Documente Academic
Documente Profesional
Documente Cultură
treatment,
reuse and
diversion component
technology review
Literature Overview
Table of Content
Technology Review | Urine diversion components
Overview of urine diversion components such as waterless urinals,
urine diversion toilets, urine storage and reuse systems
Imprint
Published by:
Deutsche Gesellschaft für
Technische Zusammenarbeit GmbH (GTZ)
Sustainable sanitation - ecosan program
Postfach 5180, 65726 Eschborn, Germany
T +49 61 96 79-4220
F +49 61 96 79-80 4220
E ecosan@gtz.de
I www.gtz.de/ecosan
Andreas Kanzler
Head of Water Section
Division Water, Energy, Transport
Further benefits include minimised excreta-related groundwater Urine diversion (UD) devices collect urine separately from
pollution, the fact that the toilet can be indoors (as opposed faeces and from water (or with minimal flush water). A urine
to a pit latrine) and better control over micro-pollutants dis- diversion toilet has two outlets with two collection systems: one
charged to the environment. The challenges include social for urine and one for faeces (and possibly a third one for anal
acceptance, user cooperation, urine reuse or disposal issues washwater), in order to keep these two (or three) excreta or
and urine precipitation. wastewater fractions separate. UD toilets may, or may not, mix
water and faeces, or some water and urine, but they never mix
Equipment used in urine diversion systems includes waterless urine and faeces. Section 5.1 provides an overview of the two
urinals, urine diversion toilets (either with or without flush main types of urine diversion toilets: UD toilets without flush
water), urine piping and urine storage tanks. The most com- water (these are called urine diversion dehydration toilets or
mon and cheapest method to treat urine for pathogen removal UDDTs) and those with flush water (UD flush toilets).
from faecal cross-contamination is by extended storage.
Urinals – widely used by men at public toilets, restaurants,
Urine can safely be used in gardening and agriculture as a schools, etc. – work as urine diversion devices because urine
nutrient-rich fertiliser, provided relevant reuse guidelines (see is collected separately from faeces. When urinals are of the
WHO, 2006) are followed. If there is no use for the urine, waterless type, they can collect the urine pure, meaning
it can be discharged to a sewer or possibly infiltrated in the without dilution with water.
ground (if local soil and groundwater conditions permit this
without adverse impacts on groundwater quality). Urine diversion may be used in ecological sanitation (ecosan)
concepts, but not all ecosan projects use urine diversion.
Waterless urinals enable the collection of undiluted urine and Ecosan is an approach to sanitation which focusses on reuse
are already widely used in many industrialised countries (par- of nutrients and organic matter contained in excreta and
ticularly in Germany) in public or communal buildings (not wastewater, and emphasises sustainability in all aspects 1.
There are three main issues to be kept in mind regarding Precipitation in urine pipes and storage tanks occurs in both
user cooperation: water-flushed and waterless systems. In addition skin cells,
1. Users have to “think a bit” when they use UD toilets hair and excreted organic complexes will also settle.
for the first time (this point does not apply to water
less urinals, which are used in the same way as water- The end result may be hard precipitates (incrustations) or soft,
flushed urinals). Thus, urine diversion toilets need viscous, paste-like precipitates (deposits). Incrustations tend
some upfront awareness raising to ensure correct usage to occur on the inner walls of pipes and pipe bends. Soft
and social acceptance. deposits occur in storage tanks (where they form a sludge at
the bottom of the tank) and in near-horizontal urine pipes.
The following design parameters reduce the extent 2.6.2 Pathogens 11
of precipitation:
ÿ Short retention time: precipitation often occurs at There are four types of pathogens relevant for sanitation:
locations where the urine flow velocity is low or even bacteria, viruses, parasitic protozoa and intestinal helminths.
stagnant (such as siphons, horizontal pipes, U-bends It is important to know that urine in the bladder of a healthy
of the toilet). Such arrangements should therefore be person is sterile (meaning it contains no pathogens). Only
avoided. very few diseases are transmitted via pathogens in urine. The
ÿ Smooth surfaces and hydrophobic materials should only disease which needs to be considered from a risk perspec-
be used. Scratching of surfaces by mechanical cleaning tive when urine is reused in agriculture is Schistosoma haema-
should be avoided. Plastic PVC pipes are commonly tobium – and only in areas where this disease is endemic
used for urine pipes. (WHO, 2006, Volume 4). In contrast, the amount of patho-
ÿ If flushing with water: Flushing with soft water, gens in faeces can be very high, depending on the prevalence
such as rainwater, is preferred to flushing with hard of diseases in the population.
water (soft water has less calcium and magnesium
which can precipitate with the urine’s ammonium
and phosphate). 2.6.3 Nutrients
ÿ Pipes with a relatively large diameter (at least 2.5 cm)
are less likely to get clogged. Macro-nutrients in excreta include N, P, K and S (nitrogen,
phosphorus, potassium and sulphur) of which N and P are
Using no flush water at all (as in waterless urinals) does not the most important.
eliminate the problem, since urine also contains calcium and
magnesium which can precipitate with ammonium and phos- With regards to the nutrients contained in urine, the follow-
phate to form struvite. In waterless UD systems, more soft ing design figures are used (derived mainly from Swedish
deposits tend to occur than hard incrustations, whereas for data but considered to be quite universal, see Jönsson et al.,
water-flushed UD systems it is the other way around. Informa 2004):
tion about maintenance tasks to prevent or remove blockages ÿ Mass of nutrients excreted with urine: 4 kgN/cap/yr,
in urine pipes is provided in Section 6.4. 0.36 kgP/cap/yr and 1.0 kgK/cap/yr.
ÿ Concentrations of macro-nutrients in urine (design
figure): 7300 mg/L N; 670 mg/L P; 1800 mg/L K.
2.5 Quantity of urine ÿ Concentration figures are based on a person’s diet
and should preferably be verified onsite.
The quantity of urine produced by an adult is around 0.8 ÿ 80% of the nitrogen excreted by a person is excreted
to 1.5 L per adult per day (WHO, 2006, Volume 4) – it mainly with the urine, and the rest with the faeces. Hence,
depends on the amount a person drinks and his or her transpi in terms of nitrogen fertiliser, urine is more important
ration. Children produce approx. half as much urine as adults. than faeces. For phosphorus, 55% is excreted with the
A widely used design figure, based on Swedish data, is 1.5 L/ urine, the rest with the faeces.
cap/d (or 550 L/cap/year)2. ÿ Adults excrete the same mass of nutrients as taken up
in their diet, as there is no retention of nitrogen and
phosphorus in the human body, except for children
2.6 Quality of urine where a small amount is retained for bone growth.
2.6.1 Source considerations
The chemical composition of fresh and stored 3 urine is
The description of urine quality in this section applies to summarised in Table 1 (see next page) and the following
urine collected without cross-contamination with faeces. Such observations are highlighted:
cross-contamination is dealt with via urine treatment methods ÿ Fresh urine contains nitrogen mainly in the form
(see Section 2.7). of urea; stored urine contains nitrogen mainly in the
form of ammonium/ammonia (the transformation
Additionally, it should be highlighted that the quality of the process is described in Section 2.7.2).
collected urine is related to the health and life style of the ÿ The lower phosphate, magnesium and calcium con
people excreting it and to the urine collection system. For ex- centrations in stored urine compared to fresh urine
ample, if urine is collected from a hospital or an old-age home are due to precipitation processes during storage.
it will most likely contain more pharmaceutical residues than
urine from healthy and young people. And if urine is led
through copper pipes it may have a high copper concentration. 2 Cap = capita = person
This has to be kept in mind during the design phase, especially
3 Stored urine means urine which is completely hydrolysed
when reuse is planned. (Udert et al., 2003), and this typically occurs within 2-4 weeks depen
ding on the amount of urease present (Maurer, 2007).
12 Table 1. Average chemical composition of fresh urine (literature careless users deposit faeces in the urine compartment
values) and stored urine (simulated values, see Udert et al. (2006))4 .
of a UD toilet (this is termed “cross-contamination” of
Significant changes during storage are indicated in bold.
urine with faecal material). As mentioned above, pure
Parameter Fresh urine Stored urine urine is virtually pathogen-free.
ÿ Other possible treatment objectives may include:
pH 6.2 9.1
„ Volume reduction by evaporation or by conversion
Total nitrogen, TN (mg/L) 8830 9200 into solid form (struvite) to reduce transport costs.
Ammonium/ammonia-N, 460 8100 „ Extraction (further concentration) of nutrients.
NH 4 + and NH3 (mgN/L) „ Elimination of micro-pollutants.
Nitrate/nitrite NO 3 + NO 2 0.06 0
(mgN/L)
2.7.2 Treatment by storage
Chemical oxygen demand, 6,000 10,000
COD (mg/L)*
The simplest, cheapest and most common method to
Total phosphorus, TP (mg/L) 800 – 2000 540 treat urine with the aim of pathogen kill, is extended storage
in storage tanks.
Potassium, K (mg/L) 2740 2200
Sulphate, SO 4 (mgSO 4 /L) 1500 1500 Storage of urine in a closed tank or container (not necessarily
gas tight) is an efficient treatment method for reducing patho-
Sodium, Na (mg/L) 3450 2600
gens in urine: The decomposition of urea into ammonia/
Magnesium, Mg (mg/L) 120 0 ammonium and hydrocarbonate – which is facilitated by the
natural enzyme urease – leads to an increased pH value (pH
Chloride, Cl (mg/L) 4970 3800
around 9) which has a sanitising effect (meaning it kills patho-
Calcium, Ca (mg/L) 230 0 gens), so that bacteria, parasitic protozoa, viruses and intestinal
helminths die off over time. An environment with a high tem-
* COD is a measure of the organic components. perature and low dilution with water enhances this effect.
Time itself also leads to pathogen kill.
2.6.4 Micro-pollutants Safe reuse of urine in agriculture can be ensured if the fol-
lowing recommended storage times are used (for details see
Micro-pollutants in urine could include the following WHO, 2006, Volume 4):
categories of substances: ÿ Urine originating from larger systems (community level)
1. Natural hormones – where cross-contamination with faeces cannot be
2. Pharmaceutical residues, including hormones ruled out – should be stored for at least one month if
from contraceptive pill it is used on food or fodder crops which are processed.
3. Heavy metals For a higher safety margin, 6 months of storage can be
4. Persistent organic pollutants (POPs) used (in which case the urine can be used on all crops).
But if the ammonia level in the urine is greater than
The last two categories of micro-pollutants – heavy metals 2 mgN/L (which it should be for undiluted urine) then
and POPs – are virtually non-existent in urine as they would shorter storage times will suffice (Winker et al., 2008).
originate from the food a person has eaten. Urine is an im- ÿ No storage is needed when urine from own production
portant pathway for the body to eliminate organic degrada- (or from systems where cross-contamination with fae-
tion products which are toxic to the human body, but these ces is definitely not occurring 5) is used for crops grown
substances are easily biodegradable by soil microorganisms for own consumption. This is because disease trans-
after excretion. The first two categories of micro-pollutants – mission within the household via the urine-oral route
the natural hormones and pharmaceutical residues – do occur is much less likely compared to day-to-day contact of
in urine and can be managed (see Section 2.7.3 and 3.2). the household members.
2.7 Urine treatment 2.7.3 Other urine treatment technologies
2.7.1 Treatment objectives
Advanced urine treatment technologies can include bio-
Urine treatment has the following objectives: logical processes (nitrification), chemical processes (struvite
ÿ Pathogen kill (this is the main objective): Collected precipitation; ozonation) or physical processes (membrane-
urine may be contaminated with faecal pathogens if based). Some of these high-tech methods (such as ozonation
4 Source: Maurer (2007) 5 For example when urine is collected from waterless urinals.
and membrane-based processes) can remove micro-pollutants ÿ A UDDT usually has a slightly higher capital cost 13
from urine (see Larsen and Lienert (2007); Tettenborn than a simple pit latrine or – of course – the do-noth-
(2007)). This is useful to know if there is concern about ing option of open defecation.
micro-pollutants in urine (see Section 3.2).
Adequate financing and operating schemes have to be found
that ensure financial sustainability and make the system afford
2.8 Are UD systems more cost effective? able for the users. Further information is available in the fact
sheet of the SuSanA working group on “costs and economics”
Possible cost savings of urine diversion systems may be re- (http://www.susana.org/index.php/lang-en/working-groups/
lated to the following aspects (in each case, one needs to con- wg02/documents-wg02).
sider which systems are being compared):
ÿ If a centralised sewer system and wastewater treatment
plant can be avoided by using UD toilets, then cost 2.9 Technical components used for achieving UD
savings will be significant. However, the collection
and treatment of greywater, industrial wastewater To achieve urine diversion, the following technical com-
and rainwater still requires a sewer system of some ponents are used: waterless urinals, urine diversion toilets,
sort (separate, decentralised systems may often be urine piping to a urine storage tank (or to a sewer) and a
preferable). Note that the remaining greywater in UD reuse system for the urine. Further information is provided
systems contains a far lower concentration of patho- in Sections 4 to 6.
gens and nutrients compared to conventional domestic
wastewater. There are two main variants of UD toilets: UDDTs (urine-
ÿ In regions where water is scarce and expensive, water diversion dehydration toilets - no flush water is used at all)
savings from UD toilets (in particular UDDTs) can and UD flush toilets (water is used to flush the faeces away
lead to overall cost savings compared to flush toilets. and to rinse the urine compartment).
ÿ In regions where soil fertility is poor and fertiliser ex-
pensive, farmers may have production cost savings or
higher yields when using urine as a fertiliser instead of
mineral fertiliser or no fertiliser at all.
3 Reuse of urine as fertiliser
Regarding potential energy savings, this needs to be analysed in agriculture
on a case by case basis. Energy savings may be possible with
UD systems in three areas:
1. If the system is set up to use less water, energy savings 3.1 How to use urine as a fertiliser
are possible with respect to pumping, processing and
distribution of the tap water. When sanitation projects are set up where collected urine
2. Energy savings may be possible at the wastewater is to be used as fertiliser, consultation with farmers and soil fer-
treatment plant, which receives a lower load of nitro- tility experts is essential, as the engineers setting up the sanita-
gen in the sewage if urine is collected separately tion projects usually lack the necessary agricultural expertise.
(hence less oxygen required for nitrification process).
3. If urine replaces artificial mineral fertiliser, then ener-
gy savings are possible for fertiliser production as well 3.1.1 Basic guidelines
as for fertiliser transport (most African countries have
no local mineral fertiliser production facilities). The benefits of urine as a fertiliser and its application me
thods have been well documented, for example in SuSanA
A life cycle analysis, comparing the energy demand for nutri- (2008), PUVeP (2008), Morgan (2007), WHO (2006) and
ent removal and mineral fertiliser production versus nutrient Jönsson et al. (2004). Some highlights from these documents
recovery identified a considerable energy saving potential with are summarised below.
urine diversion nutrient recovery (Maurer et al., 2003).
Urine is a quick acting fertiliser that can be used for any crops
On the other hand, the following aspects can lead to UD which require the macro-nutrients N, P, K or S (nitrogen,
systems having higher costs than conventional systems: phosphorus, potassium or sulphur 6). The fertilising effects
ÿ In comparison with conventional sewer-based sanitation of these nutrients in urine are the same as those of artificial
systems, urine diversion systems using UD flush toilets mineral fertiliser if the same amount of nutriens is applied.
tend to have a higher initial investment cost as they re- Hence, reuse of urine in agriculture has the potential to re-
quire additional components for the separate collection, duce demand for artificial mineral fertiliser.
transport and treatment of the urine and faeces.
7 Source: Peter Morgan, Aquamor, Zimbabwe in 2008 8 This means 0.15% by weight of P₂O₅, or 1500 mg/L P₂O₅ (mul-
tiply % value by 10,000).
The following disadvantages are not specific to urine as a 3.2 Are hormones and pharmaceutical residues 15
fertiliser but still need to be kept in mind: in urine problematic for reuse?
ÿ Like other fertilisers, urine can cause plant fertiliser
burn (also called leaf scorch) if not applied correctly. The information in this section is based on Winker (2009)
Fertiliser burn is the visible symptom of insufficient and the input from Arno Rosemarin (Stockholm Environment
water in a plant associated with an over application Institute). The publication of Larsen and Lienert (2007) is also
of fertiliser salts (salts dissolved in urine) 9. recommended in this context.
ÿ Urine adds salinity to the soil and therefore its use as
fertiliser to pot plants is only recommended when the Hormones and pharmaceutical residues are two types of mi-
soil can easily be exchanged. cro-pollutants which occur in urine (concentration levels are
ÿ A lso like other fertilisers, urine can lead to ground available in Winker (2009)), as humans excrete them with
water pollution (with nitrate) and nutrient run-off their urine and faeces (as a rule of thumb: two thirds of phar-
(resulting in eutrophication in water bodies) if excess maceutical residue substances are excreted with the urine, one
amounts are applied. third with faeces, although the figures can vary widely for in-
ÿ Urine is a multi-component fertiliser (with a fixed dividual substances 10).
ratio of N, P, K and S) which should only be applied
until the first nutrient reaches its optimum for the If urine is reused in agriculture, some of these micro-pollu
soil (probably nitrogen or sulphur). Otherwise (if tants can be taken up by plants and thereby enter the human
applied until phosphorus is sufficiently supplied) food chain. This is a risk, but a small one. A full evaluation of
it can cause over-fertilisation of nitrogen and sulphur. the potential toxic effects of pharmaceuticals ingested by hu-
mans via urine-fertilised crops is very difficult and has not yet
been done. The potential risks from consuming crops fertilised
3.1.4 Should urine be applied undiluted with urine need to be compared with the risks related to pesti-
or diluted with water? cide use on crops, as well as antiobiotics and hormones given
to farm animals (poultry and cattle) which can be traced for
Urine can be applied either undiluted or diluted with example in milk and eggs. At the end of the day, it comes down
water, depending on the soil and the gardener’s or farmer’s to a risk analysis and risk management strategy.
preferences. Some gardeners dilute urine with water in a
ratio of 1:3, 1:5 or even up to 1:15, and this dilution has the Animal manures and sewage sludge containing pharmaceuti-
following advantages: cal residues and hormones are already now being used on fields.
1. R educes risk of plant “ fertiliser burn” (see previous It was shown that the load of hormones and antibiotics in
section). human urine is in fact much lower than in animal manure
2. Enables irrigation and fertilisation in one step (also (however not all groups of substances can be compared in
called “ fertigation”) and with one piece of equipment. this way as they are not all present in animal manure). With
But nozzles of drip irrigation may clog when a urine- sewer-based sanitation systems, these types of micro-pollu
water mixture is used for fertigation. tants are not removed in conventional sewage treatment plants
3. Reduces odour during application, especially if a and are thus discharged into surface water bodies and can
high dilution ratio is used (1:5 or greater). reach the groundwater (detected concentrations of pharma-
4. Minimises the risk of applying too much fertiliser ceutial residues in groundwater are in the order of 50 ng/L in
to potted plants, as the pot will overflow before too several locations in Germany).
much nitrogen is applied.
When comparing the two approaches (discharging urine with
On the other hand, applying urine undiluted has the advan- treated wastewater to surface water versus urine application to
tage that a smaller volume of an odorous liquid has to be soil), it is likely to be safer to discharge urine to soil rather
handled. than water. The micro-pollutants can be degraded better in
the aerobic, biologically active soil layers (high concentration
When applying urine undiluted, fertiliser burn of the roots is of micro-organisms per cubic centimetre) with longer residence
avoided by adding urine in furrows, somewhat to the side of times than in water bodies whose ecosystems are much more
the plants (approx. 15 cm). Odour nuisance is minimised by sensitive. This has previously been proven in the case of hor-
immediately covering the urine with soil after the urine has mones 11, and more research is needed to prove it for other
been added to the furrows. Usually, irrigation water is added types of micro-pollutants as well.
directly after the urine application.
9 Root cells actively absorb fertiliser salts from soil solution, and 10 To be more precise: around 70% of pharmaceutical substances
under normal conditions maintain a higher osmotic pressure. If excess are excreted via urine accounting for 50% of the overall ecotoxicological
fertiliser salts are applied (i.e. concentrated urine which is not diluted), risk (Larsen and Lienert, 2007). The ecotoxicological risk of the fraction
the osmotic pressure of the soil solution is raised. This means water can- of pharmaceutical residues contained in urine and in faeces is the same
not enter the cell and may actively move out of it. The resulting injury is regardless of the higher number of substances excreted via urine.
known as fertiliser burn or physiological drought (Robert Holmer, 11 This finding is of particular relevance regarding the artificial
Ecosanres discussion forum, 2008). hormones which are excreted in urine from women taking the
contraceptive pill.
16 Terrestial systems (soil) are more suitable for natural degra 4 Waterless urinals
dation of pharmaceuticals than aquatic systems because:
ÿ The oxygen levels are around 50,000 times higher
in soil than in water. This chapter draws on the publication by v. Münch and
ÿ Exposure to UV light helps to degrade pharmaceuti- Dahm (2009). Note: “waterless” means “without water” in
cals, although this only applies to the surface (1-2 cm English. Some people also use the term “waterfree”. We do not
soil depth) and crops can shade the ground. recommend any particular urinal model in this publication.
ÿ The high specific surface of soil particles maximises
the exposure of adsorbed chemicals, maximising the
kinetics of degradation. 4.1 Definition and purpose
ÿ The wide biodiversity of the fungal and bacterial flora
of soil is adapted to degrade various types of organic A urinal is a specialised toilet for urinating only, which is
molecules, both complex and simple. used while standing up, and is designed primarily for male
users. Urinals are widely used around the world, especially in
Finally: “Drug residues in sustainable sanitation products used public facilities being frequented by a large number of boys
to supply plant nutrients can hardly be a serious issue in regions and men, because they save space and costs compared to toi-
where malnutrition, groundwater and surface water pollution lets (simpler design; no separate cubicles needed, although in
due to inappropriate sanitation and irrigation with untreated many cases separation panels are installed). Urinals are not
wastewater is a reality” 12. commonly used in private households due to their additional
space requirements.
3.3 Is urine an “organic fertiliser” and A limited number of urinals for females (to be used while
can it be used in organic farming? standing or squatting) are on the market but they are not
widely accepted for various reasons, such as females having
The definition of “organic fertiliser” may be according greater needs for privacy as they have to partially undress.
to two different categories: Squatting-type urinals (squatting pans without an outlet for
1. Organic in the analytical chemistry sense (a com- faeces) are sometimes used for girls in African or Asian prima-
pound which contains carbon and may contain other ry schools to save on space and costs compared to toilets.
elements such as hydrogen, oxygen, nitrogen).
2. Organic in a “green”, “eco” or “natural” sense. Conventional urinals are flushed with approx. 4 L of water
either after each use or based on a timer, whereas waterless
Fresh urine contains urea and is thus an organic fertiliser in urinals (see Figure 1) use no water for flushing.
the analytical chemistry sense. Stored urine contains ammo-
nia and no urea (see Section 2.6.3), and is therefore not organic The main motivation for using waterless urinals is to:
but rather a “mineral fertiliser” in the analytical chemistry 1. Save water and hence costs – these urinals are
sense. In other words: Urine is both a natural mineralised or connected to a sewer system.
mineral fertiliser, and an organic, ecological or natural ferti- 2. A llow collection of pure, undiluted urine for use in
liser 13. agriculture as a nitrogen and phosphorus-rich fertiliser
– these urinals are connected to a urine storage tank.
The “organic farming” 14 regulations differ between countries
with regards to which type of fertiliser is allowed (and is in Waterless urinals are the first and easiest step towards urine
this context called “organic fertiliser”). For example, countries diversion and, possibly, ecological sanitation (ecosan).
in the European Union are subject to the EU organic farming
legislation, where urine is not considered an allowed fertiliser.
In China on the other hand, urine is considered a natural fer-
tiliser and thus allowed in organic farming. Making urine al-
lowed for organic farming in the EU remains an important
challenge. It should be possible as urine is a natural fertiliser
with a similar composition as for example pig urine.
