘ䐿ᶯ ࡽ
ਾᯩ
〫ࣘ䐿ᶯ
7-26
᧘㦀⏖━⋩˖ Ựḕ৺⏖━ѫᷦḡ৺‫ח‬ᷦḡ ᧘㦀⏖━⋩˖

ࡽࡦࣘᵶ˖ ᴹᵪ⹵⏖━㜲
ϔϔ⹵㜲
ਾ䖞ࡦࣘᵶ˖
ϔϔᴹᵪ⹵⏖━㜲
਺㟲᷒⛩Ⲵ⏖━
਺㟲᷒⛩享⇿䳄а⇥⢩ᇊⲴᰦ䰤ˈ‫➗׍‬
ᇊᵏ‫ޫ؍‬৺⏖━㺘㻛⏖━Ǆ
᧘㦀⏖━⋩˖
ᴹᵪ⹵⏖━㜲
ѫᷦḡ৺‫ח‬ᷦḡⲴ᫽֌ᗵ享൘⇿⅑㹼
7
傦ࡽỰḕˈྲᴹᗵ㾱ˈ᷒䖤⛩઼䠁኎
ሩ䠁኎Ⲵ᧕䀖䶒䴰䘋㹼⏖━Ǆ
ྲ᷌‫ח‬᭟ᷦнࣘҶкл亪࡙ˈᴹ䳵傜
૸㓿䬰୶Ựḕᡆ‫⨶؞‬Ǆ੖ࡉˈ䈕‫ח‬᭟
ᷦਟԕ㚄㌫ൠ䶒઼࠶ᮓ᫽֌ˈᗇࡠ൘
᧗ࡦҶਟ㜭ⲴᦏཡǄ
7-27
ࡽ৹ⲴỰḕ Ựḕ䖜ੁᵪᶴ
ࡽ৹Ⲵ⣦ߥ઼᫽֌ᓄ᤹ᇊᵏ㔤‫━⏖؞‬ ⼘ᦏᡆᶮࣘⲴ䖜ࣘ䖤᢯ਟ㜭Պ䙐ᡀড
㺘Ⲵ⢩ᇊ䰤䳄ᵏ䘋㹼⏖━Ǆ 䲙Ǆഐ↔ˈ⇿䳄а⇥ᇊⲴᰦᵏˈаᇊ
㾱‫➗׍‬ᇊᵏ‫ޫ؍‬৺⏖━㺘䘋㹼Ựḕ䖜
ࡽ৹⣦ߥⲴỰḕ ੁᵪᶴⲴ᫽֌Ǆ
Ựḕ޵㛾ⲴࡂⰅǃᦏൿ઼䗷ཊⲴ┿⋩Ǆ ൘ᕅ᫾л࣐‫ޕ‬ᷦᆀˈ֯ࡽ䖞⿫ൠ
ॷ䎧Ǆ（䈖㓶㿱亥ؑ᚟˅
ࡽ৹᫽֌ⲴỰḕ 䆖੺ʽᓄᢺ⭥অ䖖っപⲴ‫ڌ‬᭮൘
ᢺ⭥অ䖖᭮൘ᒣⲴൠᯩˈᒦᨑⴤ⭥ ᆹ‫Ⲵޘ‬ൠᯩˈ䱢→㘫‫Ⲵق‬ਟ㜭ᙗǄ
অ䖖Ǆ䆖੺˖ѪҶ䚯‫ݽ‬ਇՔˈ⺞‫⌘ ؍‬᜿ ECA10591 [EWA10752]
⭥অ䖖ᆹ‫Ⲵޘ‬᭟᫁ԕ䱢→㘫‫Ⲵق‬ਟ
ྲ᷌ਁ⧠ࡽ৹ᦏൿᡆᰐ⌅亪࡙᫽֌ˈ ˊᣃտࡽ৹Ⲵлㄟԕ৺ቍ䈅ੁࡽਾ
㜭ᙗǄ [EWA10752]
ራ≲䳵傜૸ԓ⨶୶Ựḕᡆ‫⨶؞‬Ǆ 〫ࣘǄ㤕㿹ᗇᴹ⑨䳉ˈ␵ငᢈ䳵
傜૸ԓ⨶୶Ựḕᡆ‫⨶؞‬䖜ੁᵪᶴǄ
᫽֌ࡽࡦࣘᰦˈ⭘࣋ᢺ䖖ᢺᖰл঻
7 ᮠ⅑ԕỰḕࡽ৹ᱟ੖亪࡙঻㕙৺৽
ᕩǄ
7-28
Ựḕ䖖䖞᢯ ⭥⊐ EAU65852
⵬ⶋ˖⭘␵≤ߢ⍇࠶䫏ˈᒦ・
࡫ራ≲५⯇➗亮
⭥⊐սҾᓗսᓅл
‫ᦞ׍‬ᇊᵏ‫ޫ؍‬৺⏖━㺘ˈ⇿䳄а⇥⢩ 㫴⭥⊐Պሩ≒≄ӗ⭏⠶⛨Ǆഐ↔
ᇊⲴᰦᵏаᇊ㾱Ựḕࡽ઼ਾ䖖䖞᢯Ǆ ˈ൘ሱ䰝Ⲵオ䰤䟼‫⭥ݵ‬ᰦˈ䘌⿫
㤕䖞⇲ᡆ䖖䖞ᰐ⌅亪⭵䖜ࣘˈ䈧㚄㔌 ᵜරਧ䝽㖞䰰᧗ᔿ䫵䞨95/$㫴⭥⊐ ⚛㣡ǃ⚛⵬ǃ俉✏ㅹ⢙䍘ᒦᴹ䏣
䳵傜૸ԓ⨶୶Ựḕ䖖䖞᢯Ǆ Ǆн䴰㾱Ựḕ⭥䀓䍘ᡆ࣐‫ޕ‬㫨便≤Ǆ ཏⲴオ≄⍱䙊Ǆ
㫴⭥⊐Ⲵሬ㓯䘎᧕䴰㾱Ựḕˈᴹ䴰㾱 ᡰᴹ㫴⭥⊐ᆈ᭮䘌⿫ᆙㄕǄ
ᰦˈ䬱㍗Ǆ
⌘᜿
EWA10761
࠷यቍ䈅ਆࠪ⭥⊐㓶㜎ᇶሱˈഐѪ
䘉ሶ≨ѵᦏൿ⭥⊐Ǆ
⭥䀓䍘ᱟਜ਼⺛䞨Ⲵᴹ∂઼ড䲙⢙
EWA10761
䍘ˈਟ㜭䙐ᡀ✗ՔǄ䚯‫ݽ‬ԫօⳞ 㫴⭥⊐Ⲵ‫⭥ݵ‬
㛔ǃ⵬ⶋ઼㺓⢙Ⲵ᧕䀖ˈ൘䶐䘁 ᖃ⭥䟿н䏣ᰦˈቭᘛራ≲䳵傜૸ԓ⨶ 7
㫴⭥⊐ᰦᢺ⵬ⶋ㖙кǄྲ᷌᧕䀖 ୶䘋㹼‫⭥ݵ‬Ǆ䈧䇠ᗇᆹ㻵к䘹ᤙᙗⲴ
ࡠˈ᤹л䘠ᙕᮁ༴⨶Ǆ ⭥ᆀ䝽ԦՊ‫׳‬ᡀ㫴⭥⊐⎸㙇Ⲵ∄䖳
ཆ䜘˖⭘བྷ䟿␵≤ߢ⍇ ᘛǄ ECA16522
޵䜘˖օྲབྷ䟿Ⲵ≤ᡆ⢋ྦᒦ㚄 ⌘᜿
㔌५⭏
䰰᧗ᔿ䫵䞨95/$㫴⭥⊐Ⲵ‫⭥ݵ‬䴰㾱
⢩࡛˄ᚂ঻˅Ⲵ‫⭥ݵ‬ಘǄ࡙⭘ᑨ㿴Ⲵ
‫⭥ݵ‬ಘՊᦏൿ㫴⭥⊐Ǆྲ᷌֐⋑ᴹ࣎
⌅᤯ࡠᚂ঻Ⲵ‫⭥ݵ‬ಘˈራ≲䳵傜૸ԓ
⨶୶ᑞ֐Ⲵ㫴⭥⊐䘋㹼‫⭥ݵ‬Ǆ
7-29
ۘ㯿㫴⭥⊐ ᴤᦒ‫؍‬䲙э
EAU66795
ᤷᇊ‫؍‬䲙э˖
ྲ᷌⭥অ䖖䎵䗷ањᴸ⋑⭘ˈ᣶ ѫ‫؍‬䲙э˖
$
䲔⭥⊐ˈ‫ۘˈ⭥┑ݵ‬㯿൘䱤߹ǃ 䇴ՠ‫؍‬䲙э
ᒢ⠕ⲴൠᯩǄ⌘᜿˖᣶䲔㫴⭥⊐ 1 $
3
ˈ❦ਾ㓯࠷ᯝ䍏ᶱ䫵㫴⭥⊐ਾ޽ 2
Ǆ䖜ࣘ䫕ॉࡠĀāˈᒦᢃᔰ⭥䐟
࠷ᯝ↓ᶱ䫵㫴⭥⊐Ǆ ᶕỰḕᱟ੖䇮༷᫽֌Ǆ
ྲ᷌㫴⭥⊐ᆈ᭮䎵䗷єњᴸˈ㠣 Ǆྲ᷌‫؍‬䲙э・ণ޽⅑ᢃࠫˈᴹ䳵
ቁ⇿њᴸỰḕа⅑ˈྲᴹᗵ㾱ˈ 傜૸㓿䬰୶Ựḕ⭥≄㌫㔏Ǆ
‫⭥┑ݵ‬Ǆ ѫ‫؍‬䲙э
ᆹ㻵㫴⭥⊐ࡽᢺ⭥‫┑ݵ‬Ǆ⌘᜿˖ 䇴ՠ‫؍‬䲙э
༷ԭ‫؍‬䲙э
ᆹ㻵ᰦ⭥⊐ˈ⺞‫ޣ؍‬䭞ਈѪ
7 Āāˈ❦ਾ䘎᧕↓ᶱᕅ㓯䘎᧕ ‫؍‬䲙эⴂᱟ᭮൘ᓗᑝлǄ˄䈧৲㘳
ѻࡽ䍏亶‫ݸ‬Ǆ 亥˅Ǆྲ᷌‫؍‬䲙эൿҶ䈧‫➗׍‬ԕ
ᆹ㻵ਾˈ⺞‫؍‬ᡰᴹ䫵㫴⭥⊐о⭥ л↕僔ᴤᦒ˖
⬦᧕䀖㢟ྭǄ ሶ䫕ॉ䖜ੁĀāԕ‫ޣ‬䰝ᡰᴹⲴ
⭥䐟Ǆ
Ǆ᤯ࠪᦏൿⲴ‫؍‬䲙эˈ❦ਾᆹ㻵ᤷ
⌘᜿ ᇊᆹ‫ؽ‬ᯠⲴ‫؍‬䲙эǄ䆖੺˖н㾱
㓿ᑨ‫؍‬ᤱ㫴⭥⊐൘‫Ⲵ⭥ݵ‬⣦ᘱǄۘ ֯⭘∄᧘㦀ᴤ儈ᆹ‫؍Ⲵؽ‬䲙эˈ
ᆈ⋑⭥Ⲵ㫴⭥⊐Պሬ㠤≨ѵᙗ㫴⭥ ഐѪ䘉ṧՊѕ䟽ᦏൿ⭥ᆀ㌫㔏઼
⊐ⲴᦏൿǄ ሬ㠤⵰⚛Ǆ
7-30
བྷ⚟ ᴤᦒ⚟⌑Ⲵ䖵ࣙ ਾ䖜ੁ䇟ਧ৺ቮࡦࣘ⚟
䘉⿽⁑ᔿ䝽༷Ⲵ/('රབྷ⚟Ǆ 䘉⿽⁑ᔿᱟ䝽༷Ҷєњ䖵ࣙ⚟‫ݹ‬Ǆྲ᷌
ྲ᷌བྷ⚟нӞˈᴹ䳵傜૸㓿䬰୶Ựḕަ 䖵ࣙ⚟⌑✗ൿˈᴤᦒྲлǄ
⭥䐟Ǆ
䈕⁑ර䝽༷ᴹањ/('රቮ⚟ࡩ䖖⚟Ǆ
⌘᜿
н㾱䍤൘䖖⚟䘿䮌ԫօ㊫රⲴ⬧⹆䍤ⲴǄ
བྷ⚟⚟⌑
7-31
ᴤᦒ䖜ੁ⚟⚟⌑ ᭟ᤱ᪙ᢈ䖖 ࡽ䖞
᣶л㷪эˈ᣶л䖜ੁ⚟অ‫ݳ‬Ǆ ഐѪ䈕⁑ර⋑ᴹ䝽༷ањѝᗳኅਠˈ
䈧᤹➗лࡇ⌘᜿һ亩৫䲔Ⲵࡽ䜘઼ਾ
䜘ᰦ䖞ᡆᢗ㹼ަᆳ㔤ᣔ㾱≲᪙ᢈ䖖ᥪ ᣶䲔ࡽ䖞
・ǄỰḕ᪙ᢈ䖖ᱟࡽањっᇊⲴ≤ᒣ
䆖੺
WARNI
ս㖞൘ᔰ࿻‫ޫ؍‬ǄаᕪབྷⲴᵘ㇡ਟ᭮
㖞൘ਁࣘᵪ໎࣐っᇊᙗǄ Ѫ䚯‫ݽ‬ਇՔˈᆹ‫ޘ‬ൠ᭟ᤱ䖖䖶ᡰԕ
ᆳ⋑ᴹড䲙㘫‫ق‬Ǆ
ԕᴽ࣑Ҿࡽ䖞
っᇊⲴ᪙ᢈ䖖Ⲵਾ䜘⭘᪙ᢈ䖖᭟ᷦ ᶮᔰࡽ䖞䖤઼ࡦࣘ䫣㷪ṃǄ
1
ᡆ㘵ˈྲ᷌ањ䱴࣐Ⲵ᪙ᢈ䖖・൪
ᱟнਟ⭘ˈ䙊䗷᭮㖞൘ࡽ䶒Ⲵᑗл
ᨂᆄਾ䖞Ǆ
㷪э
7 ᣜ䎧ࡽ䖞⿫ൠ䶒⭘᪙ᢈ䖖ㄉ・Ǆ
䙊䗷৫䲔✗ൿⲴ⚟⌑᧘‫ޕ‬ᒦ䘶ᰦ
䪸᯻䖜Ǆ ԕᴽ࣑Ҿਾ䖞
ሶᯠ⚟⌑ᨂ‫ޕ‬ᨂᓗˈሶަ᧘‫ˈޕ‬ 䙊䗷ᨀ儈ਾ䖞⿫ᔰൠ䶒⭘᪙ᢈ䖖Ⲵ
❦ਾ亪ᰦ䪸᯻䖜ⴤࡠ‫→ڌ‬Ǆ ・൪ˈᡆ㘵ྲ᷌᪙ᢈ䖖・൪ᱟнਟ
ᆹ㻵䮌ཤᆹ㻵䮌ཤᤗǄ⌘᜿˖ ⭘ˈ᭮㖞ॳᯔ亦Ⲵԫа⇿а‫ח‬лᑗ 1
䈧य䗷ᓖᤗ㍗㷪эˈ੖ࡉ䮌ཤਟ ѝⲴਾ䖞Ⲵᡆṩᦞࡽ䈕᯻䖜㟲Ⲵ⇿ 䖖䖤㷪⇽
㜭Պ⹤㻲Ǆ а‫ח‬Ǆ
ሶࡽ䖞ᣜ⿫ൠ䶒ṩᦞ〻ᒿĀ᭟ᤱ᪙
ᢈ䖖āǄ