At present, Germany is probably the country with the highest Urine precipitates (“urine stone”), which stick to the rubber
number of waterless urinals per capita, as the price of munici- tube need to be cleaned off with water regularly (otherwise
pal tap water in Germany is one of the highest in the world, the flat rubber tube does not close properly anymore). The
and Germans are consequently very interested in all water- cleaning frequency depends on the number of uses per day
saving opportunities (1,200 waterless urinals of Keramag are (cleaning once per month under average circumstances may
in use in the public toilets of Hamburg in Germany). be sufficient). The rubber tube needs to be replaced around
once a year. The rubber material is sensitive to solvents, acids,
Waterless urinals are commonly used in industrialised coun- and deodorising tablets often used in urinals. Therefore, the
tries for public toilets which are not connected to the sewer use of acids or aggressive cleaning agents must be avoided. This
(such as rest stops along highways). It would be beneficial if system is used for example by the German company Keramag
they became widely used in developing countries as well. in their Centaurus model.
To gain wide acceptance, waterless urinals must meet the The curtain valve seal is similar to the rubber tube seal,
accepted standards applicable for conventional waterborne in- but was designed to reduce maintenance requirements. This
stallations. Their odour emission must be less or at worst equal type of one-way valve has “self-cleaning properties” as a small
to the old system. To achieve this odour-free performance four pressure difference forces the urine to wet the whole inner
aspects are absolutely crucial for waterless urinals: surface between the “curtains”, therefore flushing them clean.
1. Suitable mechanism to block the odour coming back The element is designed in a manner to minimise build-up of
from the sewer and urine storage tank, for example urine precipitates or urine sludge and thus keeping the sealing
(discussed in detail in the sections below): surfaces clean. Like the flat rubber tube seal, this one-way
„ rubber tube seal valve also allows passage of grit up to 2 mm.
„ curtain valve seal
„ sealant liquid (blocking fluid) The silicon curtain element is integrated into a plastic casing
„ plastic table tennis ball placed in a funnel which (Figure 2). The placing of the EcoSmellstop (ESS) element
is inserted in the opening of a jerrycan; or into a plastic sleeve has two purposes, firstly to guarantee that
18 no odour from the sewer or urine storage tanks escapes into 4.4.3 Sealant liquid (blocking fluid)
the room, and secondly to allow an easy removal of the ESS
unit for maintenance purposes. For replacement of the This system works with a sealant liquid (also called block-
curtain (if simple cleaning is no longer possible), the entire ing fluid) which is made of vegetable oils or aliphatic alcohols
plastic casing is removed with a small plastic extractor tool – they are biodegradable if released to the sewer or urine stor-
(Figure 3), then discarded and replaced with a new ESS. This age tank. The sealant liquid, with a specific gravity of around
replacement process may be necessary about once per year 0.8, floats on top of the urine contained in the trap and thus
and takes only a few seconds. It can be performed without constitutes an effective odour barrier. Urine immediately pe
having to touch the ESS element by hand. netrates the sealant liquid and flows to the drain. Urine pre-
cipitates are collected in a cartridge or inner cylinder of the
The ESS manufacturing process is not simple as the injection trap. The maintenance program of waterless urinals with a
moulds are of extreme complexity, and the mixing and injec- sealant liquid consists of cleaning of the urinal bowl, and
tion requires very sophisticated machinery. For this reason, it the regular exchange of the cartridge (or the sealant liquid,
is not yet possible to manufacture the ESS locally in develo see Figure 4). The required exchange frequency depends on
ping countries, but it can easily be imported as it is small, the number of users. With each use and in between uses,
light-weight and low-cost. This patented ESS unit is used by some urine precipitates accumulate which eventually renders
the companies Addicom, Kellerinvent AG and F. Ernst Inge- the trap inoperative. Foreign objects, such as cigarette stubs,
nieur AG 15 since 2006. accelerate the process. At this point the cartridge has to be
cleaned or replaced.
If the trap starts to smell, while it is still freely passing urine,
merely a refill with the sealant liquid can resolve the problem
for some designs. In the USA, this is currently the most com-
mon type of waterless urinal, as under current legislation only
these liquid-filled traps are approved for waterless urinals.
Figure 2. Two types of odour seals for waterless urinals. Left: Flat rubber
tube (Keramag Centaurus). Right: (left side) See-through pipe fitting;
(right side) see-through EcoSmellstop (ESS) unit showing the blue
silicon curtain one-way valve inside (source: (left) E. v. Münch, 2007;
(right) Addicom).
Figure 3. EcoSmellstop (ESS) unit with pipe fitting and extractor. Figure 4. Example instruction sheet, showing replacement of sealant
Inside the ESS is the silicon curtain valve (source: Addicom). liquid for Uridan urinals (other urinals with sealant liquid have a similar
maintenance routine) (source: Uridan).
Possible advantages of sealant liquid systems in the context of duce maintenance costs). Waterless urinals do not need to be 19
developing countries may include: connected to a sewer but can be connected to a urine storage
ÿ No need to be exchanged when full with precipitates, tank instead (important for remote locations not connected
but can be easily cleaned. to sewers). Obviously, water for hand wash basins and water-
ÿ After being cleaned, they can be refilled with some f lushed toilets (if not replaced by waterless toilets) is still
thick cooking oil16 (this does not last as long as the required next to the waterless urinals.
recommended liquid, but is available almost anywhere).
Materials
There is no clear evidence yet which of the three systems dis- Urinal bowls are typically made of acrylic, ceramic, stainless
cussed above is better for low-cost, low-maintenance applica- steel or glass-fibre reinforced polyester, but can also be made
tions, and this may depend on the preference of the individu- of simple low-cost plastic, provided that it has a smooth sur-
als or companies responsible for the urinals’ maintenance. face (for odour control). Self-construction of inexpensive
waterless urinals is also possible. When using plastic urinal
bowls, one option is to use linear low density polypropylene
4.4.4 Other methods for the odour seal as it is one of the most inert plastics (non-stick surfaces). The
hot production process at 180°C guarantees a smooth, non-
Other methods for odour control are on the market (see porous surface, therefore minimising bacterial biofilm growth.
also suppliers listing in Appendix). One example is the system
by Urimat where the sealant liquid is replaced by a float (hy- Converting water-flushed urinals to waterless urinals
drostatic float barrier) which is magnetically activated thus It is in principle also possible to convert conventional water-
opening the channel to the overflow chamber. For low-cost flushed urinals to waterless urinals (depending on the bowl
applications in developing countries, this system has the dis- design), for example by using the ESS, which is also sold as a
advantage of a higher complexity compared to the systems stand alone unit. It is very important to get a snug fit of the
described above 17. ESS into the urinal drain.
The flat rubber tube and ESS units can be cleaned many times As waterless urinals are a novelty for many people, any smell
before having to be replaced. Some sealant liquid cartridges emitted from a waterless urinal gets blamed on the new system.
cannot be cleaned but need to be replaced when they fail, However a smelly water-flushed urinal is accepted as normal
whilst for example the Uridan system can be cleaned, and as they have a long odorous history. It is a fact that any type
the sealant liquid replaced, any number of times. To give an of urinal (water-flushed or waterless) will not smell if well
example: According to information given by Addicom, an ESS maintained. The extent of maintenance required for water-
element can last for 16 months with careful maintenance, such less urinals can be higher or lower compared to water-flushed
as spraying the urinal bowl regularly with the cleaning agent urinals, depending on the type of waterless urinal used (as
“DestroySmell” (containing tensides and active microorganisms), explained above).
and removing the ESS element and rinsing with diluted citric
acid to slow down the formation of urine precipitates on the
curtains. 4.8 Suppliers and costs of waterless urinals
Empirical evidence gathered in low-income settings in South The following options exist for buying waterless urinals in
Africa (such as public parks and taxi ranks in Johannesburg) developing countries:
since 2004 suggests that the curtain seal (ESS system) can ÿ Imported waterless urinals with or without patented
perform with less maintenance than the flat rubber tube. In odour control devices
regions where diligent maintenance of urinals cannot be gua ÿ Plastic waterless urinals manufactured locally and
ranteed (such as public toilets in informal settlements in sub- imported ESS element or liquid seal inserted for
Saharan Africa), the ESS system may therefore be a better odour control
choice of the two. More side-by-side comparisons between ÿ Self-constructed waterless urinals made from plastic
different waterless urinal types are required, particularly for containers.
urban, low-income areas in developing countries with a poten-
tially high level of abuse and neglect. For low cost applications, simple plastic urinals may be a good
option. These can be produced in a "rotation moulding" pro
cess. This is a cheap and simple process to make a single-skin
4.7 User acceptance of waterless urinals type unit, which can be replicated in any country.
Experience worldwide has shown that waterless urinals en- Suppliers lists for waterless urinals are provided in the Appendix.
joy the same level of user acceptance as water-flushed urinals For reference installations either contact the manufacturers or
do, since for the male users there is no behaviour change re- see the case study descriptions of sustainable sanitation
quired (many users do not even notice that they are using a projects on www.susana.org. Many of these projects incorpo-
waterless urinal). For those men who are shy and do not like rate waterless urinals. Photos of waterless urinals are also
using urinals in public places (for lack of privacy), it makes no available here: http://www.flickr.com/photos/gtzecosan/
difference whether the urinal is water-flushed or not. sets/72157613881735035/
For outdoor UDDTs with individual urine storage tanks, the 5.4.2 Basic design information
connection to the urine storage tank is usually direct, with-
out any odour trapping device. The faeces chamber has a vent The benefits of UD flush toilets compared to flush toilets
pipe to remove odour from the toilet, and dry additives assist were listed in Section 2.3.1. The UD flush toilet has a parti-
in odour control. tion in the toilet bowl isolating a bowl for urine in the front,
and a bowl for faeces in the back. The bowl is similar to
bowls used for UDDTs, except that for the UD flush toilet,
5.3.3 Construction methods and materials water is used to flush the faeces away. The flushing mechanism
for the urine part is designed in one of two ways:
Possible materials for the toilet pedestal or squatting pan 1. The urine pipe stays open and therefore receives a
are: ceramic, concrete, acrylic or glass-fibre reinforced plastic. certain amount of flushing water when the bowl is
The toilet can either be self-constructed or prefabricated. flushed (see Figure 6); or
Metal components (except for stainless steel) cannot be used 2. t he urine pipe is closed by a valve and therefore
since urine is corrosive. receives no flushing water (this is the case for the
Roediger NoMix toilets).
The UD flush toilets can reduce water consumption com- A particular problem found with the Roediger NoMix toilet 23
pared to conventional water-flushed toilets because the water is that toilet paper thrown into the urinal bowl is not flushed
required for the “urine flush” is less than the amount for the away with the small urine flush; and hence more than one
“ faeces flush”. flush becomes necessary – negating the water saving effect of
this type of toilet 20.
UD flush toilets can also be combined with the concept of
vacuum toilets (realised for example by the company Roedi- Another problem of the Roediger NoMix toilet is that the valve
ger for a pilot project in Berlin Stahnsdorf and by the Swe on the urine pipe can get blocked over time. In this case, urine
dish company Wost Man Ecology, see Appendix). This type is no longer collected in the storage tank but flows to the faeces
of toilet collects urine and a small, concentrated amount of section of the toilet, or the valve is not closing anymore causing
brownwater (faeces with about 1 L of flush water). odour problems in the toilet room. Therefore, the user needs to
carry out preventative maintenance by adding diluted citric acid
to the valve once per month for a period of 24 hours.
5.4.6 Project examples
UD flush toilets are used in some industrialised countries
and they are not a low cost option. So far they are mainly used
in Sweden and in some projects in Germany, the Netherlands,
Switzerland and Austria.
Two project examples for which detailed descriptions are avail
able are (both on http://www.susana.org/lang-en/case-studies/
Figure 6. UD flush toilets. Left: Gustavsberg (in Meppel, the Netherlands); region/europe):
Right: Dubbletten (in Stockholm, Sweden); (sources: E. v. Münch, 2007). ÿ Urine and brownwater separation at the GTZ
main building, Eschborn, Germany
ÿ Urban urine diversion & greywater treatment
5.4.3 Odour control for the urine collection system system, Linz, Austria
For the urine pipe, several types of odour seals are used by
the toilet manufacturers, such as a valve (Roediger NoMix toi- 5.5 Suppliers and costs for UD toilets
lets), a urine/water seal (Gustavsberg toilets) or a novel silicon
seal (Dubbletten toilets). Information on models and suppliers can be found in
the Appendix. The costs for some of these toilets are relatively
Odour locks in the UD toilet’s urine pipe are required to pre high, as the number sold is quite low. If the market for these
vent back flow of odour into the toilet room; but these are not types of toilets grows and more suppliers enter the market,
necessary in the case of short urine pipe systems of up to 3-4 m. then the unit costs will decline.
For the faeces part, odour control is achieved by a water seal in
a U-bend (just like for conventional flush toilets).
5.6 How to choose between a UDDT
and a UD flush toilet
5.4.4 Materials
For pro-poor approaches in developing countries, UDDTs
As UD flush toilets have been designed for users in high- are more suitable than UD flush toilets, as the latter still require
income countries, they have been manufactured only in cera a reliable 24-hour water supply, a sewer system and a treatment
mic and have a similar appearance to conventional flush toilets. process for the faeces-water mixture (brownwater).
A comprehensive description of the technical details for To prevent odours, the piping system should be only spar-
urine pipes and tanks is available in Kvarnström et al. (2006). ingly ventilated, pressure equalisation is enough (see Section 6.3
Some key considerations are provided below. for more details on ventilation). Also the pipe opening needs to
be immersed into the liquid in the storage tank. This is parti
cularly important in long vent pipes that can act as chimneys
6.1 Urine piping with upward flow of air 23.
Urine pipework is normally made of durable plastics such The urine which is collected by means of a waterless urinal
as polyethylene (PE) or polyvinyl chloride (PVC). or by a urine diversion toilet flows to a urine storage tank.
These tanks have a lid and are closed to prevent odour and loss
of nitrogen via ammonia gas. The tanks are either emptied by
6.1.3 Pipe size and layout the users themselves (small-scale systems) or emptied by a pump
and truck arrangement. The urine is then transported to the
To maximise the flowrate of the urine (and any sediments), point of agricultural reuse or to further storage or treatment.
the insides of the pipes should be smooth. Flow restrictions,
such as sharp 90º bends, should be avoided as much as possible. Urine storage tanks have one or several of the following three
main purposes:
The minimum recommended diameter of the pipes is 50 mm, 1. To bridge the time in between collection/emptying
but the optimum range is from 75 mm to 110 mm. events.
2. To sanitise the urine: over time, pathogens in the
For larger systems (several toilets connected to one urine tank), urine are killed off (increased pH due to urea conver-
the slope of the pipe should be at least 1% to minimise urine sion to ammonia (see Section 2.7.2).
precipitation. For individual toilet systems, the slope should 3. To bridge periods where plants are not fertilised: The
be at least 4%, but can be built with smaller diameter pipes, plants’ need for fertiliser is not constant all year round
down to about 15 mm. (except in the tropics). Fertiliser nutrients are generally
only needed just before sowing and in the beginning
For inspection and cleaning, the pipes should be made of the growth period (see Section 3).
accessible (by provision of inspection openings).
There are two types of urine tanks: the receptor urine tank at
As a rule of thumb: keep urine pipes as short as possible the toilet and the urine storage tank for storage, sanitisation
and with the highest possible slope. Horizontal pipes should and reuse (these functions can be realised in the same vessel
not exceed 200 m because of the problems of sludge accu- or in separate vessels).
mulation in the continuously wetted side of the pipe 21.
The location of the urine storage tanks can be: The urine tank system may be set up to use one large urine
1. At toilet level: If the urine is to be used in the house- storage tank or several smaller tanks (even down to using a large
hold garden, a simple plastic jerrycan can be used. number of 20 L jerrycans). In either case, the required total
2. At household/building level (several toilets together). storage volume (Vstorage) can be estimated as follows (addi-
3. A t community level (several houses together) – tional safety factors may be applied):
this is possible if distances between houses are short.
Vstorage = Nusers · purine · t storage · ftimefraction
As the urine tanks must be emptied regularly, suitable access
for persons or vehicles is required. with:
Nusers = number of users
The tanks can be located either in the cellar of the building, purine = specific urine production per person
next to the building or below ground. Urine tanks below (~ 1.5 L/cap/d of urine if the user is at the
ground have the disadvantage that leaks from the urine tank premises 24 hours per day 24)
are difficult to detect (a leaking urine storage tank can lead t storage = desired storage time 25
to groundwater pollution with ammonia and nitrate or to ftimefraction = fraction of time that the users stays at the
the tank being filled with groundwater). Underground tanks premises where the toilet is.
have the advantages however that they are usually cheaper
to build, have a better insulation in winter (relevant for cold The required storage time (t storage) was already discussed in
climates) and the access to the manhole is usually also easier. Section 2.7.2). For example, typical design criteria for a sto
In the case of underground tanks it is important to take the rage tank are 360 L of urine per person per year (if they spend
groundwater level into account – to avoid tanks floating in the 2/3 of their time at the premises) and a storage time of one
event of rising groundwater. month.
Whilst the tanks are closed and designed to minimise odour, It is obvious from this equation that if urine is flushed away
some odour could still occur. Hence, the tanks should be in with water, then a larger urine storage tank is required com-
a well-ventilated area and away from kitchens, offices and pared to a toilet where urine is collected undiluted.
bedrooms to minimise odour complaints.
When designing the size of the urine storage tank, considera-
A secondary urine storage tank at the farmer’s premises may tion also needs to be given to the capacity of the emptying
be necessary to enable the farmers to apply the urine when they vehicle. Details on possible emptying vehicles in the low-cost
need it (Figure 8). context are provided in Slob (2006).
Plastic tanks which are sold for rainwater harvesting are also For large installations, the use of several urine storage tanks is
suitable as urine storage tanks, and can be a good solution in advisable so that one can be taken out of service if necessary.
developing countries.
24 Plus flushing water if UD flush toilets are used, unless they have
a valve like the Roediger NoMix toilet model.
25 This could also be the desired time between emptying events if
sanitisation by storage is not the aim (for receptor tank with additional
storage elsewhere).
26 6.2.6 Urine overflow pipe
Installation of a urine overflow pipe on the tank is not
recommended, as this increases costs and introduces a risk of
contamination of the urine when there is an overflow or block
age in the ordinary wastewater system. Also, if there is an over
flow arrangement, users may be tempted to just let the urine
overflow and not ensure its use. It is better that the urine is
pumped to an acceptable disposal point with a portable waste
water pump if the collection tank becomes too full.
6.2.7 Examples
Figure 9. Plastic urine storage tank in Ouagadougou, Burkina Faso as part
of the EU-funded project ECOSAN_UE led by CREPA (source: S. Rüd, 2008).
Examples for urine storage tanks of different sizes are
shown below.
6.3 Ventilation for pressure equalisation
of pipes and tanks
The pipe and tank system should only be pressure equal-
ised (not ventilated) which is best done by a small hole in the
tank for equalisation with the urine tank pressure. This al-
lows the replacement of headspace air by urine flowing into
the tank, and vice versa when emptying the tank.
The reasons why the pipe system should not be ventilated are:
ÿ To eliminate ammonia emissions and odour.
ÿ To reduce risk of sucking the liquid out of any liquid
urine seals in the UD toilets.
Figure 7. Left: Low-cost solution: 20 L plastic jerrycan for urine storage at in-
dividual toilet level in Ouagadougou, Burkina Faso (source: E. v. Münch, 2006).
A one-way valve or air admittance valve placed at the top of
Note: it might be quite difficult to lift up a full jerrycan out of this enclosure.
the vent pipe can also be a good option. Advantages of such
Right: Below-ground plastic urine storage tanks at Kullön, Sweden during the
construction process. The tanks will be covered with soil (photo: Mats a valve are 26:
Johansson, source: Kvarnström et al., 2006).
1. that ammonia is not emitted,
2. internal pressure is equalised ensuring proper drainage
downwards to the tank (emptied urine pipes mean no
standing urine and less precipitation),
3. t he installation can be done inside the building just
above the top floor in the building so that the top of
the vent pipe does not need to penetrate the roof like
old-fashioned ventilation pipes,
4. saves on construction costs,
5. eliminates problems caused by condensation ice in
cold climates and UV weathering of plastic pipes.
These one-way air valves are popular in Sweden for greywater
and urine systems, and many new houses no longer have pro-
truding vent pipes.
The urine tank should not be opened more often than neces-
sary in order to prevent odour development and ammonia-
nitrogen losses. Important points concerning the tank’s
Figure 8. Urine storage tank made of a 150 m³ plastic bladder at Lake
ventilation system are:
Bornsjön near Stockholm, Sweden (photo comissioned by: E. v. Münch,
2007).
Dag-Hammarskjöld-Weg 1-5
65760 Eschborn / Germany
T +49 6196 79-0
F +49 6196 79-1115
E info@gtz.de
I www.gtz.de
Sustainable Sanitation
P r a c t i c e
Issue 3. 04/2010
Opening minds and closing loops
– productive sanitation
initiatives in Burkina Faso and
Niger
Experiences from use of urine in
Arba Minch, Ethiopia
Pharmaceutical Residues in
Urine as Fertiliser
Backyard urine recycling in the
United States of America
Food Security and Productive
Sanitation‐ practical
guidelines on the use of urine
Use of Urine partner of
Impressum
published by / Medieninhaber, Herausgeber und Verleger
EcoSan Club
Schopenhauerstr. 15/8
A‐1180 Vienna
Austria
www.ecosan.at
Editors / Redaktion
Elke Müllegger, Günter Langergraber, Markus Lechner • EcoSan Club
Journal Manager / Journal Management
Isabelle Pavese
Contact / Kontakt
ssp@ecosan.at
Disclaimer / Haftungsausschluss
The content of the articles does not necessarily reflect the views of EcoSan Club or the editors and should
not be acted upon without independent consideration and professional advice. EcoSan Club and the
editors will not accept responsibility for any loss or damage suffered by any person acting or refraining
from acting upon any material contained in this publication.
Die in den Artikeln vertretenen Standpunkte entsprechen nicht notwendigerweise der Haltung und Ansichten des EcoSan Clubs oder
des Redaktionsteams. Der praktischen Anwendung dargestellter Inhalte muss eine unabhängige Begutachtung und professionelle
Beratung vorausgehen. EcoSan Club und das Redaktionsteam haften in keiner Weise für Schäden (Sachschaden oder
Personenschaden), die durch die Anwendung, oder Nichtanwendung der in dieser Publikation vermittelten Inhalte, entstehen.
Reproduction / Reproduktion
Permission is granted for reproduction of this material, in whole or part, for education, scientific or
development related purposes except those involving commercial sale, provided that full citation of the
source is given. Cover photo excluded.
Die Reproduktion, Übernahme und Nutzung der Inhalte von SSP, vollständig oder teilweise, für Bildungszwecke, für die Wissenschaft
und im Zusammenhang mit Entwicklung ist unter Voraussetzung der vollständigen Quellenangabe gestattet und erwünscht. Titelbild
ausgenommen.
aim and scope / Offenlegung der Blattlinie gemäß § 25, Abs. 4 Mediengesetz
Sustainable Sanitation Practice (SSP) aims to make available high quality information on practical
experiences with sustainable sanitation systems. For SSP a sanitation system is sustainable when it is not
only economically viable, socially acceptable and technically and institutionally appropriate, but it should
also protect the environment and the natural resources. SSP is therefore fully in line with SuSanA, the
Sustainable Sanitation Alliance (www.susana.org). • SSP targets people that are interested in sustainable
sanitation systems and the practical approach to it. • Articles are published after blind review only. •
Sustainable Sanitation Practice is published quarterly. It is available for free on www.ecosan.at/ssp.
Sustainable Sanitation Practice (SSP) hat zum Ziel praxisrelevante Information in hoher Qualität im Zusammenhang mit „sustainable
sanitation“ bereit zu stellen. „sustainable“ also nachhaltig ist ein Sanitärsystem für SSP wenn es wirtschaftlich machbar, soziokulturell
akzeptiert, technisch als auch institutionell angemessen ist und die Umwelt und deren Ressourcen schützt. Diese Ansicht harmoniert
mit SuSanA, the Sustainable Sanitation Alliance (www.susana.org). • SSP richtet sich an Personen, die sich für die praktische
Umsetzung von „sustainable sanitation“ interessieren. • Artikel werden nur nach einer Begutachtung veröffentlicht. • Sustainable
Sanitation Practice erschient vierteljährlich, kostenlos unter: www.ecosan.at/ssp.