7-32
ਆл䙏ᓖՐᝏಘሬ㓯䙊䗷᣶л㷪 ᨂ‫ޕ‬䖖䖞ᒦᆹ㻵䖖䖤䖞 ਾ䖞
ṃᶕ‫؍‬ᤱ᭟ᷦǄ վҾൠ䶒кⲴ⚾⯷Ǆ
䙊䗷নлࡦࣘ䖟㇑᭟ᷦনл㷪ṃǄ ᆹ㻵ࡦࣘ䫣ˈᆹ㻵㷪ṃǄ
2 ᨀ⽪ ਆлਾ䖞
1 ൘ሶࡦࣘ䫣ᆹ㻵ࡠࡦࣘⴈкѻࡽˈ
4 ⺞‫ࣘࡦ؍‬㺜ඇѻ䰤ᴹ䏣ཏⲴオ䰤Ǆ 䆖੺
Ѫ䚯‫ݽ‬ਇՔˈ䈧ᆹ‫ޘ‬ൠ᭟᫁䖖䖶ˈ
ԕ‫ݽ‬᪄‫ق‬Ǆ
5
3 নл㝊ෛᶯˈ᣶л㷪ṃǄ
ᆹ㻵ࡦࣘ䫣ˈᆹ㻵㷪ṃǄ
1.制动软管支架
ሶ䖞䖤઼ࡦࣘ䫣㷪ṃᤗ㍗ࡠᤷᇊⲴ
2.螺栓 ᢝ⸙Ǆ
3.制动钳 7
4.制动钳螺栓 ᤗ㍗ᢝ⸙˖
5.轴螺栓䖞䖤˖
᣶лࡦࣘ䫣㷪ṃǄ 40 Nm (4.0 m·kgf, 30 ft·lbf) 2 1
᣹ࠪ䖞䖤ˈਆлሶ䙏ᓖՐᝏಘ᣹ࠪ ࡦࣘ䫣㷪ṃ˖
ᶕˈ❦ਾਆл䖞ᆀǄ⌘᜿˖ᖃ䖞㛾 35 Nm (3.5 m·kgf, 26 ft·lbf)
оࡦࣘⴈ㻛ਆࠪᰦˈн㾱֯⭘ᆳˈ ཊ⅑ੁл᧘ࣘ䖖ᢺˈỰḕ৹ᆀᱟ੖
н❦ࡦࣘ䫣⡷Պ㠚ࣘ‫ޣ‬䰝Ǆ ↓ᑨᐕ֌Ǆ
㝊䐿ᶯ
ᆹ㻵ࡽ䖞㷪ṃ
ሶ䖖䖞ᨀॷࡠ৹㞯ѻ䰤Ǆ ᣶л㷪ṃ઼䖤⧟ˈਆл䬮ᶑⴆǄ
7-33
ᶮᔰ᩶㟲єㄟ䈳㢲䬮ᶑⲴ䬱㍗㷪⇽Ǆ ൘᭟᫁ࡦࣘಘ᭟ᷦⲴ਼ᰦˈ᣹ࣘ䖖
1 ᤹➗˄D˅Ⲵᯩੁ᯻䖜䬮ᶑ㷪ṃᒦੁ 䖞઼ෛസԕ৺䬮ᶑ⢥ᕅಘˈ❦ਾ᣶
ࡽ᧘ࣘ䖖䖞Ǆ л䖖䖞Ǆ
⌘᜿˖䖖䖞оࡦࣘⴈа䎧᣶лਾˈ
䈧य䑙лࡦࣘಘˈ੖ࡉࡦࣘಘሶ㻛
ᕪࡦ‫ޣ‬䰝Ǆ
2
(a)
䬮ⴆ
㷪ṃ
ᶮᔰ䖤㷪⇽
1 2
7 1
䬱㍗㷪⇽
䈳ᮤ䬮ᶑ㷪ṃ
Ӿਾ䖞кਆл䬮ᶑǄ 䖤㷪⇽
1
ᨀ⽪ ᆹ㻵ਾ䖞
2
3 ྲ᷌Րࣘ䬮䳮ԕ᣶নˈ䈧俆‫ݸ‬᣶л Ӿᐖ‫ח‬ᨂ‫ޕ‬䖞䖤ˈᆹ㻵䖖䖞઼ࡦࣘ
䖤㷪⇽ 䖞䖤ˈ❦ਾੁкᨀॷ䖞ˈԕ‫ׯ‬Ӿਾ 䫣᭟ᷦ
ෛസ㷪э 䬮䖞к᣶лՐࣘ䬮Ǆ
᣹䬮ಘ
傡ࣘ䬮н䴰㾱᣶ন᣶নᡆᆹ㻵䖖䖞 ᨀ⽪
ᰦǄ ⺞‫ࣘࡦ؍‬䫣᭟ᷦкⲴᨂ‭䘲䝽൘
᤹➗ㅜ亥кⲴ↕僔ሶਾ䖞ᨀ⿫
᩷㟲кⲴപᇊಘкǄ
ൠ䶒Ǆ
⭘ෛസ˄⧟˅઼᣹䬮ಘ᣶л䖤䖞Ǆ
7-34
൘ᆹ㻵䖖䖞ѻࡽˈ⺞‫ࡩ؍‬䖖⡷ѻ ᤗ㍗ᢝ⸙˖
ᧂ䲔᭵䳌
䰤ᴹ䏣ཏⲴオ䰤Ǆ 䖤㷪⇽˖ 㲭❦䟾傜૸⭥অ䖖㓿䗷ࠪলࡽⲴᖫᓅỰ
1gP˄NJIgPˈOEgIW˅ ḕˈնᱟ൘᫽֌ᰦ䰞仈ਟ㜭Պਁ⭏Ǆ
䬱㍗㷪⇽˖ ֻྲԫօ䰞仈ਁ⭏൘⟳⋩ǃ঻㕙ᡆ㘵
1gP˄NJIgPˈOEgIW˅ ⛩⚛㌫㔏ˈ䜭ਟ㜭䙐ᡀᰐ࣋䎧઼ࣘཡ৫
ࣘ࣋Ǆԕлᧂ䲔᭵䳌㺘ˈᱟ᧿䘠ањᘛ
⭘㷪ṃ઼䖤⧟ᆹ㻵䬮ⴆǄ 㘼ㆰঅⲴ〻ᒿǄ䇙ᛘ㠚ᐡỰḕ䛓Ӌ䟽㾱
ᆹ㻵㷪ṃᆹ㻵㝊䐿ᶯǄ Ⲵ㌫㔏Ǆᰐ䇪ྲօˈ㤕ᛘⲴ⭥অ䖖䴰㾱
ԫօ‫ˈ⨶؞‬䈧䘱㠣䟾傜૸ԓ⨶༴ˈ⟏㓳
ⲴᢰᵟӪઈᤕᴹᡰ䴰Ⲵᐕާǃ㓿傼৺⸕
䚃ྲօ༴⨶ྭᛘⲴ⭥অ䖖Ǆ
䈧ਚ֯⭘䟾傜૸৏㻵䝽ԦǄԯࡦ૱ⴻᶕ
2 1
‫ۿ‬䟾傜૸Ⲵӗ૱ˈնᱟᆳԜⲴ૱䍘㋇㌉
ˈᴹ䖳⸝Ⲵ֯⭘ሯભ઼ਟ㜭ሬ㠤ᴤ䍥Ⲵ
ຎᆀ
ᨂ‭
㔤‫؞‬䍩Ǆ 7
ሶՐࣘ䬮ᆹ㻵ࡠਾ䬮䖞кǄ
ᆹ㻵᣹䬮ಘ઼䬱㍗㷪⇽઼ෛസ
˄⧟˅ˈ❦ਾ䈳ᮤ䬮ᶑǄ˄䈧৲
䰵ㅜ亥˅
᭮лਾ䖞֯ަ㩭൘ൠ䶒кˈ❦ਾ
ሶ‫ח‬᭟ᷦ᭮лǄ
ᤗ㍗䖤㷪⇽ˈ❦ਾሶࡦࣘ䫣᭟ᷦ
㷪ṃᤗ㍗ࡠᤷᇊⲴᢝ⸙Ǆ
7-35
ᖃỰḕ⟳⋩㌫㔏ᰦˈ䈧н㾱ᣭ✏ˈ઼⺞
‫؍‬н㾱ᴹ‫ޜ‬ᔰ⟳✗ᡆᴹ⚛㣡ⲴൠᯩỰḕ
䘉वᤜ✝≤ಘⲴᤷ⽪⚟ᡆ⚹Ǆ
⊭⋩ᡆ⊭⋩㫨≄ਟԕ㻛⛩⟳ᡆ⠶⛨ˈሶ
ሬ㠤ѕ䟽ⲴਇՔᡆ䍒⢙ⲴᦏཡǄ
7-36
ᧂ䲔᭵䳌㺘
䎧ࣘ䰞仈ᡆᕅ᫾㺘⧠нྭ
Ǆ⟳ᯉ
ᴹ䏣ཏⲴ⟳⋩Ǆ Ựḕ঻㕙Ǆ
Ựḕᴹ㇡޵
⟳⋩Ⲵ⏢սǄ ᕅ᫾н㜭ਁࣘǄ
⋑ᴹ⟳⋩Ǆ ໎࣐⟳⋩Ǆ
Ựḕ⭥⊐Ǆ
㫴⭥⊐
ᕅ᫾ᘛ䙏䖜ࣘǄ 㫴⭥⊐⣦ߥ㢟ྭǄ
ᕅ᫾н㜭ਁࣘǄ
᫽֌䎧ࣘ⭥ࡦǄ Ựḕ⛩⚛Ǆ
ᕅ᫾ធ䙏䖜ࣘǄ Ựḕ⭥⬦㓯Ⲵ䘎᧕ˈᒦᴹ
䳵傜૸㓿䬰୶䍏䍓⭥⊐ྲ
᷌ᗵ㾱ⲴǄ 7
⛩⚛⭥䰘 ⭘ᒢᐳᬖᒢ઼䈳ᮤ⚛㣡ຎ䳉ᡆ
⒯ⲴǄ ᫽֌⭥䎧ࣘǄ
᣶䲔⚛㣡ຎ ᴤᦒ⚛㣡ຎǄ
઼Ựḕ⭥ᶱǄ
ᒢⲴǄ 䈧≲䟾傜૸ԓ⨶୶Ựḕ⭥অ䖖Ǆ ᕅ᫾н㜭䎧ࣘǄ
Ựḕ঻㕙Ǆ
঻㕙
ᴹ঻㕙Ǆ ਁࣘᵪн੟ࣘǄᴹ䳵
傜૸㓿䬰୶Ựḕ䖖䖶Ǆ
᫽֌⭥䎧ࣘǄ
⋑ᴹ঻㕙Ǆ 䈧≲䟾傜૸ԓ⨶୶
Ựḕ⭥অ䖖Ǆ
7-37
ᕅ᫾䗷✝
Ь൘ᕅ᫾઼ᮓ✝ಘ⑙ᓖ儈ᰦˈयሶᮓ✝ಘᢃᔰǄ┊✛Ⲵ✝⏢઼㫨≄൘儈঻лਟ㜭௧ࠪˈ䘉Պ䙐ᡀѕ䟽ⲴՔᇣǄ䈧⺞
‫؍‬ㅹࡠᕅ᫾ᐢߧতҶǄ
Ь᣶䲔ߧতࡲⴆ᢯ಘ㷪䪹ˈᢺа⡷⹤ᐳྲ∋ᐮˈⴆ൘ᮓ✝ಘкˈ❦ਾធធⲴ৽ᰦ䫏ᯩੁ᯻䖜ԕ䟺࢙᭮лⲴ≄঻Ǆ౦
౦༠‫→ڌ‬ਾˈ䈧ੁ䘶ᰦ䪸ᯩੁ᯻䖜ˈ਼ᰦ䈧ᆹ⵰ⴆˈ❦ਾ᡽ᢃᔰⴆǄ
䈧ࡠ䟾傜૸ԓ⨶୶ᐢᔪḕ઼
ᴹ┿ᦏǄ ‫؞‬㺕ߧত㌫㔏Ǆ
ߧতࡲ⏢սվ
Ựḕߧতࡲ㌫
7 㔏ᱟ┿ᦏǄ ⋑┿ᦏǄ ␫࣐ߧতࡲ˄䈧৲䰵ᨀ⽪˅Ǆ
ㅹࡠᕅ᫾ Ựḕߧতࡲ‭઼ᮓ✝
ߧতлᶕ ಘⲴߧতࡲ⏢սǄ
ߧতࡲ⏢ս↓ ᔰ੟ᕅ᫾Ǆྲᕅ᫾޽⅑䗷✝ˈ䈧ࡠ䟾傜૸ԓ⨶
⺞Ǆ ୶Ựḕ઼‫؞‬㺕ߧত㌫㔏
ᨀ⽪
⭘㠚ᶕ≤Ჲᰦԓᴯߧতࡲˈ੖ࡉ䈧ቭᘛᦒഎ᧘㦀ⲴߧতࡲǄ
7-38
⭥অ䖖Ⲵ➗亮઼ۘ㯿
EAU37834 EAU26015 ␵⌱
⼘⸲仌㢢䴰᝾䟽 ➗亮 ECA10773
ECA15193 ᔰ᭮ᔿⲴ⭥অ䖖䇮䇑ኅ⧠Ҷ、ᢰⲴ੨ᕅ ⌘᜿
⌘᜿ ࣋ˈնԆҏኅ䵢Ҷᖸཊᕡ⛩Ǆ㲭❦ᕅ⭘
Ҷ儈૱䍘Ⲵ㓴Ԧն⭏䬸઼㞀㲰䘈ᱟՊਁ Ь䚯‫⭘֯ݽ‬ᕪ⛸Ⲵ䞨ᙗ䖖䖞␵⌱⏢Ǆ
ᴹӋරਧᐢ䝽༷Ҷ⼘⸲㢢Ⲵᡀ૱Ǆ␵ ⭏Ǆаਚ⭏䬸Ⲵᧂ≄㇑൘а䖶䖖䟼ᱟн ྲ᷌↔㊫ӗ૱ᗵ享㾱֯⭘ԕ৫䲔亭
⍇᪙ᢈ䖖ѻࡽ䈧࣑ᗵ૘䈒䳵傜૸㓿䬰 ᱃㻛ਁ⧠նᆳতՊ䍜վҶа䖶⭥অ䖖ᮤ പⲴ⊑⢙ˈ䈧य䇙␵⌱ࡲ⮉൘ਇᖡ
୶‫ޣ‬Ҿ␵⍇ӗ૱Ǆ֯⭘ࡧᆀǃ㤋࡫Ⲵ փⲴ㖾㿲Ǆ㓿ᑨᖫᓅ␵⌱ᛘⲴ⭥অ䖖ˈ ૽Ⲵൠᯩ䎵䗷ᡰᤷᇊⲴᰦ䰤Ǆ䲔↔
ॆᆖ૱ᡆ␵⌱ࡲᶕ␵⍇䘉Ӌ䜘սሶՊ нӵՊ࣐ᕪཆ㿲ˈᴤ㜭᭩㓿ᆳⲴᙗ㜭ˈ ѻཆˈᖫᓅⲴߢ⍇ˈਇᖡ૽Ⲵൠᯩˈ
ࡂՔᡆᦏൿަ㺘䶒Ǆ㵑ҏнᓄ䘲⭘Ҿ ⭊㠣ᔦ䮯䴦ԦⲴ֯⭘ሯભǄ ᔴᒢਾˈ❦ਾ௧к䱢䬸௧䴮ࡲǄ