Information on the publisher / Offenlegung gemäß § 25 Mediengesetz
publisher: EcoSan Club, Schopenhauerstr. 15/8, A‐1180 Vienna, Austria • chairperson: Günter
Langergraber • website: http://www.ecosan.at/ • scope: EcoSan Club was funded as a non profit
association in 2002 by a group of people active in research and development as well as planning and
consultancy in the field of sanitation. The underlying aim is the realisation of ecological concepts to close
material cycles in settlements.
Medieninhaber: EcoSan Club, Schopenhauerstr. 15/8, A‐1180 Vienna, Austria • Obmann: Günter Langergraber • Gegenstand des
Vereins: Der EcoSan Club wurde 2002 als gemeinnütziger Verein von einer Gruppe von Personen gegründet, die in Forschung,
Entwicklung, Planung und Beratung in der Siedlungshygiene ‐ Sammlung, Behandlung oder Beseitigung flüssiger und fester Abfälle aus
Siedlungen ‐ tätig waren und sind. Das Ziel des EcoSan Clubs ist die Umsetzung kreislauforientierter Siedlungshygienekonzepte (EcoSan
Konzepte) zu fördern, um einen Beitrag zum Schutz der Umwelt zu leisten.
Cover Photo / Titelbild
© fotolia. http://de.fotolia.com
Sustainable Sanitation Practice 2 Issue 3 /2010
Editorial
The SuSanA factsheet on "food security and productive sanitation systems" states that
"The nutrient content of human excreta depends on the diet and varies between countries as well as
between individuals. Excreta contain all essential micronutrients and an average amount of plant available
macronutrients of 4.5 kg/person/year (kg/p/a) for nitrogen, 0.6 kg/p/a for phosphorus and 1.2 kg/p/a for
potassium. Most plant nutrients are found in the urine with a formulation similar to ammonium and urea
and comparable results on plant growth. A combined application of faeces and urine is advantageous, since
faeces are a very good soil conditioner due to its high share of organic matter. The use of excreta in
agriculture improves the pH, the nutrient content and water retention capacity of the soil as well as the
ability of plants to withstand insects, parasite attacks and pests". (see www.susana.org)
"Use of urine" is the thematic topic of the third issue of Sustainable Sanitation Practice (SSP). If urine is
collected separately, treated and converted to agricultural usage, the biggest step towards nutrient reuse and
highly efficient water protection is taken.
The papers present various aspects on the use of urine: Practical experiences from the use of urine in Ethiopia,
West Africa and from the United States of America are presented. Findings on the fate of pharmaceutical
residues in urine are summarized in another article. The final contribution gives an outline on updated
guidelines on the use of urine that will be published during 2010.
The next issue (issue 4, July 2010) will present the main results from the ROSA project (Resource‐Oriented
Sanitation concepts for peri‐urban areas in Africa) which lasted from October 2006 until March 2010 and
proposed resources‐oriented sanitation concepts as a route to sustainable sanitation. ROSA was implemented
in four pilot cities: Arba Minch in Ethiopia, Nakuru in Kenya, Arusha in Tanzania, and Kitgum in Uganda.
Information on future issues is available from the journal homepage (www.ecosan.at/SSP) and will be regularly
updated. Please feel free to suggest further topics for issues of the journal to the SSP editorial office, Ms.
Isabelle Pavese (ssp@ecosan.at). Also, we would like to invite you to contact the editorial office if you
volunteer to act as a reviewer for the journal.
SSP is available online from the journal homepage at the EcoSan Club website (www.ecosan.at/SSP) for free.
We do hope that SSP will be frequently downloaded and further distributed to interested people.
With best regards,
Günter Langergraber, Markus Lechner, Elke Müllegger
EcoSan Club Austria (www.ecosan.at/ssp)
Content:
- Opening minds and closing loops – productive sanitation initiatives
in Burkina Faso and Niger ............................................................................................................................... 4
- Experiences from the use of urine in Arba Minch, Ethiopia ......................................................................... 12
- Are pharmaceutical residues in urine a constraint for using urine as a
fertiliser?....................................................................................................................................................... 18
- Backyard Urine Recycling in the United States of America: An
Assessment of Methods and Motivations .................................................................................................... 25
Sustainable Sanitation Practice 3 Issue 3 /2010
implementing
organisation:
Opening minds and closing loops –
productive sanitation initiatives in Burkina
Faso and Niger
This paper shows how two agriculture funded sanitation projects in rural
Niger and Burkina Faso have introduced sanitized urine and faeces as new
fertilizers for improved local nutrient management, food security and health.
Authors: L. Dagerskog, M. Bonzi
Abstract
The link between food production and sanitation is at the centre of two agriculture funded sanitation projects
in Burkina Faso and Niger. Productive sanitation is used to increase food security, based on the fact that urine
and faeces from a family of ten contain nutrients equivalent to approximately 100 kg of chemical fertilizer,
locally worth ~80 US$. Urine contains the main part of these nutrients and is relatively easy to collect and
reuse. The agriculture extension officers have a key role in supervising participative tests with urine as a
fertilizer that help create demand for sanitation. Farmers are trained on how to produce liquid and solid
fertilizers from urine and faeces, by eliminating the dangers and capturing the resources via the good use of
simple urinals and “productive toilets”. The article describes the arguments and methodology used in the
projects and perspectives for up scaling in Burkina Faso and Niger.
Key actions for introducing sanitized urine and faeces as fertilizers:
Illustrative examples of the quantity of fertilizer in human excreta and results of reuse
Simple urinals for “liquid fertilizer” production and composting/dry latrines for “solid fertilizer” production
Involve the agriculture extension officers
Participative evaluation of urine as a fertilizer to create demand for productive sanitation
Sensitization on dangers and resources in excreta – and how to eliminate dangers and maintain the resources
Follow up on the whole productive sanitation chain i.e. collection, sanitization and reuse.
Sustainable Sanitation Practice 4 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
N = 2.8 kg
as urine and faeces. The global N = 2.8 kg P = 0.45 kg
phosphorous flow analysis by Cordell et P = 0.45 kg K ~ 1.3 kg
al. (2009) estimates that only 10% of K ~ 1.3 kg ~ 500 l
In the urine and
Consumed per urine
phosphorous in human excreta is faeces per
recycled to arable soil, while 50% ends up person per year person per year
in water and 40% under‐ground or on
non‐arable soil. These losses are
~50kg
equivalent to around 20% of the annual
faeces
phosphorous mined (Cordell et al. 2009).
Figure 1. The average annual fertilizer production per person
In Burkina Faso and Niger chemical
fertilizers are out of reach for most
farmers, while a growing population increases the part of consumed plant nutrients is incorporated in
pressure on arable land. Table 1 shows the difficult growing body tissue. Dagerskog (2007) used the
soil fertility and sanitary situation in these two method proposed by Jönsson et al. (2004) and
countries with low chemical fertilizer use, high statistics on protein consumption (FAOSTAT, 2005)
nutrient losses from agricultural land, a high to estimate the human fertilizer production for the
percentage of open defecation in rural areas and a ten countries in West Africa concerned by CREPA’s
high number of child deaths per year due to ECOSAN program: Benin, Burkina Faso, Congo,
diarrhoea. Côte d’Ivoire, Guinea, Guinea Bissau, Mali, Niger,
Senegal and Togo. An average person in these
Safe recycling of urine and faeces can help improve countries excretes annually 2.8 kg of nitrogen (N),
both food production and health, but the farmers 0.45 kg of phosphorous (P) and approximately 1.3
are rarely aware of the possibilities of how to kg of potassium (K) with the urine and faeces
“eliminate the danger” and “use the resources” in (Figure 1).
human excreta.
This regional average was used to illustrate the
Table 1. Challenges with soil fertility and value of human excreta in Burkina Faso. The
sanitation in Burkina Faso and Niger annual quantity of N and P in urine and faeces
from a family of ten persons corresponds
Burkina roughly to the quanitity of N and P in 50 kg of
Niger
Faso urea and 50 kg of NPK(14‐23‐14) which are the
Chemical fertilizer use two most common chemical fertilizers in
5.9 0.9
1996‐20021 (kg NPK*/ha/yr)
Burkina Faso (Table 2).
Estimated nutrient balance
2002‐20042 (kg NPK*/ha/yr)
‐ 43 ‐ 56
Open defecation in rural areas The local market price of 50 kg of Urea and 50
83 92 kg of NPK in Burkina Faso is about 80 US$
in 20063 (%)
Annual child deaths due to (SOGEDIF, Feb. 2010). The total Burkinabè
24 300 26 400
diarrhoea4 population of ~15,6 million inhabitants then
excrete the equivalent of 125 million US$
* NPK = N+P2O5+K2O worth of fertilizers per year. In addition, urine and
1
Morris et al (2007) faeces are complete fertilizers, containing the main
2
Henau and Baanante (2006)
3 plant nutrients (N, P, K) as well as the important
UNICEF/WHO (2008)
4
UNICEF/WHO (2009) trace elements and organic matter.
Table 2. The annual quantity of nutrients in the
excreta from 10 persons compared with chemical
The fertilizer value of human excreta fertilizer
To capture the attention of agriculture Fertilizer N (kg) P (kg) K (kg)
stakeholders it is important show that human
Urine et faeces from 10
excreta contain a substantial amount of plant 28 4.5 13
persons in one year
nutrients. According to Jönsson et al. (2004) the 50 kg of urea and 50 kg of
amount of nitrogen and phosphorous in human 30 4.9 7
NPK(14‐23‐14)
excreta can be calculated from protein
consumption. There is an equilibrium over the
human body ‐ what comes in sooner or later also
comes out, except during growth when a minor
Sustainable Sanitation Practice 5 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
Comparing urine and faeces as fertilizers
The distribution of plant nutrients between urine
and faeces depends mainly on the digestibility of
the food. In general the absolute majority of N and
K are excreted with the urine while P is more
evenly distributed between urine and faeces (see
Jönsson et al. 2004 for details). Faeces, rich in
phosphorous and organic material, are a suitable
base fertilizer while the nitrogen rich urine is a
suitable cover fertilizer.
The baseline study for the project in Aguié, Niger,
showed that defecation is mostly done in the fields
around the villages, while the shower/ablution
area is the preferred place for urinating (CREPA,
2009). In this situation, a better urine management Figure 2. Two bags of fertilizer were brought along
would make the greatest difference to the local for sensitization sessions in Niger to illustrate the
nutrient recycling. However this does not mean annual amount of nutrients that are present in the
that open defecation should be encouraged for any excreta from one family
reason. While defecating in the fields can bring the
nutrients in faeces back into the productive cycle, The population is sensitized on the amount of
it is a health hazard and a sub‐optimal way of fertilizer they produce (Figure 2) and the local
recycling as it is not applied at the place, time and agriculture extension officers are trained.
dose to optimize plant growth.
Urine collection starts via simple urinals (jerry
can and a funnel) to enable tests with the locally
Results and project experiences produced “liquid fertilizer”.
Participative tests are done to demonstrate the
Introducing the new fertilizers ‐ methodology
virtue of urine as a nitrogen fertilizer (urine
Both projects have followed a similar methodology compared to urea) at farmer field schools and on
when introducing sanitized urine and faeces as individual fields.
fertilizers. The methodology is based on how other
Participative evaluation of the test plots.
new fertilizers are usually introduced, via practical
participative tests: Training of village facilitators and artisans.
All concerned stakeholders are informed on the Sensitization in the villages using SARAR/PHAST
new fertilizers, showing the experience from tools for understanding the dangers as well as
CREPA’s ECOSAN projects in West Africa and the resources in human excreta and on how
photos from other projects around the world. good use of latrines and urinals can help
Table 3. The scale at local level of the two projects
ECOSAN_UE2, PS‐Aguié
Kourittenga, Burkina Faso Aguié, Niger
Number of villages involved: 30 11
25 farmers involved in participative
366 farmers trained on urine application
Vegetable farmers : tests, 22 others applied urine on own
methods
initiative
1255 farmers tested urine in 30 farmer 122 farmers tested urine in eight
Cereal farmers: field schools, 500 have done tests on own farmer field schools, 65 have done
initiative tests on own initiative
Agriculture extension officers
29 10
trained:
A total of 5,7 ha for cereal tests in farmer
A total of 0,7 ha for cereal tests in
Surface fertilized: field schools (half with urine) and 27 ha for
farmer field schools (half with urine)
individual tests (with and without urine).
Urine collected : ? > 125 m3 during 2009
Households producing solid 150 (another 60 toilets under
318 (712 toilets still to construct)
fertilizer via toilets: construction)
Households producing liquid
2000 1143
fertilizer via urinals:
Sustainable Sanitation Practice 6 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
Figure 4. Urinals and toilets in Aguié, Niger
Sustainable Sanitation Practice 7 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
Table 4. Results from analysing agronomic parameters in Aguié urine
Parameter N P K Na Mg Ca pH
(n=number of jerry cans analysed) (n=37) (n=33) (n=28) (n=9) (n=3) (n=3) (n=29)
Unit g/l g/l g/l g/l mg/l mg/l
Average 6,0 0,8 0,9 3,1 20 36 8,8
Standard deviation 1,1 0,2 0,3 0,2 1,6 3,1 0,2
The urine is especially rich in nitrogen, and in the that can cause food poisoning. However, the
higher range of the 3‐7 g N/l given as indicative infective dose is quite high and clostridium is
values in Jönsson et al. (2004). It can also be noted frequently present in the intestines of both
that sodium concentration is much higher than humans and animals and also widely distributed in
magnesium and calcium. In irrigation water where the environment due to its spore forming
the concentration of sodium salts is high relative to capability (FDA, 2009).
other types of salt, a sodic soil may develop, which
is characterized by a poor soil structure: they have Application of urine in agriculture
a low infiltration rate, they are poorly aerated and In Kourittenga, urine tests were done on a
difficult to cultivate (FAO, 1985). Even though the relatively large scale. To facilitate application, the
salt concentration is quite high in urine, the total furrows were opened and closed using animal
salt quantity applied per year is not high when traction and the urine was poured directly from
compared to irrigation water. However salinity is the jerry cans (Figure 5).
complex and further research on urine use and
salinity would be welcome to avoid long term In Aguié, the preferred application method has
problems. been with a bucket and cup. The urine in Aguié was
dosed to give the same nitrogen quantity as the
Laminou (2009) followed the volume of urine locally recommended dose for urea. With a urine
generated from 10 men, 10 women and concentration of about 5 g N/l and with urea
10 children (ca. 10 years old) in two villages in containing 46% N, 10 grams of urea corresponds
Aguié. On average the men produced 1.7 l/day, the roughly to 1 litre of urine. After the application it is
women 1.9 l/day and the children 0.9 l/day. With important to water down thoroughly, or wait to
50% of the population under 15 years, the average apply until after a rain. Some farmers have had
daily urine production would be about 1.35 litres problems with wilting plants after urine
per person. Using the concentrations in table gives application, especially young tomato plants. A
that the average person in Aguié urinates annually solution has been to avoid application during the
~ 3 kg N, 0.4 kg P and 0.45 kg K with the urine, hottest part of the day and to reinforce watering
which is higher than expected, except for the two following days after application. For
potassium. It should be noted though that the cereals, urine application has been made after a
study was made just after harvest time when good rain when the soil is humid.
people have plenty to eat. In both projects the local agriculture extension
officers have been supervising the participative
Laminou (2009) also analyzed the sanitization of tests.
urine after 30 days of storage, and found no micro‐
organisms except for anaerobic sulphite reducers
that were present in 3 out of 9 samples.
Clostridium Perfringens is one bacteria of this type
Figure 5. Urine transport and application in Kourittenga
Sustainable Sanitation Practice 8 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
It is important that farmers see sanitized human
excreta as something that complement rather than
replaces existing fertilizers. Recycling human
excreta helps reduce losses, but to increase fertility
in degraded soils all available resources are
needed: animal manure, crop and food residues,
chemical fertilizers as well as human excreta.
Overcoming mental barriers
OM 10,5kg OM with urine
17,5 kg To consider human urine and faeces as potential
resources requires a change of mindset. Such
Figure 6. Individual test in Kourittenga on change does not come over night, and initial
sorghum where organic matter (OM) has been resistance is normal. Here are some experiences of
used as base fertilizer and urine as an how mental barriers were over come in the two
additional source of nitrogen (pile to the right) projects:
The farmers want to see to believe. It was
Agronomic results with urine important to quickly start with urine collection
and testing.
During the tests, urine has been compared to urea
In Muslim societies urine is considered impure
as a nitrogen fertilizer, or complementing the
and something that one should never get in
farmer’s traditional way of fertilizing using only
contact with. On the other hand, the importance
organic matter. The test on sorghum in Figure 6 is
of cleanliness in Islam provides a good argument
an example of an individual in Kourittenga who
for collecting and taking away urine from the
tested the nitrogen effect of urine on sorghum.
compound. Men also squat when urinating, so
the alternative to dig down the urinal was
The tests in the farmer field schools were
appreciated. When applying urine, gloves and
monitored more closely, and Table 5 summarizes
mouth protection are used, and the same
millet results from four farmer field schools in
clothes are not used when praying. If urine
Aguié in 2009. All test plots (T0‐T3) of 200 m2 had
touches the clothes or skin, the accepted
organic matter (OM) as base fertilizer at a dose of
solution is to wash well with water.
20 ton/ha. T1 and T2 also had 50 kg/ha of Super
Simple Phosphate (SSP) as extra base fertilizer. The The fields closest to the village has always given
N‐application was either through 5 grams of urea the best yields since animals and people relieve
(T1) or 0.5 litres of urine (T2 and T3) per plant, themselves there and no‐one has ever hesitated
which with 10000 millet plants/ha gives around 25 to eat what is produced from these fields. The
kg N/ha. new way of recycling excreta is an improvement
of what is already done.
Urine gave roughly 10‐20 % more than urea. This is It is possible to eliminate the danger and keep
not surprising as urine, a part from nitrogen, also the resources by simple storage for urine or
contains some phosphorous and potassium. drying/composting for faeces. After sanitization
Compared to the control with only organic matter, urine is called “liquid fertilizer” and faeces is
urine increased the yields in general by 40‐50%. called “solid fertilizer”, which makes it easier to
One 25‐litre jerry can of urine gave around 2‐3 kg talk about.
extra grains in the Aguié conditions. The urine odour is said to be the fertilizer ‐ if it
Table 5. Millet harvests (kg/ha) at four farmer field schools in Aguié.
Tsamiya Malloumey Zabon
Village Dan Bidé
Bakoye Saboua Moussou
T0 (OM) 781 660 1244 1209
T1 (OM+SSP+Urea) 1160 893 1318 1000
T2 (OM+SSP+Urine) 1257 1072 1637 1111
T3 (OM + Urine) 1161 948 1773 1399
Surplus yield T2 compared to T1 (%) 8 20 24 11
Surplus yield T3 compared to T0 (%) 49 44 42 16
Sustainable Sanitation Practice 9 Issue 3 /2010
Opening minds and closing loops – productive sanitation initiatives
doesn't smell, it is no good! In Kourittenga, it is but the construction and good use of productive
compared to the traditional spice soumbala, toilets require skill and knowledge. A large scale
which is considered to be better the stronger program that provides these new skills and follows
odour it has. up on the whole system will need a lot of time and
It is people behind desks who can be the real resources. However, simple urine collection
barriers. Farmers are often very pragmatic in captures the majority of plant nutrients in human
their struggle to get a decent harvest. The excreta and can be done to a much lower cost, and
productive sanitation approach that both with less skills and follow up. An interesting
improve the living conditions and food approach would be to scale up urine recycling via
production has been received with open arms in the agriculture sector while sanitation programs
the two projects. promote faeces management. The agriculture
extension officers already widely present in the
A much appreciated activity in Aguié was the
rural areas could disseminate knowledge on urine
“blind taste‐tests” of vegetables and cereals
reuse, and prepare the grounds for further
fertilized with urine and urea. The results show a
sanitation interventions.
sweeter taste for urine fertilized vegetables, and
in general a higher buying preference for the
As an alternative to large national programs a
urine fertilized vegetables both based on taste
recent example from Malawi (Bramley and Breslin,
and appearance (Saley, 2009).
2010) show that basic productive sanitation
services also can be spread on grass root level via
Scaling up potential business opportunities for small scale
In Burkina Faso, the use of excreta derived entrepreneurs. There are signs of this dynamic in
fertilizers could either be scaled up like other the two projects discussed in this article; In
agriculture innovations, or it could go through the Kourittenga people have initiated urine collection
national sanitation program (PN‐AEPA) that is on public places, and in Aguié an individual has
about to roll out. The PN‐AEPA includes the UDDT already bought 140 jerry cans of urine from his
as a technical option, but it does not explicitly neighbours to enrich his compost.
allocate resources for accompanying farmers with
the recycling. Fortunately, in Burkina Faso it is the Conclusion
Ministry of Agriculture who is in charge of water
In the pilot villages in Kourittenga and Aguié, urine
and sanitation, so there are good opportunities for
and faeces are now looked upon as potential liquid
synergy between sanitation and agriculture
and solid fertilizers. An important reason has been
programs, if the political will is there.
the methodology of participative tests with urine.
In rural areas food production is the main
The ongoing EcoSan projects in Burkina Faso are
occupation and an effective entry door to create
still preparing the base, and the information and
interest for sanitation, at least among the men.
results are slowly reaching the top. To convince the
The women tend to be more interested by the
decision makers there is still a lot of advocacy work
comfort, hygiene and pride‐side of productive
needed, with precise and reliable data, as well as
sanitation. Already a simple urinal makes a
good economic arguments. Part of this work is
difference, as the urine odour in the shower
being done within the project in Kourittenga.
disappears with the collection.
In Aguié, Niger, the local partner project partner
On a global scale, with the absence of political
(PPILDA) will continue to support farmers and
awareness and will, the incentive to recycle human
eventually extend the approach to the entire
excreta will come with increasing fertilizer prices.
intervention zone (260 villages). On national scale
In Burkina Faso and Niger were commercial
in Niger the Rural Development Strategy (SDR)
fertilizers are beyond the purchase power of most
could be a suitable framework to take the
farmers, there is already a strong recycling
approach further. The director of the SDR
incentive. The important knowledge of urine
executive committee has shown interest but
collection and reuse can be spread by the local
wishes to have more national research on hygienic
agriculture extension officers. They are in a good
and agronomic aspects.
position to lead the yellow revolution!
From an agro‐economic point of view, the subsidy
of 180 US$ in the Burkina project or 50 US$ in
the Niger project for a productive toilet can help a
family to potentially collect around 80 US$ worth
of fertilizer per year. This is a short pay back time,
References Morris et al. (2007): Fertilizer use in African Agriculture –
Bramley, S., Breslin, E. (2010): Lessons Learnt and Good Practice Guidelines, World Bank,
Sanitation as a Business: A new spin on the challenge of sanit Washington DC, USA.
ation. Sustainable Sanitation Practice 2, 10‐14. Saley, M. (2009): Etude organoleptique des produits maraîchers
Cordell, D., Drangert, J‐O., White, S. (2009): The story of issus de l’application des urines hygiénisées et de l’urée.
phosphorus: Global food security and food for thought. Project report, PS‐Aguié project, Niger
Global Environmental Change 19, 292‐305. http://www.ecosanres.org/aguie/documents/EtudeOrganole
Cordell, D. (2010): The story of phosphorous – sustainability ptique‐SALE.pdf (in French)
implications of global phosphorous scarcity for food security. UNICEF/WHO (2008): Progress on drinking water and sanitation
PhD thesis, University of Technology, Sydney, Australia, and – special focus on sanitation, JMP report,
Linköping University, Sweden. http://www.who.int/entity/water_sanitation_health/monito
CREPA (2009): Etude de l’état des lieux AP‐Aguié. Project report, ring/jmp2008.pdf
PS‐Aguié project, Niger (in French). UNICEF/WHO (2009): Diarrhoea: Why children are still dying
Dagerskog, L. (2007) : ECOSAN et la valeur des fertilisants and what can be done,
humains ‐ le cas du Burkina Faso, ITN conference paper, 26‐ http://whqlibdoc.who.int/publications/2009/978924159841
28 Nov. 2007, Ouagadougou, Burkina Faso (in French). 5_eng.pdf
Djariri, M.L. (2009): Réduction des coûts des ouvrages
d’assainissement dans le cadre du projet assainissement
productif à Aguié au Niger. MSc Thesis, 2iE, Ouagadougou,
Burkina Faso
http://www.ecosanres.org/aguie/documents/Memoire‐
ReductionDesCouts‐DJARIRI‐lowres.pdf (in French)
FAO, (1985), Irrigation Water Management: Introduction to
irrigation, Irrigation water management, Training manuals ‐
1, http://www.fao.org/docrep/R4082E/R4082E00.htm
FAOSTAT, statistics from 2005 on protein consumption in
different countries:
http://faostat.fao.org/site/609/default.aspx#ancor, (Date of
visit: Oct 2007)
FDA, (2009): Bad Bug Book – Foodborne Pathogenic Micro‐
organisms and Natural Toxins Handbook,
http://www.fda.gov/Food/FoodSafety/FoodborneIllness/Foo
dborneIllnessFoodbornePathogensNaturalToxins/BadBugBoo
k/default.htm (date of visit: 25 March 2010)
Henau, J.C., Baanante. (2006): Agricultural Production and Soil
Nutrient Mining in Africa: Implications for Resource
Conservation and Policy Development. IFDC, Muscle Shoals,
AL, USA
http://www.africafertilizersummit.org/Background_Papers/0
3%20Henao%20and%20Baanante‐‐
Agricultural%20Production.pdf
Jönsson, H., Richert Stintzing, A., Vinneras, B., Salomon, E.
(2004): Guildelines on the use of urine and faeces in crop Name: Linus Dagerskog
production. EcoSanRes Publications Series, Report 2004‐2, Organisation: CREPA Headquarters
Stockholm, Sweden. Town, Country: Ouagadougou, Burkina Faso
Laminou, S. (2009) : Identification des risques sanitaires et des e‐mail: linusdagerskog@yahoo.fr
opportunités de production de fertilisants dans le système de
collecte d’urine du projet assainissement productif dans le
département d’Aguié au Niger. MSc Thesis, 2iE, Name: Moussa Bonzi
Ouagadougou, Burkina Faso, Organisation: CREPA Headquarters
http://www.ecosanres.org/aguie/documents/Memoire‐ Town, Country: Ouagadougou, Burkina Faso
RisquesSanitairesEtDesOpportunites‐LAMINOU‐lowres.pdf
(in French) e‐mail: bouabonzi@yahoo.fr
The ECOSAN_UE2 project in Burkina Faso is financed mainly with EU food security money (~1.5 million Euro, 2008‐2011).
CREPA together with the National Environment and Agriculture Research Institute (INERA) and the Ministry of
Agriculture implement the project covering 30 villages in the Kourittenga province. Ecological sanitation is combined
with soil and water conservation techniques to improve food production.
The International Fund for Agriculture Development (IFAD) granted a 200 000 US$ pilot project for CREPA, PPILDA (a 17
million US$ IFAD‐funded rural development project run by the Ministry of Agriculture in Niger) and Stockholm
Environment Institute (SEI) to test urine as a fertilizer in the Aguié province in Niger. The objective was to show the
effectiveness of urine and to develop strategic tools as well as low cost appropriate technologies for an eventual up‐
scaling within the PPILDA rural development project and other IFAD funded projects. The PS‐Aguié project was carried
out during 16 months from Nov 2008‐Feb 2010. See www.ecosanres.org/aguie for more information, fact sheets and
tools.
Sustainable Sanitation Practice 11 Issue 3 /2010
overall project:
Experiences from the use of urine in Arba
Minch, Ethiopia
Urine crop trials in Arba Minch, Ethiopia, showed the possibility for improving
soil fertility and increasing crop yield.
Authors: K. Kassa, F. Meinzinger, W. Zewdie
Abstract
In this paper an overview of practical experiences with the collection and the use of urine from urine diversion
dry toilets in Arba Minch is discussed. At two crop trial sites maize was fertilized with urine and the maize yield
and the effect on soil was studied. At one site, the yield of urine fertilized maize was increased seven times
compared to unfertilized soil. Analyses of the soil fertilized with urine showed that Kjeldahl nitrogen and
salinity was increased while pH was decreased at higher rates of urine application. Urine contains important
nutrients for the plants and increases the quality of soil; however precautions against the development of
salinity in the roots of plants are required. The urine crop trial sites have changed the attitude of many people
who had a chance to visit.
Introduction
The EU‐funded project called ROSA (Resource‐
Oriented Sanitation concepts for peri‐urban areas
in Africa) proposed resource‐oriented sanitation
concepts as a route to sustainable sanitation to
meet the UN MDGs. These concepts have been
applied in four pilot cities in Eastern Africa, namely
Arba Minch (Ethiopia), Nakuru (Kenya), Arusha
(Tanzania) and Kitgum (Uganda). Arba Minch is
located about 550 km south of Addis Ababa, the
capital of Etiopia, and has a population of about
80'000. ROSA Arba Minch was working in the
whole of Arba Minch town on the management of
solid waste, greywater, faeces and urine to Figure 1: Typical storage tank in UDDT toilet
improve sanitation of the town and to increase
agricultural productivity in the Arba Minch area.
Different resource oriented sanitation systems
have been implemented in Arba Minch town
including 15 urine‐diversion dry toilets (UDDTs), 30
Fossa alternas, 9 Arborloos, 7 greywater towers, 1
biogas unit and more than 5 composting sites.
One of the most commonly used technologies for
the source separated collection of urine are
UDDTs. Urine is diverted from faeces using
separating pedestals. Urine is a valuable flow since
it contains phosphate, nitrogen and potassium and
can be used directly or after storage. It is a low cost Figure 2: Urine storage in UDDT toilet
alternative to the application of nitrogen rich Considering the contents of the major nutrients in
mineral fertilizer in plant production. The chemical urine, research in applying urine in agriculture
composition of urine and its plant availability is especially in developing countries is needed. The
comparable to chemical fertilizer (Johansson et al. use of urine as fertilizer in arid and semi arid
2001; Kirchmann and Pettersson, 1995). regions like Arba Minch gives some knowledge
input and also may contribute to the change of the
attitude of the people and even decision makers.
The use of urine in agriculture may increase this was not sustainable. Therefore, female and
agricultural production and eventually reduce youth group has been identified which has been
vulnerability in developing countries. originally organized to collect the town solid waste
from households and business centres. These
The objective of the research conducted in Arba entrepreneurs are now transporting urine from
Minch town was to test urine as fertilizer for maize UDDT toilets to the area of use by donkey carts
on two types of soil with different fertility. The (Figure 4). The donkey cart was given by ROSA
yield of maize was used to evaluate the effect of under the condition that the entrepreneurs
urine application. The impact of urine on the transport excreta and solid waste to earn extra
quality of the soil was also investigated by income by transporting things different from
measuring parameters such as conductivity, pH waste. The UDDT users have proposed a certain
and nutrient content. The trial sites were amount of money they are willing to pay for these
furthermore used to demonstrate the use of urine services.
to farmers and other community members.
Use of urine and analyses For a hygienic point of view, human urine is a
“safe” fertilizer with less concern regarding risks
Urine separation, collection and transport in Arba for disease transmission when handling
Minch (Kvarnstrom, et. al., 2006) and it is an uncommon
transmission route of disease. In rural Ethiopia, it is
Urine is stored in plastic jerry cans or plastic water
common to urinate on fresh wounds to stop
tanks, which are available from local market, in the
bleeding. In order to reduce the risk from possible
vaults of the UDDTs. Joints of urine collecting pipes
contamination by faeces, urine is stored at the
are connected by adhesives and flexible plastic
production or reuse sites. Some families were
pipes are used to reduce nitrogen losses in the
using the fresh urine directly in their gardens.
form of ammonia. The sizes of the tanks depend on
Urine is one of the components of co‐compost
the size of the family using the UDDT. Initially, the
produced by organized youth groups; recently the
transfer of urine from the UDDTs tank into the
compost producers have started selling their
transportable jerry cans was done by pump.
products to private farmers.
However, this resulted into breakage of two
pumps, therefore, a cheap method of collection
The use of urine as a fertilizer in agriculture in
was introduced which is a plastic hose connected
Ethiopia is generally faced with some cultural
at the bottom of the urine tank and lowered to
objections, although wastewater use in agriculture
pour the urine and raised and bent to seal it
is a common practice in Addis Ababa. In Arba
(Figures 1‐2). In some occasions neighbours were
Minch reuse of urine was not practiced until ROSA
complaining and UDDT owners were also ashamed
started it in trials. There was a widespread
of the odour produced when the stored urine was
perception that urine may burn the plants. A part
transferred into transporting jerry cans. Taking this
from the burning effect, many households in Arba
as lesson urine was poured carefully from
Minch, who were interviewed in the beginning of
container to container to avoid nuisance.
the project, stated that they would be hesitant to
eat vegetables fertilized by urine. Nevertheless,
Initially, the urine used to be transported by the
urine trial farms were prepared in Arba Minch. The
ROSA project in a pick‐up car (Figure 3). However,
trial sites were successful in showing that urine
Figure 4: Donkey cart used for transporting urine,
Figure 3: Transportation by pickup car
solid waste, and dried faeces
Table 1: Urine application on the maize plant at Arba Minch University Plot (planting on 28.06.2007)
N applied (kg Urine added (ml)
Code
N/ha) 21.6.07 04.8.07 28.8.07 17.9.07 Sum
T25 25 100 50 50 38.1 238.1
T50 50 200 100 100 76.2 476.2
T75 75 300 150 150 114.3 714.3
T100 100 400 200 200 152.4 952.4
improves yield and they were also successful in The application of the urine on the farm was done
initiating an attitude change. Many people in Arba in different portions at different development
Minch have eventually consumed urine fertilized stages of the plant before the first signs of the
maize, lettuce and tomato although they knew it maize tassel and cob appearance. Operators
was fertilized by urine. applying urine in the farm were complaining of
strong smell in the direction of wind but there have
Methods been no problems with odour once the urine was
poured on the soil even at high temperatures in
Urine fertilizer trials Arba Minch.
Arba Minch University farm trial plot ROSA office farm trial plot, Secha
The urine, which was collected from UDDTs, was Two plots each with a size of 4 m2 and 16 planting
transported in 20 litre jerry cans and stored in a spots were prepared at the ROSA office site and
tank located at the farmland. Twenty plots each two maize grains were planted in each spot. Each
with a size of 16 m2 were prepared in Arba Minch spot of the first plot was treated with 1.2 litres of
University farm (Figures 5). Five application rates urine in four portions while the second plot was
of urine based on nitrogen amount were chosen watered only with water. All watering was done at
including four replicates. The application rates the same day for all plots. The amount of nitrogen
were 25kg N/ha, 50kg N/ha, 75 kg N/ha, and 100kg added in terms of urine was 175 kg/ha. Finally,
N/ha, respectively (Table 1). The yield of each plot each plant stand was analyzed for the yield and
was analyzed when the crops were mature. biomass when the crops were mature.
Physicochemical analysis
2.5 gram of soil taken from 20 cm depth were
analyzed for potassium using flame photometer
after extracting with 100 ml of ammonium acetate
buffer solution (Dewis, et al., 1970, APHA, 1992).
2.5 gram were analysed for Kjeldahl nitrogen (TKN)
after extraction (Dewis, et al.,1970, APHA, 1992).
pH and conductivity were analysed after shaking
the dispersed sample (1:5 sample: water) (Dewis,
et al.,1970). Urine was analysed for phosphate,
potassium, nitrogen, pH and conductivity according
to standard methods (APHA, 1992).
Results from crop trial plots
Figure 5: Urine application method on farm
Characteristics of urine
The application of urine was done by watering cans
The urine samples were collected from ROSA office
after mixing with 50% irrigation water. The plants
for use at the ROSA office trial plot and from
were counted in rows; the urine irrigation water
construction site UDDT toilets for use at the Arba
mixture was applied nearby the roots of the plants
Minch University trial plot as described above.
keeping the watering at the same pace. The
Table 2 shows the charcteristics of the urine from
application was done back and forth until the
the 2 sites.
mixture in the watering can was finished (Figure 5).
Table 2: Typical characteristics of nutrients in urine collected from two UDDT sites in Arba Minch (ROSA office
and construction site)
NH4+‐N N‐org TKN PO43‐‐P K+ pH Conductivity
Sample/Parameter
g/l g/l g/l g/l g/l ‐ mS/cm
Urine ROSA office 3.3 0.3 3.7 0.4 1.6 8.8 25.9
Urine construction site 3.9 0.4 4.2 0.6 2.7 8.9 35.8
Crop yields from trial sites
It was shown that there is a difference in quality Figures 6‐8 show the maize yield on Arba Minch
depending on way of storage, storage time and the university trial farm which was fertilized by urine at
differences in use of the toilets. The urine from the rate of 25, 50, 75 and 100 kg N/ha,
ROSA office was collected from office workers who respectively. Figure 7 shows the maize yield
drink water when they need and the urine from increases with increasing urine application rates.
the construction site UDDT was collected from day However, finally the increase is stabilized with the
workers who had a possibility of dehydration. increase of urine amount. The difference between
Besides, the conductivity of urine from the the yield of the fertilized and unfertilized maize
construction site was higher maybe because it was was not much compared to the results from the
stored for a number of days in open sun in a water ROSA office trial plot shown in Figure 9‐12. Figure 8
tank but the urine ROSA office was relatively fresh shows biomass of maize without the cob but the
and was stored under the shade in the vault of change is not significant. One reason for this might
UDDT. be the damage caused by wildlife before analysis.
Figure 9‐12 show the results of the ROSA office
Figure 6: Urine experiment on maize at Arba Minch Figure 9: Left: urine fertilized; right: unfertilized maize
University farm collected from ROSA office farm.
Figure 7: Maize yield (crop trial performed on Arba Figure 10: Maize yield (crop trial results of the ROSA
Minch University farm. The farm land is relatively fertile) Office demonstration farm)
Figure 8: Average of maize biomass measured without Figure 11: Weight of maize biomass (ROSA office), 175
cob cover and root (University farm) kg N/ha equivalent of urine was added.
Sustainable Sanitation Practice 15 Issue 3 /2010
Experiences from use of urine in Arba Minch, Ethiopia
trial farm where there is big difference between From these two experiments, it is possible to say
the urine fertilized and unfertilized maize most that less fertile soil has a tendency to give good
probably because of the initial lower soil fertility. yield with urine. Hence, the Ethiopian highlands,
The maize yield fertilized by urine at a rate of which are particularly suffering from nutrient
175 kg N/ha is seven times more than the depletion, are a promising region for using urine
unfertilized maize (Figure 10). The related maize and compost conditioned with urine.
biomass fertilized by urine is twice as much as the
unfertilized one (Figure 11). Impact of urine application on soil quality
Figures 13‐15 show the soil quality changes after
urine addition at the Arba Minch University trial
farm plots. The conductivity of the soil increases
with increasing urine application which means that
there is a possibility of increased salinity as more
urine is added to the soil (Figure 13). Farmers who
are going to use urine as a fertilizer must irrigate
with more irrigation water to leach the salt
accumulation in the root zone of the plants. The
dilution ratio can start from 3:1 urine to water and
above. If 1 litre of urine is added either diluted
with 25% or 75% the nutrients that are supplied to
the plat are the same. The problem arises when
concentrated urine is added salt is being
Figure 12: Control (left) and urine fertilized maize accumulated on the soil surface and not reaching
(right) at the ROSA office trial plot the plant root. Yet, when the urine is mixed with
more water the nutrient may be leached or
A comparison of the results from the two trial plots washed away before the roots absorbed it.
shows the dependence of the effect of urine on
the initial soil quality. Although the initial soil Figure 14 Kjeldahl nitrogen and potassium of soil
quality is not indicated here since it was not fertilized by urine. The amount of nitrogen slightly
sampled, the Arba Minch University trial plot is increased with addition of urine which is one of the
very rich and it was in use as a farm while the farm positive values of urine as a fertilizer. Potassium
in ROSA office is lacking nutrients and was not in variation with increasing amount of urine was
use for agriculture before. The results of Arba neglegible.
Minch University farm trial plots also showed that
the maize yield and biomass increased in response The pH of neat urine applied was about 9 (Table 2).
to the increased urine application, but at a slower The pH of soil measured after application of urine
rate at higher urine applications. Jönsson et al indicated in Figure 15 decreased with increasing
(2004) indicated that the effect of crop yield application of urine on the soil. This might be
increases with increasing fertiliser application rates described by as the fact that ammonium is nitrified
and then remains constant at higher in soil, releasing two protons and thus decreasing
concentrations. the pH. However, this might be only a temporarily
Figure 13: Conductivity of urine fertilized soil after harvesting Figure 14: Potassium (filled) and TKN concentration (clean) in
maize the soil fertilized with urine, after harvesting maize
Sustainable Sanitation Practice 16 Issue 3 /2010
Experiences from use of urine in Arba Minch, Ethiopia
Conclusions and Recommendations Jönsson, H., Stinzing, A.R., Vinneras, B., Salomon, E. (2004):
Guidelines on the use of and faeces in crop production.
Urine collection, transport, treatment and reuse is EcoSanRes Publication Series p 4.
one of the difficult step in resources‐oriented Johansson, H., Jönsson, H., Hoglund, C., Richert Stintzing, A.,
sanitation systems because the society and the Rodhe, L. (2001): Urine separation‐closing the nutrient cycle.
Stockholm water company, Stockholm, Sweden.
decision makers may not be aware of the
Available:www.stockholmvatten.se/pdf_arkiv/English/urinse
advantages. In Arba Minch the transport and p_eng.pdf.
collection of urine from UDDTs was first done by Kirchman, H., Pettersson, S. (1995): Human urine‐chemical
car but gradually entrepreneurs were involved to composition and fertilizer efficiency, Fertilizer Research 40:
independently transport by donkey cart without 149‐154.
external support. This is a good progress to Kvarnstrom, E. Emilsson, K., Stintzing, A.R., Johansson, M,
sustainability of the implemented sanitation Jönsson,H., Petersens, E., Schönning, C., Christensen, J.,
Hellstrom, D., Qvarnstrom,L., Ridderstolpe, P., Drangert, J.
systems. (2006): Urine diversion: one step towards sustainable
sanitation. Report 2006‐1, EcoSanRes publication series, p37.
Youth groups also use urine to enrich the co‐ Schönning, C. (2001) Urine diversion ‐ hygenic risks and
compost, which they produce from faeces and microbial guidelines for reuse. In: Höglund, C (2001):
organic waste. Costumers are happy to buy the Evaluation of microbial health risks associated with reuse of
source separated human urine, PhD thesis, Royal Institute of
produced compost so that the youth groups can Technology, Stockholm, Sweden. ISBN 91‐7283‐039‐5.
gain an income.
The response of maize plant for urine is very good
but it depends on whether the soil is already fertile
in terms of nutrients or not. The response is very
good in the ROSA office trial farm, while it is
smaller at the University trial farm, where the soil
had already a relatively high initial fertility. Name: Kinfe Kassa
Organisation: ROSA, Arba Minch University
Urine increases soil fertility but the development Town, Country: Arba Minch, Ethiopia
of soil salinity might happen especially in areas e‐mail: kinfe_k@yahoo.com
where irrigation water is scarce. Therefore,
appropriate measures such as drainage might need Name: Franziska Meinzinger
to be taken and salt tolerant crops should be Organisation: ROSA, TU Hamburg‐Harburg,
selected. Town, Country: Hamburg, Germany
In order to make urine accepted by the Ethiopian
farmers widely repeated research and Name: Wubshet Zewdie
demonstration should be done in different agro‐ Organisation: ROSA, Arba Minch University
Town, Country: Arba Minch, Ethiopia
Sustainable Sanitation Practice 17 Issue 3 /2010
implementing
organisation:
Are pharmaceutical residues in urine a
constraint for using urine as a fertiliser?
This paper provides an overview about pharmaceutical residues in urine and
their potential role as constraint for reuse of the urine in agriculture.
Author: M. Winker
Abstract
Urine is an excellent, complete plant fertiliser (containing nitrogen, phosphorus and potassium), but also
contains certain amounts of pharmaceutical residues even after prolonged storage as a treatment step. If those
substances are polar and hardly biodegradable they can be taken up by plants and thereby possibly enter the
human food chain. Research has shown that the low pharmaceutical concentrations provided with urine are
unlikely to affect plant development and growth. A full evaluation of the potential toxic effects of
pharmaceuticals ingested by humans via urine‐fertilised crops is very difficult and has not yet been done.
Perceptions of societies towards urine reuse vary widely and can work as a driver or a constraint for reuse.
pharmaceutical residues to agricultural fields
Introduction (Lienert et al., 2007a; Winker et al., 2008b). Only
recently the fate of pharmaceuticals regarding
Urine can be used as an alternative fertiliser for
their accumulation in soils, transfer to
agriculture. It contains large amounts of nutrients
groundwater, and incorporation by plants came
such as 80% of nitrogen, 50% of phosphorus, and
into the focus of research. However, these effects
70% of potassium usually present in domestic
cannot be excluded as fairly high concentrations of
wastewater as well as various micronutrients (Ciba
pharmaceuticals are expected in urine (Winker et
Geigy AG, 1977; Larsen and Gujer, 1996; Otterpohl,
al., 2008b).
2002; von Münch and Winker, 2009). But this
usage of urine includes the risk of transfer of
The urine normally ends up in the domestic
Key message:
Pharmaceutical residues are contained in urine but only in few investigations concentrations have been
measured so far. Predicted (German) concentrations were in the range of 0.1 to 103 μg/l of urine and
determined for 124 substances.
Data from literature show that plants are generally able to take up pharmaceuticals. Concentrations in plant
parts detected were very low (in the range of ng/kg) even though plants were exposed to high concentrations
(mg/kg soil). Nevertheless, pharmaceuticals were also found in edible plant parts.
Pharmaceuticals can also cause phytotoxic effects in dependence of the applied pharmaceutical concentration.
Also here, it has to be mentioned that high concentrations were applied.
Overall, different plant species have dissimilar sensitivity levels towards the same pharmaceutical as studies
have shown. Unfortunately, it is impossible to extend these conclusions to long term effects in general.
Exposure of rye grass to pharmaceuticals contained in urine at expected “natural” levels as well as at higher
concentrations did not affect dry matter production during the growth period of three months either for single
pharmaceuticals, or for the combination of carbamazepine, ibuprofen, and 17α‐ethinylestradiol.
Only carbamazepine was shown to be taken up by roots and aerial plant parts of rye grass. The concentrations
in aerial rye grass parts were in the mean 4950 μg/kg DM (dry matter), and in roots 225 μg/kg DM. This leads to
the assumption that only pharmaceuticals which are persistent in soil and not biodegraded are transferred to
plants in measureable concentrations.
Potential effect of pharmaceutical substances contained in urine towards plants cannot be determined in
germination experiments. The urine matrix itself is much more affecting the seedlings due to its specific matrix
than the active agents.
Farmers and consumers are open to urine as fertiliser, although they are aware of the aspect of pharmaceutical
appearance. The perception varies not only among the stakeholder groups but also between countries.
“av” determined average of the collected data (for details see Lienert et al., 2007a); “SD” stands for standard deviation;
“N” stands for sample size.
Table 4. Influence on dry weight of the seedlings by addition of one active agent. “>” indicates that the
limiting concentration causing an effect was not reached and lies most likely above the tested level (Winker
et al., 2010b).
Substance Cress Winter wheat Winter rye* Winter barley Oat
>1.000.000
EE2 > 1000 fold >1000 fold >1000 fold > 1000 fold
fold
E2 >10.000 fold > 1000 fold >1000 fold > 1000 fold > 1000 fold
CZ >10.000 fold > 1000 fold AGU conc. >1000 fold > 1000 fold
10 fold 1000 fold
PI > 1000 fold >1000 fold > 1000 fold
‐ better ‐ worse
1000 fold
IBU >1000 fold > 1000 fold > 1000 fold > 1000 fold
‐ better
* “worse”: the concentration let to a negative effect of the dry weight; “better”: the concentration let to a statistically
relevant increase of the dry weight.
Table 5. The 8 datasets reporting concentration similar to those in the case of urine fertilisation (DS/AGU ratio
<200) which showed phytotoxic or bioaccumulative effects (Winker, 2009).