ԫօ⼘⸲ᡀ૱Ǆ ЬнᖃⲴ␵⨶Պ䙐ᡀᥑ仾ᣔ㖙ˈ㖙⡷ˈ
␵⍇ࡽ ፼ᶯ઼ަԆກ㜦䜘࠶ⲴᦏൿǄਚ⭘
ᖃᕅ᫾ߧতਾˈ⭘ກ㜦㺻ሶᧂ≄㇑ ᶮ䖟ˈᒢ߰Ⲵᐳᡆ⎧㔥ˈ⑙઼Ⲵ␵
ⴆྭǄ ⌱ࡲ઼␵≤ᶕ␵⍇ກ㜦䜘࠶Ǆ
⺞‫؍‬ᡰᴹⲴⴆ઼㖙वᤜᡰᴹⲴ⭥ᆀ
ᨂཤ઼䘎᧕ಘˈवᤜ⚛㣡ຎⴆ䜭㻛
䬱㍗Ǆ
㾱ਆࠪ䶎ᑨ亭പⲴ⋩⊑ˈ䈧֯⭘ࡧ
8
ᆀ઼৫⋩ࡲˈնᱟн㾱֯⭘਼ṧⲴ
ᯩ⌅൘ᇶሱෛǄෛ⡷ˈ䬮䖞喯ˈ䖜
ࣘ䬮઼䖞䖤кǄ䈧⭘␵≤ᶕߢ⍇⊑
⢙઼⋩䘩Ǆ
8-1
Ь䈧यᢺԫօ㋇㌉Ⲵॆᆖӗ૱⭘൘ກ Პ䙊֯⭘ਾ˖ ௧ሴ䱢㞀㲰ࡲ൘‫ޘ‬䜘Ⲵ䠁኎૱к
㜦䜘࠶кǄ⺞‫؍‬䚯‫᧕⭘֯ݽ‬䀖䗷ᕪ ֯⭘⑙≤ˈ⑙઼Ⲵ␵⌱ࡲˈ઼Ḅ䖟Ⲵ⎧ ˄वᤜҶ䬜઼䭽Ⲵ⭥䭰˅ԕ䱢⋫㞀
⛸ᡆ㞀㲰ᙗⲴ␵⌱ࡲˈ⟄ࡲˈ⟳ᯉ 㔥ԕ৫䲔⊑⢙Ǆ❦ਾᱟ⭘␵≤ᖫᓅⲴߢ 㲰Ⲵਁ⭏Ǆ
ˈ৫䬸ࡲˈࡦࣘ⏢઼⭥䀓≤Ⲵᐳᡆ ⍇ᒢ߰Ǆ֯⭘⢉ࡧᡆࡧᆀᶕ⍇ࡧ䛓Ӌ䳮
⎧㔥Ǆ ԕ䗮ࡠⲴൠᯩǄ␵⍇ࡽˈྲ᷌㾶ⴆаᶑ ␵⍇ਾ
Ь䗷儈Ⲵ≤঻Պ֯≤Ӿ≤㇑ⓒࠪˈԕ ᮷∋ᐮ൘ଚњൠᯩࠐ࠶䫏ˈ亭പⲴ⊑⢙ ֯⭘䖟Ⲵỹᐳᢺ⭥অ䖖ᣩᒢǄ
৺㠣ᦏൿᇶሱෛ˄䖖䖞ˈ਺㟲䖤᢯ ઼ᰶ㲛Պ∄䖳ᇩ᱃㻛৫䲔Ǆ ・ণᬖᒢՐࣘ䬮઼⏖━ˈԕ䱢→
ˈ৹઼ࡦࣘಘˈ⭥ಘ䜘࠶˄䘎᧕ಘ ᆳӾ⭏䬸Ǆ
ˈᨂཤˈ⭥䰨઼⚟˅ˈᧂ≄㇑઼䙊 ൘䴘ཙˈ⋯⎧ൠ४ᡆ௧Ҷⴀ≤Ⲵ䚃䐟傮・࡫ᢺ䖜ࣘ䬮ᔴᒢҶ❦ਾᢺᆳ⏖
仾ᆄ˅ 傦ਾ ━ԕ䱢⋫⭏䬸Ǆ
⭡Ҿ⎧ⴀ㞀㲰ᙗᶱᕪᔰኅਾˈԕл⇿њ ֯⭘䬜ᢃ㵑ࡲԕᬖӞᓖ䬜Ⲵ㺘䶒ˈ
Ьྲ⭥অ䖖㻵༷ᥑ仾ቿ˖н㾱֯⭘ᕪ ↕僔僁൘䴘ѝᡆ䱴䘁⎧ฏǄ ҏवᤜҶᧂ≄㌫㔏Ǆ˄⭊㠣䗷✝
⛸Ⲵ␵⌱ࡲᡆ䗷⺜Ⲵ⎧㔥ˈഐѪՊ ᕅ᫾ߧতਾˈᱟ⭘ߧ≤઼⑙઼Ⲵ␵ 䙐ᡀⲴ㞯㢢ҏਟԕ䟽ᯠᬖӞ˅Ǆ
ሬ㠤㢢䈳᳇␑ᡆ࡞㣡ǄаӋກᯉ␵ ⌱ࡲ␵⍇ᛘⲴ⭥অ䖖Ǆ⌘᜿˖यᕅ
⌱ࡲॆਸ⢙Պ֯ᥑ仾ቿ⮉л࡞ⰅǄ ⭘⑙≤ഐѪᆳՊࣙ䮯㞀㲰ⲴᛵߥǄ
൘ᥑ仾ቿⲴаሿ᳇༴⍻䈅ӗ૱ˈ⺞
‫؍‬བྷнՊ⮉лԫօ࡞ⰅǄྲ᷌ᥑ仾
8 ቿ㻛࡞㣡ˈ⍇⏔ਾˈ֯⭘䍘䟿ྭⲴ
ກᯉॆਸ⢙ᶕᬖӞǄ
8-2
ᔪ䇞֯⭘䱢䬸ࡲ൘ԫօ䠁኎䜘ԭ ۘᆈ
वᤜᓖ䬜઼䭰䭽Ⲵ䜘࠶ԕ䱢⭏䬸Ǆ z䈧यᢺ⋩ᡆ㝺֯⭘൘ກ㜦ࡦ૱ᡆₑ
֯⭘⋩௧ࡲˈањ䙊⭘Ⲵ␵⌱ࡲ 㜦ࡦ૱кˈ䈧֯⭘䘲ᖃⲴ‫ޫ؍‬ӗ૱Ǆ
৫䲔࢙։Ⲵ⊑ිǄ z䚯‫⼘⭘֯ݽ‬㲰ᙗ䍘Ⲵᢃ㵑ӗ૱ᶕ⩒ ⸝ᵏ
⼘ഐѪᆳՊ䙐ᡀ┶䶒Ⲵ⼘ᦏǄ ␵ۘᆈᛘⲴ⭥অ䖖൘ањ䱤߹઼ᒢ⠕Ⲵ
‫؞‬㺕⸣ཤ䙐ᡀⲴ䖫ᗞ⋩≄ⲴᦏൿǄ ൠᯩǄྲ䴰㾱ˈ֯⭘ᴹᆄⲴⴆԕ䚞ⴆ⭥
ሶᡰᴹ⎲┶Ⲵ㺘䶒кᢃ㝺Ǆ অ䖖ԕ䱢ቈෳǄ
ECA10811
ᨀ⽪
⌘᜿
ƽ䈧ᮉ‫ޣ‬ҾӰѸṧⲴӗ૱֯⭘Ⲵ᜿㿱
ሩࡩ䖖઼䖞㛾⊑ḃ⢙ਟ㜭Պሬ㠤ཡ᧗Ǆ 䳵傜૸ԓ⨶୶Ǆ Ьሶ⭥অ䖖ۘ㯿൘ањオ≄н⍱䙊ᡆ㾶
ƽ⍇⏔ˈ䴘ཙᡆ▞⒯Ⲵ≄‫ى‬ਟ㜭Պሬ ⴆ⵰ᐶᐳՊ䙐ᡀ⒯≄❦ਾ⭏䬸Ǆ
z⺞‫⋑؍‬ᴹ⋩ᡆ㝺൘ࡦࣘಘᡆ䖞㛾к
㠤བྷ⚟䮌ཤ䴮Ǆ൘䈸ࡠањᖸ⸝Ⲵ Ь䚯‫ۘݽ‬ᆈ൘▞⒯Ⲵൠテǃ傜ᡯ˄ഐѪ