Concentration Ratio
Substance Plant species Reported impacts1 Ref.
applied DS/AGU2
Phytotoxic: negative impact on w, h, r,
Chloroquine soybean 8000 ng/kg 182 Jjemba, 2002
s, l (13 d after germination)
Phytotoxic: positive impact on h, r
Chlorotetracycline spring wheat 160 ng/kg 82 Batchelder, 1982
(27 d after germination)
Phytotoxic: negative impact on w, h, r,
Chlorotetracycline pinto bean 160 ng/kg 82 Batchelder, 1982
s, l (45 d after germination)
Uptake: 0.013 ng/kg FW in s and l Kumar et al.,
Chlorotetracycline green onion 100 ng/kg 51
(42 d after transplantation) 2005
Uptake: 0.01 ng/kg FW in s and l (42 d Kumar et al.,
Chlorotetracycline cabbage 100 ng/kg 51
after transplantation) 2005
Phytotoxic: negative impact on w, h, r,
Metronidazole soybean 2000 ng/kg DM 67 Jjemba, 2002
s, l (13 d after germination)
Phytotoxic: positive impact on h, r
Oxytetracycline spring wheat 160 ng/kg 2 Batchelder, 1982
(27 d after germination)
Phytotoxic: negative impact on w, h, r,
Oxytetracycline pinto bean 160 ng/kg 2 Batchelder, 1982
s, l (45 d after germination)
1
Letters denote weight (w), height (h), roots (r), stalk (s), and leaves (l).
2
"Ratio DS/AGU" describes the concentration applied in the specific investigation summarised in one dataset (DS) related
to the pharmaceutical concentration calculated to be reached in case of urine application. DS/AGU = 1 describes equal
conditions, <1/>1 implies that lower/higher concentrations would be applied by a fertilisation with urine under the
described conditions. (March 16, 2008).
Sinar (2008) showed that apart from appearance of Brian, P., Wright, J., Stubbs, J., Way, A. (1951): Uptake of
antibiotic metabolites of soil microorganisms by plants.
pharmaceutical residues in urine, it is important to
Nature, 167(4244), 347‐349.
investigate a societies’ attitude on pharmaceutical
Butzen, A., Werres, F., Balsaa, P. (2005): Aufbau und Einsatz
consumption and that a difference between rural einer problemorientierten Analytik mit dem Ziel eines
and urban areas might exist. In Ghana, the Monitorings ausgewählter Pharmaka in Böden und Urin.
frequently used pharmaceutical groups (often Bonner Agrikulturchemische Reihe, 21, 25‐54.
referred to as indications) are antimalarials, Ciba Geigy AG (1977): Teilband Körperflüssigkeiten. In: Lentner,
antibiotics, analgesics, antifungals and C. (editor), Wissenschaftliche Tabellen Geigy, 8th edition,
CIBA‐GEIGY AG, Basel, Switzerland, pp. 51‐97.
antihelminthics; in urban areas pharmaceuticals
Dolliver, H., Kumar, K., Gupta, S. (2007): Sulfamethazine uptake
addressing diabetes and cardiovascular diseases by plants from manure‐amended soil. J Environ Qual, 36(4),
are also consumed (Sinar, 2008). While in Ghana, 1224‐1230.
consumption of contraceptives is negligible, they Gajurel, D. (2007): Investigation of elimination of selected
most likely play a major role in Peru. 17α‐ pharmaceuticals in urine during storage, by UV irradiation
ethinylestradiol is available for all women for free and by ozonsation (in German), report, DFG‐
Förderkennzeichen: GA 1063/2‐1, Institute of Wastewater
and very popular (Webb and Fernández Baca,
Management and Water Protection, Hamburg University of
2006) as a result of the family planning below Technology, Hamburg, Germany. URL: http://www.tu‐
president Fujimori. harburg.de/aww/forschung/pdf/endbericht_dfg01.pdf
Grote, M., Freitag, M., Betsche, T. (2004): Antiinfektivaeinträge
aus der Tierproduktion in terrestrische und aquatische
Conclusion Kompartimente, Ministerium für Umwelt und
If urine is reused in agriculture, some of the Naturschutz,L.u.V.d.L.N.‐W., Germany.
pharmaceutical residues will be taken up by plants Jacobsen, A., Halling‐Sørensen, B., Ingerslev, F., Hansen, S.
and thereby enter the human food chain. This is (2004): Simultaneous extraction of tetracycline, macrolide
and sulfonamide antibiotics from agricultural soils using
expected especially for polar and hardly pressurised liquid excretion, followed by solid‐phase
biodegradable substances. A full evaluation of the extraction and liquid chromatography‐tandem mass
potential toxic effects of pharmaceuticals ingested spectrometry. J Chromatogr, 1038(1‐2), 157‐170.
by humans via urine‐fertilised crops is very difficult Jjemba, P. (2002): The effect of chloroquine, quinacrine, and
and has not yet been done. metronidazole on both soybean plants and soil microbiota.
Chemosphere, 46(7), 1019‐1025.
Moreover, research carried out so far shows that Komoßa, D., Langebartels, C., Sandermann, H. (1995): Metabolic
processes for organic chemicals in plants. In: Trapp, S. and
the expected concentrations of pharmaceutical Mc Farlane, J. (editors): Plant contamination, Lewis
residues in average urine do not reach Publishers, Boca Raton, Florida, USA, pp. 69‐103.
concentration levels which affect plant growth and Kumar, K., Gupta, S., Chander, Y., Singh, A. (2005): Antibiotic use
development. This finding can be supported by the in agriculture and its impact on the terrestrial environment.
fact that the load of hormones and antibiotics in Adv Agron, 87, 1‐54.
human urine are much lower than in animal Larsen, T., Gujer, W. (1996): Separate management of
anthropogenic nutrient solutions (human urine). Water Sci
manure which is already used in agriculture. Technol, 34(3‐4), 87‐94.
Lienert, J., Bürki, T., Escher, B. (2007a): Reducing
Overall, it can be concluded with the statement of micropollutants with source control: substance flow analysis
Jörn Germer (cited in von Münch and Winker of 212 pharmaceuticals in feces and urine. Water Sci Technol,
(2009)) that “Drug residues in sustainable 56(5), 87‐96.
sanitation products used to supply plant nutrients Lienert, J., Güdel, K., Escher, B. (2007b): Screening method for
ecotoxicological hazard assessment of 42 pharmaceuticals
can hardly be a serious issue in regions where
considering human metabolism and excretory routes.
malnutrition, groundwater and surface water Environ Sci Technol, 41(12), 4471‐4478.
pollution due to inappropriate sanitation and Lienert, J., Haller, M., Berner, A., Stauffacher, M., Larsen, T.
irrigation with untreated wastewater is a reality”. (2003): How farmers in Switzerland perceive fertilizers from
recycled anthropogenic nutrients (urine). Water Sci Technol,
48(1), 47‐56.
References Mauer, M., Pronk, W., Larson, T. (2006): Treatment processes
Batchelder, A. (1982): Chlortetracyline and oxytetracycline for source‐separated urine. Water Res, 40(17), 3151‐3166.
effects on plant growth and development in soil systems. J Muskolus, A. (2008): Anthropogenic plant nutrients as fertiliser,
Environ Qual, 11(4), 675‐678. PhD thesis, Institut für Pflanzenbauwissenschaften,
Blume, S., Winker, M. (2010): Three years of operation of the Humboldt‐Universität zu Berlin, Berlin, Germany. URL:
urine‐diversion system in GTZ headquaters in Germany; user http://edoc.hu‐berlin.de/dissertationen/muskolus‐andreas‐
opinions and maintenance challanges. In: IWA Conference on 2008‐04‐18/PDF/muskolus.pdf
Sustainable solutions for small water and waterwater Otterpohl, R. (2002): Options for alternative types of sewerage
treatment systems, 19‐22 April 2010, Girona, Spain. and treatment systems directed to improvement of the
Boxall, A., Johnson, A., Smith, E., Sinclair, C., Stutt, E., Levy, L. overall performance. Water Sci Technol, 45(3), 149‐158.
(2006): Uptake of veterinary medicines from soils into plants. Patten, D., Wolf, D., Kunkle, W., Douglass, L. (1980): Effect of
J Agric Food Chem, 54(6), 2288‐2297. antibiotics in beef cattle feces on nitrogen and carbon
Backyard Urine Recycling in the United
States of America: An Assessment of
Methods and Motivations
This paper discusses the newly emerging urine harvesting movement in the
United States of America.
Authors: L. Allen, J. Conant
Abstract
In the United States of America awareness and practice of ecological sanitation is in its infancy. In this article
we briefly assess the urine harvesting practices of a small group of individuals in the San Francisco Bay Area,
California, Portland, Oregon, and coastal Massachusetts. Though there are no coordinated or sponsored urine
harvesting projects, a few Americans, learning primarily from the international urine harvesting community, as
well as from historic practices, are beginning to implement individual‐scale, “backyard” urine harvesting
projects. We found that urine reuse is gaining in popularity, is accepted in certain social groups, and that urine
harvesters have seen exceptionally beneficial results from using the urine fertilizer. Urine harvesting seems a
good first step towards ecological sanitation practices because it is legal in the United States, whereas other
practices are not. Some U.S. regulations are now changing around ecological sanitation practices, which bodes
well for a trend toward greater acceptance of urine recycling and other ecological sanitation practices.
harvesting projects. We believe there is similar
Introduction interest and practice of urine harvesting in other
parts of the USA as well.
In the United States of America, despite advanced
technology, high levels of education, and growing
The USA have a long history of composting toilet
concern about environmental sustainability,
use, mainly in rural areas that do not have sewer
awareness and practice of ecological sanitation is
or septic systems. Traditionally, American
in its infancy. In this article we briefly assess
composting toilets have not separated urine. All
residential‐scale ecological sanitation practices in
manufactured American composting toilets today
the USA by focusing on the urine harvesting
combine urine, except one, "Nature's Head", which
practices of a small but active, and representative,
is designed for use on boats and has only been
group of individuals in the San Francisco Bay Area,
available since 2007 (Nature's Head, 2010). The
California, Oregon, and Massachusetts.
most popular book on the subject, The Humanure
Handbook, by Joseph Jenkins (Jenkins, 2005; first
Urine harvesting practices in the USA are growing
edition 1994, now in its 3rd edition), advocates
from the grassroots level. Though there are no
combined sources, though most rural compost
coordinated or sponsored urine harvesting
toilet users encourage people to "pee outside" and
projects, a few Americans, learning primarily from
not in the toilet. There is only one book about urine
the international urine harvesting community, as
harvesting from the USA (Steinfeld, 2004) which
well as from historic practices, are beginning to
includes information on the global urine harvesting
implement individual‐scale, “backyard" urine
Key messages:
Urine reuse is practiced in the United States of America even though there are no coordinated projects
Urine is socially accepted in certain social groups
Urine recycling is gaining popularity
Regulations are changing around sustainable sanitation practices
Urine recycling is legal, contrary to popular belief
International information on urine recycling could spur growth of USA's urine adoption
discharge depth, and waiving permit requirements Motivation
for very simple systems from washing machines.
Nine urine recyclers were interviewed during
Since 2001, beginning with the state of Arizona,
January and March, 2010. Since there are no
drought‐affected states like Arizona, Texas, and
sanctioned urine recycling projects in the USA,
New Mexico have revised grey water standards,
the authors found the participants through
and wetter states such as Oregon are revising
networks of environmental organizations. The
standards to allow for legal rainwater reuse. In
participants had a diverse range of occupations: a
addition, composting toilet use has been on the
director of a small ecological justice non‐profit
rise for many years (While there is a lack of
organization, an "eco‐artist" and dog border, an
quantified growth trends, reports in the media
architect specializing in green design, a gardener
affirm the growth in use and interest in compost
and public park employee, a supervisor in a
toilets: see
construction company, an ecological designer, a
http://www.treehugger.com/files/2009/07/compo
medical program manager, a small businessman,
sting‐toilets‐us‐cities.php, and http://www.carol‐
and a statistician.
steinfeld.com/compostingtoilets.html though the
regulations around it in most states remain
The nine individuals surveyed range between 27
prohibitive at worst, and unclear at best.
and 60 years of age; live in cities of the
metropolitan Bay Area: Oakland, Berkeley, and
Given California’s history as a region of “early
San Francisco, or in Portland, Oregon, and coastal
adopters” and cultural visionaries, it is not
Massachusetts. Five of the nine own their
surprising that a fledgling ecological sanitation
homes, while four are renters. The average
movement should emerge here. It is also timely at
period they have practiced urine recycling is
the current moment, as California has been in
around two years, though one individual has
drought for three consecutive years. According to
maintained the practice over a period of twelve
the California Drought Center the last two water
years. All nine survey participants voluntarily
years have resulted in 63 and 72 percent of
practice other forms of residential‐scale
average annual precipitation (CA Department of
ecological resource stewardship, including
Water Resources, 2009).
recycling and composting, both locally common
practices. Most are innovators in other ways:
The change in state regulations on greywater
seven of the nine practice some form of
reflects a growing awareness of the need for
unregulated grey water reuse, while two of the
increasing water efficiency practices, while the
nine collect and channel some portion of the
practices of individual urine‐recyclers reflect a
rainwater on their property (also an
growing desire for more progressive
unsanctioned and unregulated practice).
environmental policies. Urine harvesting is an easy
first step for individuals concerned about reducing
Given the propensity of this group to engage in
water use and restoring natural cycles.
ecological practices, it is not surprising that their
The law presents a major barrier in the USA to
adoption of many ecological practices. Many
sustainable practices, like greywater, rainwater,
and composting toilets, are illegal under local and
state building regulations. Because of this, early
adopters of ecological practices in the United
States are often breaking local or state laws.
Though most do so without consequence, there is
a history of a few "pioneers" being fined, losing
property, and being forced to remove the
unpermitted projects (Kettmanm, 2009).
Organizations are hesitant to attempt projects that
break local laws, thus further slowing the progress
of ecological sanitation implementation in the U.S.
Residential urine harvesting falls outside of existing
laws; with increasing knowledge about its benefits,
and legality, more users will be able to implement
the practice without fear of legal consequence. Figure 2: This "Pee‐pee‐ponics" system uses urine
to water Figure and fertilize plants. Credit: Nik
Bertulis
greater acceptance of urine recycling and other IAPMO, (2007): California Plumbing Code (2007): Chapter 29
Plumbing Systems, IAPMO, Ontario, CA, p 410
ecological sanitation practices. Given that concerns
among our respondents to issues of social Jenkins, J., (2005): The Humanure Handbook, 3rd Edition,
Joseph Jenkins, Grove City, PA.
acceptance appear to weigh more heavily than
Josson, H., Richert Stintzing, A., Vinneras, B., and Salomon, E.
technological or infrastructure challenges and (2004) Guildelines on the use of urine and faeces in crop
those empirical benefits are readily apparent, it production, EcoSanRes Publications Series, Report 2004‐2,
appears almost certain that more progressive Sweden.
regulatory frameworks will lead inevitably to wider Kettmanm, M. (2009): Getting Grief for Going Green, The Santa
cultural acceptance of ecological sanitation in the Barbara Independent, Sep. 10th, 2009
United States. Larsen, T., Peters, I., Alder, A., Eggen, R., Maurer, M., and
Muncke, J. (2001): Re‐engineering the toilet for sustainable
wastewater management. Environ Science Technology May
The increased exposure and awareness of global 1, 2001 / Volume 35 , Issue 9 / pp 192 A – 197 A. T.
ecological sanitation practices, including urine Nature's Head (2010): Composting Toilets for Marine, RV,
harvesting, will help promote increasing ecological Cabins, and Trucks. A Nature's Head Composting Toilet,
sanitation practices in the United States. http://www.natureshead.net/store/index.phpmain_page=pr
oduct_info&products_id=1 (date of visit: 3 February, 2010).
Pryne, E. (2010): Rain, even urine, would help make Bullitt HQ
city's 'greenest building ever', Eric Pryne, March 15th, 2010,
Recommendations The Seattle Times.
There is a lack of studies and projects on urine SEI, (2004) SEI EETP Office, 2004, China – Sweden Erdos Eco‐
Town Project Document, Erdos, Inner Mongolia, China
recycling in the United States. We believe there
should be U.S.‐focused studies and organized urine Steinfeld, C. (2004): Liquid Gold: The Lore and Logic of Using
Urine to Grow Plants, Carol Steinfeld, Sheffield, Vermont.
recycling projects.
WHO, (2006): Guidelines for the Safe Use of Wastewater,
Americans can be socially accepting of urine use. Excreta and Greywater. Volume 4: Excreta and greywater use
Urine harvesting is a good first step toward in agriculture. World Health Organization, Geneva,
Switzerland.
ecological sanitation practices.
Wilsenach, J., and Van Loosdrecht, M., (2006): Integration of
Increased knowledge that urine harvesting is Processes to Treat Wastewater and Source‐Separated Urine‐
legal in the USA can increase numbers of Journal of Environmental Engineering, vol 132, p 331
adopters of the practice.
Increased exposure of the international
ecological sanitation practices can positively
affect practices in the USA.
References
Allen, L. (2010): Phone conversation with staff at Berkeley
Environmental Health Division and Alameda County
Environmental Health division on Jan 28th, 2010 by Laura
Allen.
Boggs, B., King, R., and Botte, G. (2009): Urea electrolysis: direct
hydrogen production from urine‐ Chem. Commun., 2009,
4859 ‐ 4861, DOI: 10.1039/b905974a
CA Department of Water Resources (2009): California's Drought
Update Sep. 30th 2009. Retrieved from
http://www.water.ca.gov/drought/ on 1 February, 2010.
Esrey, S. et al. (1998): Ecological Sanitation. Esrey, S. Gough, J.,
Rapaport, D., Sawyer, R., Simpson‐Hebert, M., Vargas, J.,
Winblad, U., Swedish International Cooperative
Development Agency, Stockholm, Sweden.
Esrey, S. et al. (2001): Closing the Loop: Ecological Saniation for
Food Security. Esrey, S., Anderson, I., Hillers, A., and Sawyer,
R., Swedish International Cooperative Development Agency,
Mexico. Name: Laura Allen
GTZ (2005): "Urine separation and reuse project at the main Organisation: Greywater Action
building of GTZ GmbH”. – data sheets for ecosan projects Town, Country: Oakland, California; USA
016. Syahril, Sonny, Räth, Nicola, Klingel, Florian; Werner, e‐mail: laura@greywateraction.org
Christine and Bracken, Patrick, ecosan sector project,
Gesellschaft für Technische Zusammenarbeit (GTZ) GmbH,
Eschborn, Germany , digitally available at: Name: Jeff Conant
http://www.gtz.de/de/dokumente/en‐ecosan‐pds‐016‐ Organisation: Greywater Action
germany‐gtz‐eschborn‐2005.pdf Town, Country: Oakland, California; USA
e‐mail: jeff.otherworlds@gmail.com
Food Security and Productive Sanitation;
Practical guideline on the use of urine in crop
production
This paper describes an upcoming publication containing a practical guideline
on the use of urine in crop production.
Authors: A. Richert, R. Gensch, H. Jönsson, L. Dagerskog, T. Stenström, M. Bonzi
Abstract
The publication “Practical Guideline on the Use of Urine in Crop Production”, is a collaborative effort of several
international organisations and institutions active in the field of sustainable sanitation and agriculture under
the aegis of the Sustainable Sanitation Alliance (SuSanA) working group on Food Security and Productive
Sanitation with Stockholm Environment Institute (SEI) as the lead. It will be launched during 2010.
The Guideline is directed towards decision makers, professionals and extension workers in the sectors of
agriculture, water & sanitation, planning and environment as well as the donor community. The main target
group is professionals in the sector of agriculture. The text gives practical guidance on the use of urine in crop
production as a vital component of sustainable crop production and sanitation systems. It covers key aspects of
how to use urine as a fertiliser in productive sanitation systems and also includes guidance on how to initiate
activities that will facilitate the introduction of new fertilisers to the agricultural community. The handbook
should help in establishing links between research and professionals interested in implementation of
sustainable sanitation systems. It is easy to read and informative, with examples from case studies and tips on
further reading for those interested.
different regions reflect differences in the
Use of urine in crop production uptake of the consumed crops and thus in the
plant nutrient supply needed for maintained
Consumed plant nutrients leave the human body
crop fertility in the region. Irrespective of the
with excreta, and once the body is fully grown
amounts and concentrations of plant nutrients
there is a mass balance between consumption and
in the excreta, one important fertilising
excretion. This has three important implications:
recommendation is thus to strive to distribute
1. The amount of excreted plant nutrients can be the excreta fertilisers on an area equal to that
calculated from the food intake, for which used for producing the food.
data is better and more easily available than
for excreta. Source separation and safe handling of nutrients
2. If all excreta and biowaste, as well as animal from the toilet systems is one way to facilitate the
manure and crop residues, is recycled, then recirculation and use of excreta in crop production.
the fertility of the arable land can be Urine contains most of the macronutrients as well
maintained, as the recycled products contain as smaller fractions of the micronutrients excreted
the same amounts of plant nutrients as were by human beings. Nitrogen, phosphorus,
taken up by the crops. potassium and sulphur as well as micronutrients
3. Differences in composition of excreta between are all found in urine in plant available forms. Urine
Key massages:
Urine used as a fertiliser can help in the mitigation of poverty and malnutrition, and improve the trade balance
of countries importing chemical fertilisers.
Food security can be increased with a fertiliser that is available free for all.
Safe handling of urine including treatment and sanitisation before use is a key component of sustainable
sanitation as well as sustainable crop production.
The "Practical Guideline on Use of Urine in Crop Production" will be published during 2010 and will be available
from the EcoSanRes and SuSanA webpages, i.e. www.ecosanres.org and www.susana.org, respectively.
Figure 2. Barrier concept for safe use of urine as a fertiliser.
Very important in dissemination and up‐scaling of
the use of urine as a fertiliser are participatory
local demonstrations involving all parties. Urine as
a fertiliser needs to be introduced in the same way
as any new fertiliser to the agricultural community.
Logistics for handling of urine are discussed in the
guidelines and examples are given for large and
small scale handling of urine. The logistics are a
challenge and there are environmental as well as
practical and economical implications of
transporting urine if there is no reuse possible on
site. However, as is pointed out in the text, local
reuse is often possible and urban agriculture
provides possibilities for recycling of human
excreta.
Although there is a wealth of location specific
Name: Anna Richert
information in this guideline, every location is
Organisation: Stockholm Environment Institute
unique and further translation and adaptation of
Country: Sweden
the guidelines is required. The last chapter of the
e‐mail: anna@richert.se
guideline gives recommendations on how local
guidelines can be developed and reasonably Name: Robert Gensch
structured. Existing local guidelines from Burkina Organisation: Xavier University
Faso and the Philippines are provided as an annex. Country: Philippines
Name: Håkan Jönsson
References Organisation: Stockholm Environment Institute
Dagerskog, L., Bonzi, M, (2010): Opening minds and closing Town, Country: Sweden
loops – productive sanitation initiatives in Burkina Faso and
Niger. Sustainable Sanitation Practice 3, pp.4‐11. Name: Linus Dagerskog
WHO (2006): Guidelines for the safe use of wastwater, excreta Organisation: CREPA HQ
and greywater; Volume 4: Excreta and greywater use in Town, Country: Burkina Faso
agriculture. World Health Organisation, Geneva, Switzerland.
http://www.who.int/water_sanitation_health/wastewater/g Name: Thor‐Axel Stenström
suweg4/en/index.html, pp.295‐306.
Organisation: Stockholm Environment Institute
Reinoso R., Torresa L.A., Bécares E. (2008): Efficiency of natural
Town, Country: Sweden
systems for removal of bacteria and pathogenic parasites
from wastewater. Science of the Total Environment 395, 80‐
86.
Name: Moussa Bonzi
Organisation: CREPA HQ
Town, Country: Burkina Faso
Sustainable Sanitation Practice 33 Issue 3 /2010
Stockholm Environment
Stockholm Environment Institute,
Institute, EcoSanRes
EcoSanRes Series,
Series, 2010-1
2009-1
(1)
Stockholm Environment Institute
(2)
Sustainable Sanitation Center, Xavier University, Philippines; CIM; lead of SuSanA
working group 5
(3)
Centre for Low Cost Water Supply and Sanitation (CREPA)
(4)
Deutsche Gesellschaft für Technische Zusammenarbeit (GTZ)
(5)
Hamburg University of Technology
(6)
Women in Europe for a Common Future (WECF)
(7)
International Water Management Institute (IWMI)
(8)
Society for Urban Development in East Africa (Sudea)
(9)
Aquamor
EcoSanRes Programme
Stockholm Environment Institute
Kräftriket 2B
106 91 Stockholm
Sweden
ISBN 978-91-86125-21-9
Contents
Foreword vii
Executive summary ix
PART I · General information and recommendations for the use of urine in crop
production 1
Application strategies 15
Application time 15
Application rate 16
Storage techniques 18
Storage in soil 20
Application techniques 20
Odour when using urine as a fertilizer 22
Combined application of urine and organic fertilizers 22
Gender aspects 33
Guideline for application of sanitized urine (Takin Ruwa) in the agricultural conditions
of Niger 46
Excerpts from the guideline 47
References 52
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Foreword
1 http://www.susana.org/
vii
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Reading instructions
The guideline is divided into three major parts: It is the intention of the authors that this guide should be
used as a general resource book and as a support tool for
PART 1 of the guidelines gives general information and the development of local guidelines on the use of urine
recommendations on the use of urine in crop production in crop production. At the beginning of key chapters of
including information on urine composition, value Part 1 there is a short box headed “practical guidance”
and use in crop production, health risk management with practical tips indicating what is most important,
based on World Health Organization (WHO) and what could be included in a simplified guideline. If
recommendations as well as institutional aspects and time for reading the entire guideline is a constraint, it is
knowledge development for the implementation of recommended to focus on the executive summary and
urine use in crop production on local level. The first part the boxes introducing each chapter and then proceed to
acts as a generic resource base related to the use of urine Part II on how to develop local guidelines.
in agricultural production.
viii
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Executive summary
Table 1: Yield of vegetables as an average of three years of field trials in Burkina Faso.
Source: CREPA
Egg plant Gombo Tomato
(t ha-1) (t ha-1) (t ha-1)
Urine (b) and mineral fertilizer (b) gave a statistically significant yield increase compared to unfertilized control (a). However, there is no
statistical difference between yields using urine (b) or mineral fertilizer (b)
ix
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Figure I: The yield and size of vegetables improves with urine use.
Photo: CREPA, Burkina Faso, Dr Moussa Bonzi
100 kg N/ha. Urine should be handled in closed tanks An example from Niger shows that the annual amount
and containers and should be spread directly onto the of plant nutrients in the excreta (urine + faeces) from
soil, not on the plant, in N-doses equivalent to what is one family is roughly equal to the quantity in one 50
recommended for urea and ammonium fertilizers. In the kg bag of urea and one 50 kg bag of NPK, see figure 2.
small scale, plastic watering cans are suitable for spreading The majority of these nutrients are in the urine, which
the urine, while in larger scale, spreaders for animal is relatively easy to collect.
slurry are suitable. Air contact should be minimized in
order to avoid ammonia losses and the urine should be Health risks associated with the use of human urine in
incorporated into the soil as quickly as possible. plant production are generally low. Source separation
of urine is a strong barrier against pathogen
The economical value of the urine can be calculated transmission since most pathogens are excreted
by comparing with the price of mineral fertilizer on the with faecal matter. The amount of faecal cross-
local market or by calculating the value of the increased contamination is directly related to the health risk in
yield of the fertilized crop. In Burkina Faso the value of the system for urine use in crop production. Collection
a 20 l jerrycan of urine can be estimated to 25 US cents. systems for urine should be designed to minimize the
A person produces around 500 litres of urine per year risk of faecal cross-contamination. Groups that are
corresponding to ~ 6-7 dollars. Including the nutient potentially at risk are mainly collection personnel
value of faeces the annual value reaches approximately and field workers, groups that come in direct contact
10 $US. However the increased maize yield from using with the excreta. Other categories where risks
this amount of fertilizer is estimated to 50 $US.
x
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Figure 2: The annual amount of nutrients in excreta from one family in Niger is equal to nutrients
in the two bags of fertilizers. Photo: Linus Dagerskog, CREPA/SEI
exist, however diminished, are households, local agricultural land at levels corresponding to the plants
communities and product consumers. needs.
Urine is a high quality fertilizer with low levels of heavy The World Health Organization (WHO) guidelines
metals. Regarding hormones and pharmaceuticals for safe use of excreta in agriculture (2006) promote a
excreted with urine, the risk of negative effects to flexible multi-barrier approach for managing the health
plants or human beings is low if urine is spread on risks associated with the use of excreta. This concept
xi
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
comprises a series of measures/barriers from ‘toilet to • Organize an arena for feed-back and interaction
table’. Each of the barriers has a potential to reduce between stakeholders.
health risks associated with the excreta use and it is
recommended by WHO to put in place several of these • Organize local communities so that there is a
barriers, if needed, in order to reduce the health risk to structure for implementation and a structure for
an acceptable minimum, see figure 3. monitoring.
Barriers include, for example, storage, crop restrictions, Dissemination and knowledge development on urine as
withholding periods and reduced contact, correct a fertilizer is best gained through local demonstration
handling and cooking of the food crop. The text gives experiments involving organizations that work with
examples of how urine can be handled in a safe way in small scale farmers and local communities as well
order to minimize risk of pathogen transmission based as local research organizations. The new fertilizer
on the WHO Guidelines for safe use of excreta in crop should be introduced with the same methodology as
production. when introducing any new fertilizer in the agricultural
community.
Institutional aspects are increasingly important as
productive sanitation systems become mainstream. In order to be implementable in a local context there
A challenge is to integrate use of excreta in existing is often an additional need to further translate or adapt
regulatory frameworks. Initially, the following activities the wealth of information given in this text to the
are suggested when productive sanitation systems are respective local site conditions. Part two of the book
implemented: gives recommendations on how local guidelines can be
developed and structured and it summarizes the most
• Identify stakeholders and clarify drivers and important factors that directly or indirectly influence
restrictions for each one in relation to the farming activities related to urine use. It is complemented
implementation of urine use in crop production. by an example of an existing local guideline from Niger
that is annexed to the publication.
• Include and target the farmers in the initial planning.
xii
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
greywater in agriculture and aquaculture. Urine contains significant quantities of the main macro
nutrients required by plants; nitrogen (N), phosphorus
Consumed plant nutrients leave the human body with (P) and potassium (K). Nitrogen occurs in high
excreta, and once the body is fully grown there is a concentration (mostly as urea), whereas phosphates
mass balance between consumption and excretion, see and potassium occur in comparatively lower
figure in box 1. This has three important implications: concentrations, in dissolved plant available forms.
The amount of excreted plant nutrients can be calculated Urine used directly or after storage is a high quality,
from the food intake, for which the data are better and low cost alternative to the application of N-rich
more easily available than for excreta. mineral fertilizer in plant production. The nutrients
in urine are in ionic form and their plant-availability
If all excreta and biowaste, as well as animal manure compares well with chemical fertilizer (Johansson et
and crop residues, is recycled, then the fertility of the al., 2001; Kirchmann and Pettersson, 1995; Simons
arable land can be maintained, as the recycled products and Clemens 2004). Urine also contains large amounts
contain the same amounts of plant nutrients as were of phosphorus, potassium, sulphur and micronutrients,
taken up by the crops. but due to its high content of N, its P/N and K/N ratios
are lower than in many mineral fertilizers used for
Differences in composition of excreta between different crop production, and lower than what many crops need
regions reflect differences in the uptake of consumed according to fertilizer recommendations.
crops and thus in the plant nutrient supply needed for
maintaining crop fertility in the region. An advantage of urine in comparison with organic
fertilizers is that the phosphorus exists in forms
Irrespective of the amounts and concentrations of that are plant-available. This means that urine is
plant nutrients in excreta, one important fertilizing quite efficient as a phosphorus fertilizer, which has
recommendation is to strive to distribute the excreta implications for the future with regard to the concept
fertilizers on an area equal to that used for growing the of Peak Phosphorus and the fact that phosphorus is a
crop. finite resource.
1
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Table 2: Proposed default values for excreted mass and nutrients. Vinnerås et al., 2006
Blackwater
Parameter Unit Urine Faeces Toilet paper
(urine+faeces)
Since it is quite difficult to analyze human urine P = 0.011* (Total food protein + vegetal food protein)
for nutrient content, there is a need for a method to ..................... Equation 2
calculate the composition of urine from easily available
data. Such a method, which uses the FAO statistics In equations 1-2 the units of N and P are the same as
(see www. fao.org) on the available food supply in those of the food protein. As is shown by equation
different countries, has been developed by Jönsson and 2, there is a strong positive correlation between the
Vinnerås (2004). This method uses equations derived contents of protein and phosphorus in the food stuffs.
from the FAO statistics and an estimation of the average Furthermore, vegetal food stuffs contain on average
excretion by the Swedish population (table 2), where twice as much phosphorus per gram of protein as animal
many measurements on excreta have been made. ones, which is why the vegetal protein is counted twice
in equation 2.
Based on this estimate of average excretion, on the
food supplied to the Swedish population according to These equations are useful for estimating the average
the FAO statistics and on statistical analysis of different excretion of N and P in different countries. The input
foodstuffs, relationships (equations 1 and 2) have been to such estimates are FAO statistics on food supplied,
developed between the food supplied according to FAO found on the FAO website. Examples of inputs and
and the excretion of N and P. results of such estimates for a few countries are given
in tables 3 and 4.
N = 0.13* (Total food protein)
……..............Equation 1 These estimates assume that the loss between the
food supplied and the food actually consumed, i.e.
Table 3: Food supply (crops primary equivalent) in different countries in 2000. FAO 2003
Vegetal
Total energy Vegetal energy Total protein
protein
Country kcal/cap,day kcal/cap, day g/cap, day
g/cap, day
3029
China, Asia 2446 86 56
2
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Table 4: Estimated excretion of nutrients per capita in different countries. Jönsson and Vinnerås 2004
the food waste generated, is of the same relative size shows that in these areas urine could provide a
in the different countries. This assumption is verified nitrogen rich fertilizer of the ratio 10:1:4 and faeces
by Chinese data. The total excretion reported by Gao a more evenly balanced 2:1:1 fertilizer. The weighted
et al., (2002) for China was 4.4 kg of N and 0.5 kg of average nutrient content, which would be the result of
P. These values agree quite well with those calculated application of these two fertilizers derived from the
in table 4, considering how difficult it is to carry out same number of people during the same time, yields
representative measurements of the excretion of a approximately a 7:1:3 fertilizer ratio.
large population.
Basic data on urine composition can also be found in Excreted amounts and volume
the following: NASA Contractor Report No. NASA
CR-1802, D. F. Putnam, July 1971. This document is The quantity of urine produced by an adult mainly
available online at: depends on the amount of liquid a person drinks and
perspires. Children produce approximately half as
http://ntrs.nasa.gov/archive/nasa/casi.ntrs.nasa. much urine as adults. Excessive sweating results
gov/19710023044_1971023044.pdf in concentrated urine, while consumption of large
amounts of liquid dilutes the urine. Vinnerås et al.,
Table 5 below shows the calculated N, P and K (2006) suggested a design value for urine generation
values of urine and faeces and urine + faeces for the to be 1500 g/p,d based on measurements in Sweden,
10+ age group of rural households in the Limpopo while Schouw et al., (2002) found that in Southern
province of South Africa (CSIR, 2008). The table Thailand between 0.6-1.2 L/p,d of urine was produced.
Table 5: N:P:K excretion of nutrients per capita per annum and the ratio for urine, faeces and
urine + faeces fertilizer in South Africa CSIR, 2008
N P K N P K
3
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Table 6: Conversion factors for major nutrients There is the possibility that if urine is reused in
agriculture, these micro-pollutants would be taken up
To Convert To Multiply by by plants and thereby enter the human food chain.
This is a risk, but a small one: a full evaluation of the
potential toxic effects of pharmaceuticals ingested by
K K2O 1.2 humans with crops is very difficult and has not yet
been done. The risks need to be put in perspective
compared to pharmaceutical residues contained in
K2O K 0.83
animal manure, or the risks resulting from pesticide
use. In sewer-based sanitation systems, these micro-
P P2O5 2.29 pollutants are discharged from sewage treatment
plants into surface water bodies and can reach the
groundwater in the long run. For example, detected
P2O5 P 0.436 concentrations of pharmaceutical residues in
groundwater lay in the range of 50 ng/l in Germany
(Heberer et al., 2000).
4
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
When comparing the two approaches (mixing urine Urine is strongly toxic to earthworms as reported
with water in conventional wastewater management from a PhD study (Muskolus, 2008). Urine
versus urine application to soil), it is likely to be safer fertilization has been found to give a temporary
to discharge urine to soil, rather than to let it pass set-back to the population of earth worms, but the
the conventional system. The micro-pollutants can effect is not permanent and after about 6 months,
be degraded better in the aerobic, biologically active the population had recovered (Muskolus, 2008). It
soil layers (high concentration of micro-organisms was investigated whether this response was related
per cubic centimetres) with long retention times than to ammonia or pharmaceuticals in urine, however,
in water bodies whose ecosystems are much more no such connections could be made. Soil microbial
sensitive. Soil is considered a more suitable medium enzyme activities were not influenced by urine used
for natural degradation of pharmaceuticals than water as a fertilizer. (Muskolus, 2008)
because:
Trace metals
• The oxygen levels, promoting biodegradation, are Human faeces and to a small extent urine contain
around 50,000 times higher than in water trace metals. The amounts of harmful heavy metals in
urine are miniscule and much lower than wastewater
• Exposure to UV light also helps to degrade sludge or even farmyard manure (WHO, 2006). This
pharmaceuticals, although this only applies to the is a result of the biological uptake being small and
surface (1-2 cm soil depth) and crops can shade the their excretion being even smaller (Vinnerås, 2002).
ground. Essentially all the heavy metals in the excreta from
a normal population come from the food ingested
• Terrestrial systems are much better equipped to and a large proportion of these metals will have been
degrade organic compounds than aquatic ones. The removed from the fields with the crop. Thus, it is
high specific surface of soil particles maximises possible to recycle excreta fertilizers, provided that
the exposure of adsorbed chemicals, maximising they have not been polluted when handled, without
the kinetics of degradation such as oxidation, threatening the sustainability of the agricultural soil
reduction, enzymeenhanced diagenesis, etc. (Jönsson et al., 2004).
5
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Table 7: The relative tolerance of common plants to salinity. Brady and Weil, 1999
with factors such as plant species and temperature. conditions, very high rates of urine application
Bernal et al., (1974) reported growth depression of lowered yields. This was due to increased salinity of
10 to 50 per cent grain yield of wheat when treated the soil that led to high levels of sodium in plant tissue.
with a solution of 50 mM NaCl. Salt-affected soils However the rates of N-application in the study were
are distributed all over the world but most of them are extreme: 1600 kg N/ha, which increased the electrical
found in arid and semi-arid regions conductivity of the soil, resulting to classification of
the soil as a very strong saline soil after harvest. The
Fertilizers are to a large extent soluble salts and if use of this level of application is never recommended.
they are not managed properly they can contribute It was also suggested that the salinity status of soils
to or cause salinization. For example, a study made fertilized with urine should be monitored in order to
to investigate salinity and nitrogen rate effects on detect possible salt-build up, which is reasonable.
the growth and yield of chile pepper plants by Villa-
Castorena et al., (2003) showed that high amounts of Monitoring in arid regions would be advisable in order
nitrogen application, 140 kg ha-1 and more, increased to get long-term data on possible salt build-up in soils
soil salinity and in turn decreased plant growth and and/or to keep rates of urine fertilization at a level that
yield. is well adapted to the climate and crop. Plants vary in
their ability to tolerate salinity and a good selection of
In a South African study on the evaluation of human crop is therefore an important part of optimizing the
urine as a source of nutrients for vegetables by Mnkeni crop yield in arid areas (table 7).
et al., (2005) it was found that under South African
6
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
7
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Box 1: Calculating the economic value of urine - experiences from Burkina Faso
Most families cannot afford two bags of fertilizers. Fertilizer imported* 22 632 8 801 14 801
No surprise then that the message “one family pro-
Excreta produced 38 024 5 780 19 265
duces the equivalent to two bags of fertilizer” has
been met with great interest by the populations in Ratio excreta/
1.68 0.66 1.30
rural Niger. Locally, two bags of chemical fertilizer fertilizer
cost roughly 80 $. *FAO statistics 2005
Figure 4: The nutrient content in the excreta from an average person in West Africa (based
on FAO data on food intake from 10 countries).
8
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
TOTAL 136
Value - 10 % 4100 (~10 $)
TOTAL -
~ 120 FCFA
10 %
For Burkina Faso with 13.5 million people, the hu-
man fertilizer value corresponds to 135 million $ per The content of secondary macronutrients such as
year. In many countries chemical fertilizers are heav- sulphur, magnesium and calcium, and micronutri-
ily subsidized. A discussion based on the figures in ents are seldom calculated, however, they contrib-
this text could be initiated to investigate the potential ute to the value of the urine since they make the
of subsidizing toilets instead of chemical fertilizers. urine a full fertilizer.
9
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Cereals in India
10
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Table 13: Average yields (grams fresh weight) in plant trials with urine as a fertilizer to
vegetables in Zimbabwe. Morgan, 2003
11
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
2008). The following text reports one of the manyfold taste of sauerkrauts were similar in cabbages from
trials that have been carried out. Plants were grown all three fertilization treatments. The results show
in 10-litre cement basins and fed with 0.5 litres of a
3:1 water/urine mix three times per week. Unfertilized
plants were cultivated as a comparison. The increase
in production was large but no statistical analysis was
performed.
Vegetables in Northern Europe that human urine could be used as a fertilizer for
cabbage and does not pose any significant hygienic
Human urine was used in trilas carried out in Finland threats or leave any distinctive flavor in food
as a fertilizer in cabbage cultivation in comparison products.
with industrial fertilizer and nonfertilizer treatments
(Pradhan et al., 2007). The main objectives of the In a field trial in Sweden in 2002, different
study were to evaluate the use of urine fertilizer application strategies for urine as a fertilizer to
on (1) growth and pest-resistance of a crop plant, leeks were tested (Båth, 2003). Fertilizing with
(2) chemical and microbial quality of the crop, urine gave a three-fold yield increase. Neither yield
and (3) flavor quality of a vegetable food product nor nutrient uptake were significantly affected by
prepared with natural lactic acid fermentation. whether the same total amount of urine was applied
Urine achieved equal fertilizer value to industrial in two doses or whether it was divided into smaller
fertilizer when both were used at a dose of 180 doses applied every 14 days. The N efficiency (i.e.
kg N/ha. Growth, biomass, and levels of chloride (N yield – N yield in unfertilized plots)/added N),
were slightly higher in urine-fertilized cabbage when using human urine was high, ranging from 47
than with industrial-fertilized cabbage but clearly per cent to 66 per cent. This is on the same level
differed from nonfertilized. Insect damage was as when mineral fertilizers are used. N efficiency
lower in urine-fertilized than in industrial-fertilized for most other organic fertilizers, e.g. compost, is
plots but more extensive than in nonfertilized normally between 5 and 30 per cent.
plots. Microbiological quality of urine-fertilized
cabbage and sauerkraut made from the cabbage Human urine obtained from separating toilets was
was similar to that in the other fertilized cabbages. tested as a fertilizer for cultivation of outdoor cucumber
Furthermore, the level of glucosinolates and the (Cucumis sativus L.) in a Nordic climate (Heinonen-
12
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Table 14: Results of a field trial using human ha for the three treatments. Soil sampling showed no
urine as a fertilizer for leeks. There was no differences between treatments regarding physical or
statistically significant difference between chemical characteristics.
treatments A, B and C. After Båth, 2003
13
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
bunch (223.4), which was 47.7 per cent more than that (Musa paradisica) to meet the nitrogen requirement of
applied with mineral fertilizer. this crop (Sridevi et al., 2009). The treatments were
absolute control, recommended dose of fertilizers,
Application of 50 litres of human urine per plant with recommended dose of nitrogen through human urine
75 per cent of recommended dose of potassium was with and without gypsum and fertilizer applied to
superior by recording 32.1 per cent more plant height, soil and different combinations of human urine and
25.6 per cent more pseudostem girth, 71.5 per cent fertilizers. The results of the field experiment revealed
more number of leaves and 68.8 per cent more leaf that the highest bunch yield (30.0 t ha-1) of banana was
area, 25 per cent more leaf nitrogen concentration, 52.6 recorded in the treatment which received RDN through
per cent more phosphorus concentration and 6.5 per human urine (After 30 days of planting) + Gypsum
cent more leaf potassium than normally grown banana applied to soil when compared to control, and other
plants without urine application (control). treatment combinations. The available nutrient content
of harvest soil viz., N, P and K had significant influence
Application of 50 litres of urine per plant along with 75 on it. Significant increase in the nitrogen, phosphorus
per cent recommended dose of potassium alone could and potassium content of plant samples was observed
give an additional net profit of Rs. 45,175/- per hectare in the crop. The highest total soluble solids (25.85 per
when compared to mineral fertilizer alone, ie., normally cent), reducing sugars (20.93 per cent) and total sugars
grown Poovan banana without urine application. (23.87 per cent) were recorded in banana grown using
human urine. The outcome of the present investigation
Field experiments were also conducted in farmers’ fields revealed that ecosan system helps to provide better
at Nagasandra village, Doddaballapura Tq, Bangalore sanitation, help farmers to save the cost on fertilizers
district for one year to study the source separated human without affecting the crop yields and thus help to
urine as a source of nutrients for banana cultivation achieve food security.
14
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Application strategies
Practical guidance:
The urine from one person during one year
suffices to fertilize 300-400 m2 of crop to a level of
about 50-100 kg N/ha. Urine should be handled
in closed tanks and containers and should be
spread directly onto the soil, not on the plant, in N
doses equivalent to what is recommended for urea
and ammonium fertilizers. Air contact should be
minimized and the urine should be incorporated
into the soil as quickly as possible.
15
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
the plants are setting ears is well utilised, but after this lettuce, can benefit from repeated applications of urine
stage the uptake of nutrients from the soil declines. throughout the cultivation time (Thorup-Kristensen,
After this stage the nutrients are mainly relocated within 2001).
the plant (Marschner, 1995). This is fully appreciated in
recommendations on use of chemical fertilizers. E.g.
in Zimbabwe, where maize is harvested 3-5 months Application rate
after planting, the recommendation is to fertilize it
three times, but no later than 2 months after planting. A starting point for the estimation of suitable urine
As a rule of thumb, fertilization should stop after 2/3 to application is the local recommendations for use of
3/4 of the time between sowing and harvest. Crops not commercial mineral N fertilizers, especially of urea or
entering the generative stage, e.g. lettuce, spinach, as ammonium fertilizers. If such recommendations are not
well as roots and tubers, e.g. Irish potatoes and sweet available, another starting point can be to estimate the
potatoes continue to take up nutrients throughout their amounts of nutrients removed by the crop, where the
growth period. However, a waiting period of 1 month removal of nutrients has to be adjusted for the expected
between fertilization and harvest is recommended yield level. Urine can be recommended for most crops.
from a hygiene point of view for all crops eaten raw
(Schönning and Stenström, 2004; WHO, 2006). The productive area (e.g. grass, flower beds, vegetable
garden, trees) necessary per person for use of all the
urine on household level depends on several factors:
16
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Box 3: Calculation of necessary productive area in garden to maximize nutrient use in urine.
A family of five has a plot size of 300 m2 on which yearly. Each person excretes about 550 l, but as-
they want to use the urine they collect in their urine suming that some of the time is spent outside the
diversion toilet. The family lives in a climate allow- home, about 300 l per person is collected yearly.
ing for two yearly crops. If we assume that they ap- The result is 1,500 l of urine from a family of
ply 4 l per m2 for the first crop, and 2 l per m2 for five. This will fertilize 250 m2 since each m2 will
the following crops, how many m2 do they need to receive 6 l m2/ on a yearly basis, giving a quite
use their urine in their garden? high level of nitrogen fertilization. Thus, the plot
Answer: size would be more than sufficient to productively
Since they live in an area where two crops can use the collected urine.
be taken per year and 6 l/m2 can be applied
Table 15: Application levels and intervals for specified crops in Burkina Faso.