Ǆ
ᰦ䰤޵ቡ൘བྷ⚟ሶᴹࣙҾ⎸䲔Ӿ䮌䱯᪙ቬӊⲴᆈ൘˅઼ۘᴹᕪ⛸ॆᆖ㦟
zྲ䴰㾱ˈ֯⭘Პ䙊Ⲵࡦࣘⴈ␵⌱ࡲ
ཤⲴ≤࠶Ǆ ⢙ⲴൠᯩǄ
ᡆщ䞞ᶕ␵⍇ࡦࣘⴈ઼ࡦࣘ㺜ෛǄ
֯⭘⑙≤઼⑙઼Ⲵ␵⌱ࡲᶕ␵⍇䖞
㛾Ǆ⭥অ䖖᫽֌ࡽˈỰḕࡦࣘಘⲴ 䮯ᵏ
᫽֌઼аӋ⢩࡛ⲴᛵߥǄ ൘ᛘᢃ㇇ሶ⭥অ䖖ۘᆈࠐњᴸԕࡽ˖ 8
䈧‫➗׍‬䘉аㄐˈĀ␵⍇ā䜘ԭⲴᡰᴹ
⌘᜿ ᤷ⽪Ǆ
z⺞‫؍‬ᣩᒢԫօཊ։Ⲵ⋩઼㝺Ǆ
8-3
ᢺ⟳⋩㇡㻵┑ˈ❦ਾ࣐‫⋩⟳ޕ‬っᇊࡲԕ ⏖━ᡰᴹᶐᵶǃ䐿ᶯԕ৺‫ח‬ѫᷦ
䱢⋫⋩㇡⭏䬸઼⟳⋩Ⲵਈ䍘Ǆ ḡⲴ᧗ࡦ㍒઼᷒⛩Ǆ
䟷ਆԕлⲴ↕僔ԕ䱢→䖟㇑ǃ⍫ຎസㅹ Ựḕ઼‫ޕ‬䴰㾱ˈ䈳ᮤ䖞㛾Ⲵ≄঻ˈ
⭏䬸Ǆ ❦ਾሶ䖖ᷦॷ儈ԕ֯ৼ䖞᫔⿫ൠ
D᣶䲔⚛㣡ຎⴆ઼⚛㣡ຎǄ 䶒Ǆ⇿њᴸˈ᯻䖜䖖䖞ԕ䱢→䖖
Eᢺа⊔ॉⲴᕅ᫾⋩‫ق‬䘋⚛㣡ᆄ䟼Ǆ 䖞Ḁњ䜘սⲴᦏൿǄ
Fᢺ⚛㣡ຎⴆᆹ㻵൘⚛㣡ຎ䟼ˈ❦ਾ ሶᧂ≄㇑ࠪਓ༴⭘ກ㜦㺻᡾㔁ԕ
᭮൘䖟㇑ཀྵкԕ⺞‫⭥؍‬ᶱ᧕ൠǄ˄ 䱢≤䘋‫ޕ‬Ǆ
䘉Պ߿ቁ⚛㣡Ⲵਁ⭏˅Ǆ ᣶䲔⭥⊐৺‫ۘˈ⭥ݵ‬ᆈ൘ањ䱤
G֯⭘䎧ࣘಘᢺᕅ᫾オ䖜ࠐ⅑Ǆ˄䘉 ߹઼ᒢ⠕Ⲵൠᯩ઼⇿њᴸ‫⭥ݵ‬а
ᱟ䖟㇑້⋮┑ᵪ⋩˅ ⅑Ǆн㾱ሶ⭥⊐ۘᆈ൘ཚ✝ᡆཚ
䆖੺Ѫ䚯‫⚛ݽ‬㣡䙐ᡀⲴᦏᇣᡆՔ ߧⲴൠᯩቁ䗷Ϩ&Ϩ&ᡆ䎵䗷
ᇣˈ⺞‫؍‬᯻䖜ᕅ᫾ᰦˈ⚛㣡ຎⲴ Ϩ&Ϩ)Ǆᴹ‫ޣ‬ᴤ䈖㓶Ⲵ⭥⊐
⭥ᶱ᧕ൠǄ ۘᆈᯩ⌅ˈ䈧৲䰵亥Ǆ
ᨀ⽪
_
൘ᵚۘᆈ⭥অ䖖ѻࡽˈྲ䴰㾱䈧֌䘲ᖃ
Ⲵ㔤‫؞‬Ǆ
8 _
8-4
㿴Ṭ
ཆᖒቪᓖ˖ 䎧ࣘ㌫㔏˖ ⟳⋩௧ሴ˖
‫ޘ‬䮯˖ ⭥ࣘᔿ䎧ࣘಘ઼䒜ᔿǄ ϔ㢲≄䰘փ˖
∛㊣ረ ⏖━㌫㔏˖ ϔϔ,'ḷ䇠˖
‫ޘ‬ᇭ˖ ᵪ⋩㇡ ϔϔϔ%.
∛㊣˄ረ˅ ᵪ⋩˖ ⚛㣡ຎ˖
‫ޘ‬儈˖ ᧘㦀૱⡼˖ ࡦ䙐୶ᡆ⁑ර˖
<$0$/8%( 1*.05(
∛㊣˄ረ˅ ㊫ර˖ ⚛㣡ຎオ䳉˖
ᓗᑝ儈˖ : ∛㊣ረ
∛㊣˄ረ˅ 㻛᧘㦀Ⲵᕅ᫾⏖━⋩ㅹ㓗˖ ⿫ਸಘ˖
䖤⸙˖ $3,6(59,&(6*㊫රᡆ㘵ᴤ儈 ⿫ਸಘ㊫ර˖
∛㊣˄ረ˅ ᵪ⋩䟿˖ ⒯ˈཊ⡷
⿫ൠ䐍⿫˖ ᕅ᫾⏖━⋩ᇩ䟿˖ ਈ䙏ಘ˖
∛㊣˄ረ˅ ‫ॷޜ‬㖾ഭཨ㝡 ѫ㾱߿䙏∄⦷˖
ᴰሿ䖜ᕟॺᖴ˖ ᑍഭཨ㝡
㊣˄㤡ቪ˅ ᴤᦒᵪ⋩└㣟˖ ᴰ㓸Րࣘ˖
䟽䟿˖ ϔϔ‫˄ॷޜ‬㖾ഭཨ㝡
ᑍഭཨ㝡䬮
ᮤ༷䍘䟿˖ ⅑㾱߿䙏∄˖
ਈ䙏ಘ⋩
‫ޜ‬ᯔ䮁 ਈ䙏ಘ⋩ᇩ䟿˄ᴰབྷⲴ
ᕅ᫾˖ ᴰ儈ㅹ㓗ḷᘇ˅˖ Րࣘᯩᔿ˖
⟳✗ᗚ⧟˖ ‫˄ॷޜ‬㖾ഭཨ㝡 ᑨஞਸ䙏
ϔϔߢ〻 ᑍഭཨ㝡˅ 喯䖞∄˖
ߧত㌫㔏˖ ᮓ✝ಘ㜭࣋˄वᤜᡰᴹ䐟⭡˅˖ ㅜа˖
ϔϔ仾ߧ ‫˄ॷޜ‬㖾ഭཨ㝡ˈ ˄˅
≄䰘ᵪᶴ˖ オ≄└␵ಘ˖
62+& ㅜҼ˖ 9
オ≄└␵ಘ‫ݳ‬㍐˖
≄㕨ᮠ˖ ⒯ᙗ└㣟 ˄˅
অ㕨 ⟳⋩˖ ㅜй˖
ᧂ≄䟿˖ 㻛᧘㦀Ⲵ⟳⋩˖ ˄˅
・ᯩৈ㊣ ᰐ䫵⊭⋩ᡆ҉䞷⊭⋩ ㅜഋ˖
ᖴhߢ〻˖ ⟳⋩㇡ᇩ䟿˖ ˄˅
h∛㊣[ረ ‫ॷޜ‬ǂ㖾ഭ࣐ԁ ㅜӄ˖
ᑍഭཨ㝡
঻㕙∄˖ ⟳ᯉ༷ۘ䟿˖ ˄˅
˖ ‫ॷޜ‬ǂ㖾ഭ࣐ԁ ㅜ‫˖ޝ‬
ᑍഭཨ㝡 ˄˅
9-1
㿴Ṭ
Ӫ˖ ਾᛜᤲ˖
ᵪ༣˖ 䶒ࡽ˖
Ṷᷦ㊫ර˖ ㊫ර˖
N3D˄NJIFPˈSVL˅ অս᩶ࣘ
僘ᒢ ਾ˖
㝊䖞䀂ᓖ˖ ᕩ㉗˖
N3D˄NJIFPˈSVL˅ 㓯സᕩ㉗
e 䖞ᆀ㊫ර˖
㩭ਾ˖ ߿䴷ಘ˖
䬨䖞 ⏢঻䱫ቬಘ
PP˄LQ 䖞䖻䖖䖞㹼〻˖
ࡽ䖞㛾˖ ቪረ˖ PP˄LQ˅
㊫ර˖ 0&h07 ⭥ᆀ㌫㔏˖
ᰐ޵㛾 ਾ䖞˖ ㌫㔏⭥঻˖
ቪረ˖ 䖞ᆀ㊫ර˖ 9
0&3 䬨䖞 ⛩⚛㌫㔏˖
ࡦ䙐୶රਧ˖ 䖞䖻 7&,
,5&5;) ቪረ˖ ‫⭥ݵ‬㌫㔏˖
ਾ䖞㛾˖ 0&h07 $&⻱
㊫ර˖ ࡽࡦࣘ˖ ⭥⊐˖
ᰐ޵㛾㊫ර˖ ⁑ර˖
ቪረ˖ ⏢঻অⴈࡦࣘಘ *7=9
0&6 ᤷᇊࡦࣘ⏢˖ ⭥঻ˈᇩ䟿˖
ࡦ䙐୶රਧ˖ '27ᡆ 9ˈ$K˄+5˅
,5&5;5 ਾࡦࣘ˖ ⁑ර˖
ᴰབྷ䍏䖭˖ ㊫ර˖ <7=9
⏢঻অⴈࡦࣘಘ ⭥঻ˈᇩ䟿˖
9 NJ˄OE˅ ᤷᇊࡦࣘ⏢˖
˄䖖᡻ˈ҈ᇒˈ䍗⢙Ⲵᙫ䟽䟿 9ˈ$K˄+5˅
'27ᡆ ⚟⌑࣏⦷˖
઼䝽Ԧ˅ ࡽᛜᤲ˖
䖞㛾≄঻˄൘ߧⲴᰦ‫⍻ى‬䟿 བྷ⚟˖
㊫ර˖ /('
䖞㛾˅˖ ը㕙৹
Ӫ˖ ࡩ䖖ቮ⚟˖
ᕩ㉗˖ /('
䶒ࡽ˖ 㓯സᕩ㉗ ࡽ䖜ੁؑਧ⚟˖
N3D˄NJIFPSVL˅ ߿䴷ಘ˖ :
ਾ˖ ⏢঻䱫ቬಘ ਾ䖜ੁؑਧ⚟˖
N3D˄NJIFPSVL˅ 䖖䖞㹼〻˖ :
PP˄LQ˅
9-2
㿴Ṭ
䖵ࣙ⚟˖
/('
䖖⡼⚟˖
:
Ԛ㺘➗᰾˖
/('
䘌‫ݹ‬ᤷ⽪⚟˖
/('
䖜ੁ⚟ᤷ⽪⚟˖
/('
ߧত⏢⑙ᓖ䆖⽪⚟˖
/('
ਁࣘᵪ᭵䳌䆖੺⚟˖
/('
〫սᤷ⽪⚟˖
/('
‫؍‬䲙э˖
ѫ‫؍‬䲙э˖
$
㓸ㄟ‫؍‬䲙э˖
$
9-3
亮ᇒ䍴䇟
䢤ᇊਧ⸱ 䬱ॉ䢤ᇊਧ⸱ රਧḷㆮ
䈧ᢺ䬱ॉ䢤ᇊਧ⸱ˈ⭥অ䖖䢤ᇊਧ⸱о
ᕅ᫾Ⲵᒿਧ䇠ᖅ൘ᡰ༷ⲴオṬ䟼ԕᯩ‫ׯ‬
䟾傜૸ԓ⨶୶䇒䍝䴦Ԧԕ৺ˈза⭥অ
䖖㻛‫ڧ‬コᰦਟԕ৲㘳Ǆ
⭥অ䖖䢤ᇊਧ⸱ 1 1
⭥অ䖖䢤ᇊਧ⸱ ਁࣘᵪᒿࡇਧ˖
䖖䖶䇶࡛ਧ⸱ᱟঠ൘ᓗἵлⲴṶᷦǄ
ਁࣘᵪⲴᒿࡇਧᱟߢ঻䘋‫ޕ‬ᴢ䖤㇡Ǆ
发动机序列号：
ᨀ⽪
䖖䖶䇶࡛ਧ⸱ᱟ⭘ᶕ䇶࡛ᛘⲴ᪙ᢈ䖖ˈ
ਟ⭘Ҿ⌘޼ᛘⲴ᪙ᢈ䖖ਁ⡼ᖃተ൘४
ฏǄ
10
10-1
亮ᇒ䍴䇟
䖖䖶ᮠᦞ䇠ᖅ
䈕⁑රⲴ(&8ᆈۘḀӋ䖖䖶ᮠᦞˈԕᑞ
ࣙ䇺ᯝ᭵䳌ᒦ⭘Ҿ⹄ウ઼ᔰਁⴞⲴǄ
ਚᴹ൘䖖䖶䘎᧕Ҷу⭘Ⲵ<DPDKD䇺ᯝ
ᐕާ˄ֻྲᢗ㹼㔤ᣔỰḕᡆ㔤‫؞‬〻ᒿ˅
ᰦ᡽ՊкՐ↔ᮠᦞǄ
ቭ㇑Րᝏಘ઼䇠ᖅⲴᮠᦞՊഐරਧ㘼
ᔲˈնѫ㾱Ⲵᮠᦞ⛩ᱟ˖
Ь䖖䖶⣦ᘱ઼ਁࣘᵪᙗ㜭ᮠᦞ
Ь⟳⋩௧ሴ઼ᧂ᭮⴨‫ޣ‬ᮠᦞ
䳵傜૸нՊੁㅜйᯩ䘿䵢䘉Ӌᮠᦞˈ
䲔䶎˖
Ьᖱᗇ䖖ѫⲴ਼᜿
Ь⌅ᖻѹ࣑
Ь‫<׋‬DPDKD൘䇹䇬ѝ֯⭘
10
10-2