Source : Moussa Bonzi, CREPA, Burkina Faso
Days (weeks)
after planting Sor-
or emergence Eggplant Tomato Onion/carrot Lettuce Pepper ghum/ Corn
of first plant millet
from seedling
14 (2) 0.5 0.4 litres 1 litre /m2 0.5 litre 0.5 0.6 litre
litres per plant (assuming 20 / plant litre per
per (when plants per and plant
plant the plant dilution: 1part before
starts to urine to 1 part seeding
flower) water)
21 (3) 1 litre of urine per m2
(assuming 50 plants
per m2 and 1 part
urine to 1 part water)
28 (4) 0.4 litre 1 litre /m2 0.6 litre
per plant (assuming 20 per plant
plants per m2 (when
and dilution: first fruits
1part urine to appear)
1 part water)
35 (5) 0.5 litre 0.5 0.6
per plant litre per litre per
plant plant
42 (6) 1 litre of urine per m2 0.5 litre
(assuming 50 plants per plant
per m2 and 1 part
urine to 1 part water)
56 (8) 0.5 litre
per plant
17
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
385 m2 (1.5 l of urine per m2), if one single crop is The application of a water/urine mix normally needs to
taken per year. If there is a restriction in plot size, it be interspersed with irrigation with water only.
is usually possible to increase the fertilization up to
three - four times, thus using up to 6 l per m2 without Diluted urine should be handled in the same way as urine.
any negative effects on crop or environment and even In order to avoid smells, loss of ammonia, generation of
larger amounts can beneficially be applied, if there is no aerosols, burns and possible contamination on plants by
or low risk of salinization. Such large applications of remaining pathogens, urine should be applied close to,
urine can be beneficial for the crop yield, if excessive on or incorporated into the soil. Foliar fertilization is
ammonia is lost in the application and especially on not recommended due to odour, loss of N, risk of plant
phosphorus deficient soils as the phosphorus application toxicity and hygiene risks.
is increased. However, care should be taken on soils and
in regions prone to eutrophication of watercourses to Concentrated urine has a higher pH, and consequently,
use nutrients in urine in the most efficient manner. dilution means that the effect of storage on pathogen
content in urine will be lowered. Keep the urine
Dilution concentrated during storage, and if dilution is chosen
as a strategy, this should be carried out as close to
Practical guidance: application as posssible. It has been observed that if
Urine can be applied neat or diluted with water. diluted urine is stored in open containers (which is not
There is no standard recommendation for dilution/ recommended), this may become a breeding site for
non-dilution and the existing recommendations mosquitoes that can act as disease vectors. This has
vary depending on the local conditions. Levels never been seen in concentrated urine.
of dilution can vary between 1:1 (1 part urine to
1 part water) and 1:15 (one part urine to fifteen
parts water). Most common dilution ratios are 1:3
Storage techniques
or 1:5. However urine should always be applied at
the rate corresponding to the desired application
rate of N, while additional water should be applied Practical guidance:
according to the water needs of the plants.
Storage of urine should always take place in
a closed container in order to avoid ammonia
emissions.
Urine can be applied neat (without dilution) or diluted
with water, which is practised in many places. The level
of dilution varies between approximately 1:1 (1 part Urine needs to be stored in order to achieve proper
water to 1 part urine) to 1:15 (one part urine to fifteen hygienization, especially if collected from many
parts water ), and 1:3 seems common. Dilution involves households. There is also need of storage if urine is
increasing the volume to be spread and thus the labour, collected when there is no cropping season. One thing
the equipment needed, the energy use and the risk for that all storage systems have in common is the fact that
soil compaction are all increased. urine must be stored in closed containers in order to
avoid ammonia losses.This section presents different
Dilution has the advantage of decreasing, or techniques for storage of urine. There is a need to
eliminating, the risk of applying urine at such high develop low-cost storage methods for small and large
rates that it becomes toxic to the crop. However, scale collection of urine.
irrespective of whether the urine is applied diluted or
neat, urine is a fertilizer and should, just as the much Jerry cans are the most common way of collecting
more concentrated chemical fertilizers, be applied at the urine, and a very good way to store urine for a short
rate corresponding to the desired application rate of N, period. A good example was introduced by CREPA
while additional water should be applied according to Burkina, where the jerry cans used for collection of
the needs of the plants. Thus, urine can be applied neat, urine were yellow, and jerry cans used for transportation
or even concentrated to the soil, which then is irrigated of hygienized urine from storage to field were green, see
according to crop water requirements. The urine can figure 14.
also be diluted into the irrigation water at a rate that
depends on the need for nutrients and water by the crop.
18
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Figure 13: Storage of urine in one cubic metre Figure 16: Slurry tank in wintertime, Sweden.
tank. Photo: Anna Richert This slurry tank will be used for human
urine, and it will be equipped with a cover to
minimize ammonia losses.
Photo: Lennart Qvarnstrzöm
19
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Storage in soil
Practical guidance:
Practical guidance: For best fertilizing effect and to avoid ammonia
Urine can be stored in the soil if storage capacity losses, urine should be incorporated into the soil
is lacking. Storage in soil is carried out by applying as soon as possible after application, instantly if
urine where is will be used during a dry inter- possible. This also limits potential health risks of
cultivation period. direct exposure A shallow incorporation is enough,
and different methods are possible. One is to
apply urine in small furrows that are covered after
Storage of urine may be a constraint in settings application. When spreading urine, it should not
be applied on leaves or other parts of the plants,
where low-cost options are a neccessity. Therefore
as this can cause foliar burning. Spraying urine
different methods to avoid storage containers have in the air should also be avoided due to the risk
been developed. In regions where the inter-cultivation of nitrogen loss through gaseous emissions of
periods are dry, storage of urine nutrients in soil is an ammonia and the hygiene risk through aerosols.
alternative for extending the storage capacity and also Drip irrigation with urine is another possible
the labor intensive fertilization period. This is carried application technique. However, when this
out by applying and incorporating the urine into the technique is used, measures must be taken to
avoid clogging of emitters. In the larger scale,
soil during the dry inter-cultivation period, followed by
equipment for spreading of animal slurry is used.
normal cultivation of the already fertilized soil during
the cropping season. The idea is that the main portion
of the nutrients remain in the soil and will be available
for the plants during the growing season. Further
investigations are needed to determine the loss and
availability of nutrients, especially N and P, to crops
during and after such storage. Results from SUDEA
in Ethiopia (Terrefe, personal communication), as
well as from an ongoing project in Niger (Dagerskog,
personal communication) indicate that the method
is an interesting alternative where storing the urine
in containers until the cropping season is impossible,
even though the N loss might be fairly high. During
one measurement where the urine nutrients were stored
28 days in the soil, the loss of mineral N was found
to be 37 per cent (Sundin, 1999). There is also a risk
that some P might be bound in forms that are less plant-
available during the storage, but K and S should remain
fully available. An additional advantage of soil storage
is that the labour of applying the urine is carried out
during the dry season, which is normally less labour-
intensive than the cropping season.
Application techniques
20
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Drip irrigation
Drip irrigation using urine as a fertilizer is another
possible application technique. However, when this
technique is used, measures must be taken to avoid Figure 20: Drip irrigation of cassava in Cote
blockages due to precipitation of salts forming sludge d´Ivoire.
as the total amount of precipitation often increases Source: Bernard Comoe 2009, CREPA Cote d´Ivoire 2009
after dilution, since the dilution water normally
contains magnesium and calcium. Thus, when using
21
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
22
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Practical guidance:
Multi barrier concept
Health risks associated with the use of human
urine in plant production are generally low if there
is no or little faecal cross-contamination. Storage Practical guidance:
of urine in closed containers will lower health risks
The WHO guidelines for safe use of excreta in
substantially.
agriculture (2006) promote a flexible multi-barrier
approach for managing the health risks associated
with the use of excreta in agriculture. This multi-
Health risks associated with the use of human urine barrier concept contains a series of measures/
in crop production are generally low. However barriers along the entire sanitation system from
during source separation in the toilet faecal cross- ‘toilet to table’. Each of the barriers has a certain
potential to reduce health risks associated with the
contamination of urine can occur. The amount of
excreta use and it is recommended by WHO to put
faecal cross-contamination is directly proportional to in place several of these barriers in order to reduce
the health risks. If faecal matter enters urine, the urine the health risk to an acceptable minimum.
will contain different types of enteric pathogens that
can represent a potential health risk. Their presence is
naturally dependent on whether the users are infected The World Health Organization (WHO) guidelines for
or carriers of the organisms in question. In the case safe use of wastewater, excreta and greywater (2006)
of diarrhoea the risk of faecal cross-contamination is recognize the potential of using excreta in agriculture
higher. and promote a flexible multi-barrier approach for
managing the health risks associated with the use of
In addition a few organisms of health concern may be excreta in agriculture. This multi-barrier concept is
excreted with the urine. One example is Salmonella comprised of a series of measures/barriers along the
typhi/paratyphi. These bacteria have a short survival in entire sanitation system from ‘toilet to table’. Each of
stored urine, there is reduction of the risk of pathogen the barriers has a certain potential to reduce health risks
transmission by at least 1000 times after a week of associated with the excreta use and it is recommended
storage. Therefore never use unstored urine when by WHO to put in place several of these barriers if
typhoid/paratyphoid cases are suspected. Another needed in order to reduce the health risk to an acceptable
example is Schistosomiasis Haematobium, which is a minimum. The reduction from each of the barriers can
parasite found only in Africa. However, in order to pose be added together, which then give both enhanced total
a risk, the eggs need to reach a watercourse and find risk reduction and also ensure that variabilities and
a suitable snail-host. Use of urine in agriculture with insecurities in each step are balanced in the long run.
spreading techniques recommended in this book greatly Thus even insufficiently treated excreta can be reused
23
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
as long as the emanating risks can be managed with contamination is negligible. The ablution water for
subsequent barriers. Effective barriers for safe use of washers should also be considered. If this water is
urine in agriculture can be found in the graphic below. combined with the urine the risk of cross-contamination
For more information visit the WHO website: http:// is increased, especially if the users have diarrhea.
www.who.int/water_sanitation_health.
The mode of collection, transport and emptying of the
Source Separation urine may also create situations where an exposure to
Source separation is an efficient barrier to reduce the humans can occur. If the urine collection chamber is
risks compared to a combined wastewater system. A flowing over, the cross-contaminated urine will be on
key objective of urine collection is to minimize faecal the ground where direct contact may occur to playing
cross-contamination. Urine diverting toilets should be children (design – have an overflow with a soak
designed in a way to minimize the cross-contamination. away). The containers for urine should not be used
If urine is collected from urinals, the risk of cross- for other purposes such as fetching water or brewing
beer. Transport to the field or to a secondary storage
container should avoid spill. Containers for transport
Box 5: Example of risk assessment and should have a tight-fitting lid.
ablution water.
Storage and Treatment
In a school in Tanzania a very well designed san- It is recommended that prior to application urine should
itation system was implemented with separate be treated in order to sanitize the urine and reduce
collection of faecal material and urine to be used
microbial health risks. Storage at ambient temperature is
in an agricultural plot within the school. Howev-
er, from a risk reduction point of view there were considered a viable treatment option. The storage times
still substantial problems since the ablution wa- should be based on temperature and the likelihood of
ter was lead untreated to an area that was used faecal cross- contamination as well as the vulnerability
for the pupils to play in (direct contamination as of the exposed population. A single family will most
transmission) and to a part of the agricultural probably transmit disease between each other through
plot (transmission from the produce). The ablu- direct routes and not through the use of collected urine.
tion water normally constitutes a minor volume
Thus in a family, when the urine is used in a local garden
(100 – 500 ml/washing). If this water instead
had been lead through a pipe directly into the
and the produce is used for family purpose only, a less
ground to a small soak-pit the risk for ground- strict storage regime can be applied. A less strict storage
water contamination would have been very small (1-2 weeks) can also be applied for urinals where the
due to the small volume. faecal cross-contamination is excluded. When urine is
collected from many different users as well as when the
24
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
produce is sold/transferred to a third party, the microbial When hygienization is finished, the liquid is tapped into
risk increases substantially. In these situations a longer green jerry cans, figure 14, and sold to farmers under
storage time should be used, rendering the used the name Birg Koom which means liquid fertilizer in
urine safer and increasing the reduction of potential the local language. The same concept is being used in
pathogens present. Recommended storage times vary Niger in a similar project. This is one way to demystify
depending on the system type (large-scale systems: urine as a fertilizer and to signal that the product is safe
1-6 months, households/urinals: 0-1 month). If cross- to use in agriculture.
contamination is likely to occur the storage time can
be adjusted upwards, exceeding 1 month. This also
applies for cold climates since the temperature is also
a governing factor in the die-off. As a rule: The longer
the storage the better.
Table 16: Recommended storage times for urinea based on estimated pathogen contentb and
recommended crop for larger systemsc. WHO, 2006
a Urine or urine and water. When diluted it is assumed that the urine mixture has at least pH 8.8 and a nitrogen concentration of
at least 1 g/l.
b
Gram-positive bacteria and spore-forming bacteria are not included in the underlying risk assessments, but are not normally
recognised for causing any of the human infections of concern.
c
A larger system in this case is a system where the urine mixture is used to fertilize crops that will be consumed by individuals
other than members of the household from which the urine was collected.
d
Not grasslands for production of fodder.
e
For food crops that are consumed raw it is recommended that the urine be applied at least one month before harvesting and
that it be incorporated into the ground if the edible parts grow above the soil surface.
25
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Crop restrictions for example, (rotation time 1-2 years) the risk is non-
When treated urine is used no particular crop restrictions existent from the urine if it is spread at amounts and
need to be applied. However, as an additional timing corresponding to the needs of the plants,
precautionary measure the urine use may be restricted consequently minimum 3 months before harvest.
to non-food crops (e.g. cotton), crops that are processed
(e.g. wheat) or cooked before consumption (e.g. potato) One goal when constructing systems for the use of
as well as crops/trees that allow for a distance between urine in crop production should be to reach a reasonable
soil and harvested part of the crop. In general it can level of risk reduction for persons involved in the use
be stated that the longer the time between application of the system, such as field workers, households or
and harvest – the less risky. Thus for crops with short consumers. The following matrix suggests strategies
rotation times, like spinach, salad crops and radish the for crop choice and fertilization in order to minimize
risk will be higher, and pretreatment is recommended, risk and maximize utilization of nutrients.
i.e. storage is required, but in the case of pineapples,
Millet, Rice,
Grain crops processed before Up until one month No storage
Sorgum, Low Workers
eating before harvest needed
Maize
Hanging plants not in direct con-
Consumers and Up until one month Storage
tact with the ground and usually Egg plant Medium
workers before harvest needed
not eaten raw
Mango,
Fruits likely picked from the Outside the fruiting sea- No storage
passion Low Workers
ground and eaten directly* son** needed
fruit, orange
Hanging plants partly or fully in
Consumers and Up until one month Storage
contact with the soil and eaten Tomatoes High
workers before harvest needed
raw
Cassava, Protection of Up until one month No storage
Root crops processed/cooked Low
potatoes workers before harvest needed
Consumers and Up until one month Storage
Root crops eaten raw Carrots High
workers before harvest needed
Leafy crops on the ground that Up until one month No storage
Spinach Low Workers
are cooked before harvest needed
Lettuce, Consumers and Up until one month Storage
Leafy crops eaten raw High
cabbage workers before harvest needed
Cotton, oil Up until one month No storage
Energy or fibre crops Low Workers
crops before harvest needed
* If vegetables are grown under fruit trees then the measures of precaution or barriers for vegetables need to be observed.
** If fertilization takes place close to the fruiting season, then precautionary measures or barriers need to be observed such as
storage of urine.
*** The storage time for urine is not indicated, since this also depends on local factors such as temperature or design of collection
system (degree of faecal contamination).
****Urine application should take place considering crop needs and common practice in the region. Continuous application can
take place where so noted, from a barrier point of view. A waiting period of one month should always be observed.
26
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Withholding period
Practical guidance:
The time between urine application and harvest
should be at least one month.
Application techniques
fieldworkers wear appropriate protective clothing
Practical guidance: (shoes and gloves) as an effective barrier to reduce
potential health risks. This is of importance when
Urine application close to the ground is
heavy faecal cross-contamination has occurred and
recommended in order to reduce contact with edible
parts and minimize spreading of urine drops. is of less concern for urine than wastewater or sludge
application. A heavy faecal load can lead to exposure
through bare skin by hook-worms and during direct
contact and subsequent contact with the mouth (the
Urine application close to the ground is recommended. faecal-oral route) while touching the face, eating and
This reduces the direct contact with the edible parts smoking. In these situations gloves reduce the risk.
of the plants. For example – do not apply urine with a Protective clothing is of concern not just for the workers
watering can on the edible or foliar parts of vegetables). but also so that contaminants are not transported to the
The urine should be incorporated into the soil either households/families.
mechanically or by subsequent irrigation with water.
If urine is applied before or during sowing/planting Handwashing with soap after urine handling
a further die-off will occur of potential remaining Washing hands with soap after urine handling can be
pathogens (see with-holding period) and thereby the considered an additional barrier in the system. Self-
risk will be reduced. evidently basic recommended health and hygiene
practices like hand washing after toilet use and prior to
Protective Equipment meals should always be observed.
Although there is little risk associated with treated
urine it is recommended if possible that agricultural
27
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
28
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
29
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Case one: reuse of urine in Vaxholm, Sweden demands documentation and analyes of the urine in
Kullön is located on an island in the municipality of initial stages.
Vaxholm, not far from Stockholm. 250 households
have one or two urine diverting double flushing Overall the system has taken much much work to initiate
toilets installed. Urine is collected in groups of 10- and an overlying conclusion is that the handling system
20 m2 tanks that serve from 5 to 40 houses each. The from an institutional point of view was not fully taken
system has been described in ESR report 2006:1 by into account when the housing area was planned, which
Kvarnström et al; http://www.ecosanres.org/pdf_files/ has caused problems. However, a functional system for
Urine_Diversion_2006-1.pdf the use of urine in agriculture exists, and the farmer is
quite content with the business that he is running.
Two times a year urine is collected by lorry, on
commission by the household owners organised in a
collective. This is a service that the household owners
pay for outside their normal taxes for waste and
wastewater collection which has caused conflicts in the
area.
30
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
• trained 100 artisans (masons etc.) to provide ecosan system is the treatment site, or eco-station,
the necessary infrastructure, in particular the which connects the households with the gardeners/
construction of the toilets. smallscale farmer. Two of the four ecostations are built
near the sites of market-gardening. The eco-stations
The physical infrastructure of the ecosan system are equipped with the sanitizing equipment required
consists of: (plastic tanks for urine and storage pits for faeces) and
accompanying infrastructure such as a hangar for the
• UDDTs at household level and at public places in working material, space for the donkeys which pull
four sectors of Ouagadougou; trolleys of urine jerricans and a storage room for the
finished fertilizer products. The number of plastic urine
• four treatment sites called eco-stations for urine tanks varies from 6 (in small sectors 19 and 27) to
and faeces in the same four sectors, each run by a 12 (large sectors 17 and 30). For sanitisation, urine is
separate association; transferred to the eco-stations and stored for one month
in closed 1 m3 plastic tanks, while faeces from double
• collection, transport and delivery of urine, dried vault UDDTs are stored and kept dry in chambers (total
faeces, sanitised urine and of sanitised dried faeces; volume: 6 m3) for two months.
• the use of sanitised urine and faeces in peri-urban To facilitate the collection in the households, the sectors
gardening. are divided into smaller areas. Each team of collectors
has to visit all latrines within 2 weeks. The collectors
The vaults are emptied by the collection service workers may have to cover distances of up to 12 km (the daily
and urine and faeces are brought to an eco-station for a work time is estimated to 5-6 hours). In total, the four
further drying/storage period and for final packaging. associations operate with approx. 28 people, 10 donkeys
For the transport to the eco-stations, urine is collected and 10 donkey carts.
in 20 L yellow jerricans, and faeces are transported
in plastic bags. Every full 20-L jerrican collected is At the beginning of the project, the technical team
replaced by an empty one. A central point of the urban and facilitators informed the households and farmers
Figure 27: Components of urine collection system in Ouagadougou, Burkina Faso. Photos: CREPA
31
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
about the benefits of using ecosan products for crop such as E. coli. Results shown that sanitized urine is
production. To raise acceptance among the users safe (without pathogens) and, used as fertilizer, has no
(gardeners, farmers and consumers), it was decided negative impact on the environment and the health.
to rename the urine and faeces. Thus, sanitised urine
is sold in green 20-L cans labelled “birg-koom” in the One important question has been the economic
local language which means liquid fertilizer, while stability of the supply chain. As established, the costs
sanitised dried faeces are sold in bags labelled “birg- for running the collection system are higher than the
koenga” meaning solid fertilizer. finances that are generated in the system, through a fee
to the household and through selling urine and faeces at
One important aspect of the project was to ensure the market prices. The fee for households was $US 0.60 per
quality and the safety of the ecosan products which month and the urine was sold to the farmers from the
are to be sold to the farmers. The gardeners and eco station at $US 0.20 per jerry can of 20 litres, faeces
small-scale farmers were trained to use the treated at $US 0.10 per kg. This means that there is a need to
urine and faeces on different vegetables (e.g. Tomato, cut costs without risking the safety of the reuse system.
cabbage, cucumber, zucchini, carrot, salad, aubergine,
strawberry, etc.). Moreover, samples of sanitised urine The project is described in the SuSanA case study
und dried faeces are sometimes taken and analysed by format: http://www.susana.org/images/documents/06-
the National Water Laboratory (Laboratoire National case-studies/en-susana-cs-burkina-faso-ouagadougou-
des Eaux) for N, P and K values, and for pathogens uddt-2010.pdf
32
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Gender aspects
Practical guidance:
In order to achieve sustainable use of urine in crop
production the gender perspective needs to be
included in implementation. This can for example
mean to consider the different roles of men and
women regarding the production of cash crops
and food for the household.
33
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
34
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
35
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Organize an arena for feed-back and interaction holding service providers accountable and achieving a
It is also important that there is an arena where degree of protection to the environment and health
the different stakeholders of the system meet and
communicate. This is especially so, since the systems
are new and thus their improvement potential is Regulatory framework
large. An arena where agriculture stakeholders can
meet stakeholders within the domains of sanitation, The regulatory framework is often not well developed
environment, planning, technical implementation, etc, regaring the implementation of systems for recycling
is of vital importance. of nutrients from sanitation systems. The question may
often be whether there is anything that specifically
Organize local communities so that there is a prohibits the use of urine in crop production, such as
structure for implementation and a structure for there is in Germany, or if the use is simply unregulated
monitoring. and therefore possible. Ideally, a regulatory framework
Local government has a key role as facilitator and facilitates the recirculation of nutrients from sanitation
regulator, finding ways to promote innovation while systems, and sets targets for environment or health that
use of urine in crop production can help in meeting.
36
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
37
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Practical guidance:
Crop experiments should be started on local
level in order to establish the use of urine as a
fertilizer in the local agricultural community. The
level of experimentation can range from simple
demonstration trials to scientifically rigorous
research. In any case, demonstration trials should
be started in a place that is easily accessible to
farmers and househols owners.
W hen planning a crop fertilization experiment Figure 31: Spinach (Swiss Chard) fertilized
the first and most important question is to with urine (left) and without fertilizer (right).
Photo: Peter Morgan
define the objective of the experiment. The answer
to this question has a decisive influence on how
the experiment should be planned, its costs and
complexity. If the answer is that the desired result
is increased knowledge among local population,
a simple demonstration trial showing yields with
urine, with mineral fertilizer and without fertilizer
can be used. If the answer is increased knowledge
in the farming community and for extension
professionals, a more extensive experiment
allowing statistical analysis is needed. The
following sections describe different strategies to
increase knowledge about cropping systems where
urine is used as a fertilizer.
Figure 32: Field trials from Niger. Urine
fertilized millet to the right. Photo: Linus Dagerskog
Demonstration experiments
Demonstration experiments are very useful and Controlled experiments to test the
flexible tools as they are cheap, quick and easy to fertilizing potential
set up. They can be small pot experiments or large
field experiment. A good idea is often to set up small In this type of experiments, as many factors as possible
demonstration trials just outside the entrance doors should be controlled e.g. the amount of water , weeds,
to the extension office, in schools or other places in insects and fungi, and maybe even climate, and the
the centre of the society where many persons can be crop should be established in the optimal way. These
reached. There is no need for repetition and the need experiments can be done on a very small scale, pot
for documentation is small. But it is good if the results or lab scale, and they often yield good, repeatable
are clearly visible and therefore the fertilization level and reliable results. Due to this small scale, this type
should preferably be large and the water factor well of experiment is actually the cheapest one for getting
controlled. The photos below show pot experiments repeatable and reliable results. To get statistically
by Peter Morgan Zimbabwe and field experiments in significant and conclusive results several repetitions
Rwanda. should be done, which due to the small scale often is
fairly easy and cheap.