B2S R15 Full PDF

Încărcat de

Informații document

Titlu original

Drepturi de autor

Formate disponibile

Partajați acest document

Partajați sau inserați document

Opțiuni de partajare

Vi se pare util acest document?

Este necorespunzător acest conținut?

Drepturi de autor:

Formate disponibile

B2S R15 Full PDF

Încărcat de

Drepturi de autor:

Formate disponibile

3FBEUIJTNBOVBMDBSFGVMMZCFGPSFPQFSBUJOHUIJTWFIJDMF

Welcome to the Yamaha world of motorcycling!

Particularly important information is distinguished in this manual by the following notations:

A WARNING indicates a hazardous situation which, if not avoided, could result in

TIP A TIP provides key information to make procedures easier or clearer.

*Product and specifications are subject to change without notice.

Motorcycle care and storage ..........8-1

Consumer information ...................10-1

LOAD LIMIT 225, 33 220, 36

Always select an approved motorcy-

1. Headlight (page 7-31) 9. Shift pedal (page 4-13)

Controls and instruments

1. Clutch lever (page 4-12)

Insert the keyhole shutter key into the

Indicator lights and warning High beam indicator light “ ” TIP

1 1. VVA (variable valve actuation) indicator

This model is equipped with variable 1. Tachometer

and then return to the current amount

To install the fuel tank cap

cap is not properly installed and WARNING

these instructions. 1. Fuel tank filler tube

filling when the fuel reaches the WARNING

wash with soap and water. If gaso- Catalytic converter NOTICE

WARNING pairable damage to the catalytic

2. While holding the key in the posi-

Sidestand Starting circuit cut-off system

With the engine turned off: WARNING

t Check fuel level in fuel tank.

Starting the engine

the start switch, wait a few sec- Shifting NOTICE

0–1000 km (0–600 mi)

1000–1600 km (600–1000 mi)

Comparison of wear on engine parts

Customer’s running cost

Distance covered (km)

Periodic maintenance chart for the emission control system

t Check fuel hoses for cracks or

General maintenance and lubrication chart

t Perform dynamic inspection us-

8 * Brake fluid t Change. Every 2 years

t Check tread depth and for dam-

t Check chain slack, alignment and

t Make sure that all nuts, bolts and

Shift pedal pivot t Lubricate with lithium-soap-

t Check coolant level and vehicle

1 3 Checking the spark plug

To change the engine oil (with or 1

8. Install the engine oil strainer, com- NOTICE

check the antifreeze content of Cleaning the air filter element

1. Air filter element

1. Throttle grip free play 1 2 (b)

WARNING note the following points regarding the

Periodically check the clutch lever free 1

Improper maintenance can result in NOTICE

Changing the brake fluid Drive chain slack

2. To tighten the drive chain, turn the

The operation of the sidestand should

t INTERNAL: Drink large quan- NOTICE

Headlights Auxiliary lights Tail/brake light

Replacing a turn signal light Supporting the motorcycle Front wheel

3. Loosen the axle nut.

Starting problems or poor engine performance

2. Battery The engine turns over

3FBEUIJTNBOVBMDBSFGVMMZCFGPSFPQFSBUJOHUIJTWFIJDMF

Brek dan pedal penukaran t1BTUJLBOPQFSBTJJUVMBODBS 7-26

8 * Cecair brek t (BOUJLBO Setiap UBIVO