38
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
The advantage of this type of well controlled is included in the experiment, and the effect on farm
experiment is that the variation between years is small economy of fertilizing these crops is evaluated. This is
even if it is performed outdoors. This means that after a highly relevant type of experiment, especially under
just one experimental season the result can be fairly marginal farming conditions, but these experiments are
representative. Another advantage that this type of very resource demanding, as they include several crops
experiment shows the full fertilizing potential of urine and need to be repeated at least 3-5 years.
to the crop in question. One disadvantage however,
is that this full potential might not at all show the
fertilizing effect that a farmer will experience in a real Statistical considerations
situation.
For all types of controlled crop experiments (not
including demonstration trials), the experimental
Controlled experiments to test the plots should be as even as possible, but even so, the
real life fertilizing effect comparison between the treatments should be repeated
several times, if possible 3-5 times in the same field.
This type of experiment is much more realistic, as the The order of the treatments should be randomized
same crop management procedures are followed for within each repetion.
the experimental plots as are usually followed by the
farmers. This means that if the year is very dry and Table 18: Example of experimental layout.
the crop is not irrigated, then the crop might suffer
severely and the fertilizing effect might be negligible Repetition 1 T4 T3 T2 T5 T1
as it is the water factor that decides the yield. Likewise,
other years it might be weeds, fungi or insects, that has Repetition 2 T4 T1 T2 T3 T5
decisive influence on the crop yield. These experiments
are often participatory and carried out on farms. Repetition 3 T2 T1 T3 T5 T4
Repetitions in order to carry out statistical analysis
increase the possibility of drawing conclusions from Repetition 4 T1 T5 T4 T2 T3
this type of research, but it is often a challenge to ensure
that the treatment actually is the same on the different In table 18, 4 repetitions with 5 treatments (T1-T5)
farms involved. . in randomized order in each repetition are shown in
a simplified experimental layout. While the whole
This type of experiment has the clear advantage that blocks should be treated according to the plan, it is
its results are much more realistic and more easily only the harvest of the central area that should be
transferred to, and scaled up by the farmers than the measured and allowed to influence the results, in
fully controlled experiments previously described. It, order to minimize the edge effects of the small plots.
however, also has the clear disadvantage that the yield
results are very much influenced by the weather and
season, which vary between years. This means that to Dissemination of results
be fairly sure to get any type of representative results
normally at least 3 years and preferably 4-5 years of The volume of published results from projects where
crop experiments are needed. urine has been introduced as a fertilizer is rapidly
increasing. However, there are numerous knowledge
gaps, and therefore it is important to capitalize on
Farm and crop rotation experiments experimentation that is done by publishing results
in fora that reach as many professionals as possible.
This is the most complex, realistic and most difficult It is quite important to reach not only agricultural
and expensive type of experiment. While the two professionals, but also professionals within sanitation,
previous types of experiments normally are confined to sociology, environment, etc. as well as the general
one crop at a time, in this type of experiment, the full public and local target groups.
range of crops normally grown by a farmer each year
39
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Figure 33: A sample page from the Aguie calculator for providing information on crop
productivity increases from using treated urine. AP-Aguie 2009
40
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
I
Food Urine + faeces
n order to be implementable in a local context the
wealth of information given in this book so far needs PEOPLE
to be further translated or adapted to respective local
site conditions. The following chapter provides some
recommendations on how local guidelines can be
developed and structured and it summarizes the most SOIL
important factors that directly or indirectly influence
farming activities related to urine use. Not all of the Crops Safe fertiliser
listed aspects necessarily need to find their way into Figure 34: Closing the loop.
the final guideline version at a local level and it is very
much up to local experts to finally decide on what needs
to be included. However the listed aspects set the frame Local site conditions
of what generally needs to be considered for successful
local adaptation. Examples of local guidelines for urine Although people working in agriculture usually know
use in crop production are presented in annexes. quite well how their respective local climate, soil and
water conditions are it might be relevant to include a
The main aim of a local guideline as presented in this chapter that specifically focuses on how this impacts
text is to be a national, regional or local support tool on urine use.
that is clearly targeted at agricultural extension workers
and not the farmers. For farmer level frequently more Climatic conditions
simplification is needed, which can be done by the Information on climatic region, temperature, rainfall
extension workers on the basis of the local guidelines pattern, humidity and seasonal specifics. For example,
developed using these instructions. in arid regions with low rainfall and high temperature
evaporation might be very high or in tropical areas with
high rainfall it should be recommended to apply urine
The productive sanitation approach more often in smaller doses.
41
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Plant requirements and nutrient Table 19: Food supply (crops primary
content in urine equivalent) in different countries in 2000.
FAO 2003
This section of the local guideline gives instructions on
type of crops, nutrient requirements, need for urine as Nitrogen Phosphorus Potassium
a fertilizer and the benefits of using urine as a fertilizer. (kg/cap/a) (kg/cap/a) (kg/cap/a)
The section on benefits is especially important, and can
be used as an advocacy text not only for agricultural China 3.5 0.4 1.3
extension personnel.
Haiti 1.9 0.2 0.9
42
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
are available the amount of urine needed can then be depends on the nitrogen need of the plant and its root
calculated by using the data of the respective local urine size. Root size varies widely between different crops
nutrient content. Another option is to back-calculate and plants with inefficient or small root systems (e.g.
the amount of urine needed from the estimated amount carrots, onions and lettuce) can benefit from repeated
of nutrients removed by the crops at harvest. However, applications of urine.
a lot of this information might not be available
particularly on small-scale household level. In this Application technique
case it is recommended to conduct experiments prior to Detailed recommendations on how the urine should be
the actual implementation to gain first experiences on applied should be given. For best fertilizing effect and
appropriate application levels. Most farmers anyway to avoid ammonia losses, urine should be incorporated
will soon get a feel for the right amount of urine that is into the soil as soon as possible after application,
needed for optimal plant growth. instantly if possible. A shallow incorporation is
enough, and different methods are possible. One is
Dilution to apply urine in small furrows that are covered after
Urine can be applied neat or diluted with water application. Washing the nutrients into the soil with
and advice should be given on appropriate dilution subsequent application of water is another option.
ratios (or non-dilution respectively) depending When spreading urine, it should not be applied on
on the local conditions. There is no standard leaves or other parts of the plants, as this can cause
recommendation for dilution/non-dilution and the foliar burning. Spraying urine in the air should also
existing recommendations vary widely depending on be avoided due to the risk of nitrogen loss through
the local conditions. Dilution increases the volume gaseous emissions of ammonia and the hygiene risk
to be spread and thus also increases labour, transport through aerosols. Drip irrigation with urine is another
expense, equipment needed etc. particularly in larger- possible application technique. However, when this
scale systems. Advantages of dilution include a technique is used, measures must be taken to avoid
noticeable odour reduction and a decreased risk of clogging of emitters. Some plants (e.g. tomatoes) in
over-application, in order not to be toxic to the plants. their early stages are sensitive to having their roots
Pros and cons should be properly weighed. Levels exposed to urine, while on many crops no negative
of dilution can vary between 1:15 (1 part urine to 15 effect is seen at all. Therefore, before the sensitivity
parts water) and 1:1. Most common dilution ratios are of a crop is known, it is wise not to simultaneously
1:3 or 1:5. However urine should always be applied expose all the roots of the plant to urine, be it neat or
at the rate corresponding to the desired application diluted. Instead, urine can be applied either prior to
rate of N, while additional water should be applied sowing/planting or at such a distance from the plants
according to the water needs of the plants. that the nutrients are within reach of the roots. For
annual plants this distance may be about 10 cm.
Application time
Recommendations on when and how often the urine Combined application
should be applied should ideally be given in an easy Urine is a valuable nutrient source (particularly for
to understand schedule. Good availability of nutrients N) but due to its comparably high N and low organic
is particularly important in early stages of cultivation. matter content it is often recommended to complement
Once the crop enters its reproductive stage it hardly urine application with other nutrient and organic
takes up any more nutrients. As a rule of thumb, matter sources. The most obvious source that can be
fertilization should stop after between 2/3 and 3/4 recommended would be, of course, source-separated
of the time between sowing and harvest. A waiting faeces due to its high organic matter content and the
period of one month between fertilization and harvest high P and K concentrations given that it is acceptable
should always be observed. As regards the risk of for the users and associated health risks can be
nutrients leaching particularly in regions where there properly managed. Another organic matter source
is heavy rainfall during the cropping season, repeated would be humus/compost that could be applied prior
applications of urine may be an insurance against to planting time. If the P and K demand of the plant
losing all the nutrients in one rainfall event. The cannot be met with urine alone other P- and K-rich
total applied amount of urine and whether it should mineral fertilizers might be a good complementary
preferably be applied once or several times also solution.
43
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
44
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
sowing/planting a further die-off will occur of potential Barrier VII: Handwashing with soap after urine
remaining pathogens and thereby the risk. handling
Washimg hands with soap after urine handling can be
Barrier IV: Crop restriction considered an additional barrier in the system. Self-
When treated urine is used no particular crop restrictions evidently basic recommended health and hygiene
need to be applied. However as an additional safety practices like hand washing after toilet use and prior to
feature the urine use may be restricted to non-food meals should always be observed.
crops (e.g. cotton), crops that are processed (e.g. wheat)
or cooked before consumption (e.g. potato) as well as Barrier VIII: Food handling and cooking
crops/trees that allow for a minimum distance between Harvested crops should always be washed before
soil and harvested part of the crop. In general it can consumption. Cooking or peeling of fruits/vegetables
be stated that the longer the time between application is another effective measure to considerably reduce the
and harvest – the less risky. Thus for crops with short associated health risks (pathogen reduction between 2-6
rotation times, like spinach, salad crops and radish the log units)
risk will be higher, and the pretreatment should be better,
but in the case of for example pineapples (rotation time Barrier IX: Health and hygiene promotion
1-2 years) the risk from urine is nonexistent. Effective hygiene education and promotion should be
conducted in order to inform local growers and food
Barrier V: Withholding period handlers (in markets, restaurants, home and food kiosks)
A withholding period of one month between the how and why they should wash produce fertilized with
last urine application and the harvest is a barrier that urine.
provides time for pathogen die-off, and is always be
recommended. Handling systems
Information should be given here on the specifics of
Barrer VI: Protective equipment the locally used collection, treatment and transport
Although there is no high risk associated with treated components of the sanitation system.
urine it is recommended if possible that agricultural
fieldworkers wear appropriate protective clothing Demonstration experiments and
(shoes and gloves) as an additional effective barrier to dissemination strategy
reduce potential health risks. Information should be taken and summarized from
local experimentation and the generic chapter.
45
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
April 2010
SUMMARY
1 Introduction Foreword
2 Aim This guide was put together within the project
3 The potential of human urine as a fertilizer “Productive Sanitation – Aguié” which was executed
3.1 The quantity of fertlizers excreted by humans from October 2008 to February 2010. The project was
3.2 The charcteristics of urine as a fertilizer mainly financed by IFAD. CREPA, PPILDA and SEI
4 Urine collection have been project partners during the implementation
5 Mode of Takin Ruwa (sanitized urine) phase.
application
5.1 Application material This guide was put together by professor Moussa
5.2 Application to crops with space between the Baragé, independant consultant, in collaboration with
plants the SEI. It is destined towards agriculture extention
5.3 Application to crops planted densely officers as well as other persons and organizations
5.4 Fruit trees interested in the possibilities of reuse of human urine as
6 Application of sanitized urine (takin Ruwa) - a fertilizer the Niger context.
recommended periods and doses for different
crops
7 Security measures
8 Bibliography
46
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Urine collection
Urine is easy to collecte either from urinals (figure 36) or from latrines (figure 37) that allow for separation of urine
and faeces.
47
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Makea furrow or hole Apply the Takin Ruwa Close the Water down using generous
10cm from the plant in the furrow/hole furrow/hole amounts of water
Wait for a rainfall of Makea furrow or hole Apply the Takin Ruwa Close the
at least 15mm 10cm from the plant in the furrow/hole furrow/hole
48
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
Fruit trees
For fruit trees, make a furrow 5-10
cm deep around the tree starting
from the distance of the canope
line. The width of the furrow can
be half the canope width, measured
from the edge towards the centre.
The application of Takin Ruwa
should be combined with compost
or manure application to supply
enough oligo elements.
The roots generally Make a furrow Apply Takin Ruwa in Cover the Takin Ruwa Water abundantly in
have the same length around the tree pro- the furrow all around with some soil. the furrow.
as the branches. portional to the line the tree.
of the canopy. The
furrow should not
reach the trunk.
49
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Application of sanitized urine (Takin Ruwa) K and oligoelements is lower) and finally the plants
– recommended periods and doses for nitrogen need. Bear in mind however that Takin Ruwa
different crops is mainly a fast acting N-fertliizer and should be
The different doses and franctions presented in the table complemented by the addition of P and K or an organic
on this page is based on the reults obtained from two base fertilizer. These Takin Ruwa recommendations
stations as well as the recommendations for nitrogen are also preliminary ; ongoing research will enrich this
fertilization in Niger, the nitrogen concentration of technical guideline.
Takin Ruwa being around 4.5 gN/l (the content of P,
Table 20: Periods and doses of sanitized urine for different crops.
Melon
Applica- Auber- Onion, Cucum-
Tomato Pepper Potatos Lettuce Gombo /mar-
tion period gine garlic ber
row
Two weeks Sandy soil:
after sow- 0.5 litre 0.5 litre 0.6 2.5 litres / 1 litre / m2 1 litre / 0.5 0.5 0.5 litre /
ing or / plant / plant litre / m2 Clayey soil: m2 litre / litre / plant
planting plant 0.7 litre / plant plant
m2
Start of 2.5 litres / Sandy soil: 1.5 litres
the flow- 0.5 litre 0.7 litre 0.7 m2 applied 1 litre / m2 / m2 (at 0.7 1 0.7 litre /
ering (3 / plant / plant litre / at the start Clayey soil: the start of litre / litre / plant
weeks plant of the of 0.7 litre / the bulb plant plant
after the tuberiza- m2 forming,
first appli- tion (around (2 weeks around
cation) 4 weeks after the first 4 weeks
after the first application) after the
application) first appli-
cation)
During
fructifica- 0.3 litre 0.3 litre 0.5 0.3 0.5 0.3 litre /
tion (3 / plant / plant litre / litre / litre / plant
weeks plant plant plant
after the
2nd appli-
cation)
50
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
(Table 20 cont…) Periods and doses of sanitized urine for different crops.
Appli-
Cab-
cation Carrot Millet Sorghum Mango Orange Goyava Papaya Banana
bage
period
Two
weeks 2 1 0.8 0.7 litre* Growth fer- Growth Growth fer- 3 litres 3 litres /
after litres litres litre* / plant tilizer (tree fertilizer tilizer (tree / tree 1 pied en
sow- / m2 / m2 / (start of aged 0-4 (tree aged aged 0-2 month couronne
ing or plant tillering) years): apply 0-4 years): years): apply after sow- 1 mois
plant- (start 2 litres/tree apply 1.5 1 litres/tree ing après
ing of 4 times per litres/tree 4 times per plantation
tiller- year. (start of 4 times per year. (start of
ing) rainy season, year. (start rainy season,
during the of rainy sea- during the
rainy season, son, during rainy season,
start of cold the rainy start of cold
season and season, season and
during the start of cold during the
cold season). season and cold season).
during the
cold sea-
son).
Start
of the 2 1.25 0.7 0.7 litre* Produc- Produc- Produc- 4 litres / 4 litres /
flower- litres litres litre* / plant tion ferti- tion ferti- tion ferti- tree 1.5 tree 1.5
ing (3 / m2 / m2 / (Fin lizer (trees lizer (trees lizer (trees months months
weeks plant mon- aged > aged > aged > after the after the
after (Fin taison 4 years) : 4 years) : 2 years) : 1st appli- 1st appli-
the first mon- – début Apply 6 litres Apply 5 Apply 4 litres cation cation
appli- tai- épiai- per tree, 4 litres per per tree, 4
cation) son son, times per tree, 4 times times per (NB: make (NB: make
soit 4 year (start of per year year (start of the same the same
rainy season, ((start of rainy season, application applica-
during the rainy sea- during the for the next tion for
rainy season, son, during rainy season, production the next
start of cold the rainy start of cold cycle) produc-
season and season, season and tion cycle)
during the start of cold during the
cold season). season and cold season).
during the
cold sea-
son).
At the 4 litres / 3 litres /
start tree 1.5 tree 1.5
of the months months
fructifi- after the after the
cation 2nd appli- second
cation applica-
tion
*The recommended doses for millet and surghum, are based on the results from the first tests in Torodi. In Aguié the dose has
been 0.5 litres, fractioned into 0.25 litres per application. This is aligned with the local recommendations for urea as a source of
nitrogen.
51
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
References
ADB (1998) Gender Guidelines in Water Supply and Drechsel, P., Giordano, M., Gyiele, L. (2004) Valuing
Sanitation. Checklist. Asian Development Bank, Nutrients in Soil and Water: Concepts and
Manila. Techniques with Examples from IWMI Studies in the
Developing World. IWMI Research Report nr 82.
Arroyo (2005) Organoponics - the Use of Human Urine International Water Management Institute, P O Box
in Composting. RUAF Urban Agriculture Magazine 2075, Colombo, Sri Lanka.
10 - Appropriate (Micro) Technologies for Urban
Agriculture. http://www.ruaf.org/sites/default/files/ FAO (2003) FAOSTAT Nutrition data – Food Supply –
Organoponics.pdf. Crops Primary Equivalent. http://apps.fao.org/page/
collections?subset=nutrition , visited 2003-02-28.
Bernal, C.T., Bingham, F.T. and Orehi, J. (1974) Salt
tolerance of Mexican wheat. ll. Relation of Variable Ganrot, Z., Dave, G., Nilsson, E. (2007) Recovery
Sodium chloride and length of growing season. Proc. of N and P from human urine by freezing, struvite
Soil Sci. Soc. Am., 38: 777-780. precipitation and adsorption to zeolite and active
carbon. Bioresource Technology 98, 3112-3121.
Brady, Nyle C., Weil, Ray R. (1999) The nature and
properties of soils: twelfth edition. Upper Saddle Gao, X. Zh., Shen, T., Zheng, Y., Sun, X., Huang, S.,
River, NJ: Prentice Hall. Ren, Q., Zhang, X., Tian, Y. and Luan, G. (2002)
Practical manure handbook. (In Chinese). Chinese
Båth, B. (2003) Field trials using human urine Agriculture Publishing House. Beijing, China.
as fertilizer to leeks (In Swedish). Manuscript,
Department of Ecology and Plant Production Germer, J., Sauerborn, J., (2006) Exploring the Potential
Science, Swedish University of Agricultural for Recycling Nutrients from Waste Water to Enhance
Sciences. Uppsala, Sweden. Agricultural Productivity - the Example of Valley
View University in Accra, Ghana. Presentation at the
Clark, G.A. (2003) A test of the production of organically Tropentag 2006 - International Research on Food
fertilised amaranth in Tehuixtla, Morelos, Mexico. Security, Natural Resource Management and Rural
Manuscript available from esac@laneta.apc.org. Development. University of Bonn, October 11-13.
Coulibaly, Chiaka. (2009) Management of EcoSan Guadarrama, R. O., Pichardo, N. A., Morales-Oliver,
System in Urban Areas: “EcoSan_UE Project E. (2001) Urine and Compost Efficiency Applied to
Case Study’’ in four sectors of Ouagadougou, BF. Lettuce under Greenhouse Conditions in Temixco,
Presentation to the West Africa Regional Sanitation Morales, Mexico. In Abstract Volume, First
and Hygiene Symposium, Accra, Ghana, 10-12 International Conference on Ecological Sanitation
November 2009. 5-8 November 2001, Nanning, China.
CSIR (2008) Human Excreta and Food Security in Hammer, M. and Clemens, J. (2007) A tool to evaluate
South Africa. Project report Nr 59P1039, Submitted the fertilizer value and the environmental impact
to L Austin, CSIR – Built Environment, PO Box 395, ofsubstrates from wastewater treatment. Water
Pretoria, South Africa, 0001. Science and Technology 56 (5): 201-209.
Dankelman, I. (2009). Making Sustainable Sanitation Heberer, Th., Fuhrmann, B., Schmidt-Bäumler,
Work for Women and Men. Integrating a Gender K., Tsipi, D., Koutsuba, V., Hiskia, A. (2000)
Perspective into Sanitation Initiatives, eds. J. Occurrence of Pharmaceutical Residues in Sewage,
Muylwijk, C. Wendland and M. Samwel. Utrecht, River, Ground and Drinking Water in Greece
Annemasse and Munich: WECF, Women in Europe and Germany. In Symposia Papers: Issues in the
for a Common Future). Analysis of Environmental Endocriine Disruptors.
52
s to c k h o l m e n v i r o n m e n t i n s t i t u t e
American Chemical Society, San Francisco March in Swedish, English summary in Appendix 2. www.
26-30, 2000. nmr.org.
Heinonen-Tanski, H., Sjöblom, A., Fabritius, H., Marschner, H. (1995) Mineral nutrition of higher
Karinen, P. (2007) Pure human urine is a good plants. Academic Press, Second Edition.
fertilizer for cucumbers. Bioresource Technology,
Volume 98, Issue 1, January 2007, Pages 214-217. Mkeni, P; Jimenez Cisneros, B; Pasha, M; Austin, L.
(2006) Use of Human Excreta from Urine Diversion
Jeyabaskaran, K.J. (2010) Utilization of human urine Toilets in Food Gardens. Agronomical and Health
as liquid organic manure in banana cultivation. Aspects. Volume 3, Report to the Water Research
National Research Centre for Banana, Tiruchirapalli Commission. WRC Report No 1439/3/06.
– 620 102 Tamil Nadu, India.
Morgan, P. (2003) Experiments using urine and humus
Johansson, M., Jönsson, H., Höglund, C., Richert derived from ecological toilets as a source of
Stintzing, A. and Rodhe, L. (2001) Urine separation nutrients for growing crops. Paper presented at 3rd
– closing the nutrient cycle. Stockholm Water World Water Forum 16-23 March 2003. Available at:
Company. Stockholm, Sweden. Available at: http:// http://aquamor.tripod.com/KYOTO.htm.
www.swedenviro.se/gemensamma_se/documents/
Urinsep_eng.pdf. Morgan, Peter. (2008) Toilets that make compost. http://
www.ecosanres.org/toilets_that_make_compost.htm
Jönsson, H. and Vinnerås, B. (2004) Adapting the SEI 2008.
nutrient content of urine and faeces in different
countries using FAO and Swedish data. In: Ecosan – von Münch and Winker (2009) Technology Review
Closing the loop. Proceedings of the 2nd international - Urine diversion components: Overview of urine
symposium on ecological sanitation, incorporating diversion components such as waterless urinals,
the 1st IWA specialist group conference on urine diversion toilets, urine storage and reuse
sustainable sanitation, 7th-11th April 2003, Lübeck, systems. Available at: http://www.gtz.de/en/
Germany. Pp 623-626. dokumente/gtz2009-en-technology-review-urine-
diversion.pdf.
Kirchmann, H. and Pettersson, S. (1995) Human urine
– chemical composition and fertilizer efficiency. Muskolus, A. (2008) Anthropogenic plant
Fertilizer Research 40:149-154. nutrients as fertilizer. PhD thesis, Institut
für Pflanzenbauwissenschaften, Humboldt-
Kvarnström, E., Emilsson, K., Richert Stintzing, Universität zu Berlin, Berlin, Germany. URL:
A., Johansson, M., Jönsson, H., af Petersens, E., http://edoc.hu-berlin.de/dissertationen/muskolus-
Schönning, C., Christensen, J., Hellström, D., andreas-2008-04-18/PDF/muskolus.pdf.
Qvarnström, L., Ridderstolpe, P. and Drangert, J.-
O. (2006) Urine Diversion - One Step Towards PUVeP (2008) Philippine allotment garden manual with
Sustainable Sanitation. Report 2006-1, EcoSanRes an introduction to ecological sanitation. Periurban
Programme, Stockholm Environment Institute, Vegetable Project (PUVeP), Xavier University
Stockholm, Sweden, http://www.ecosanres.org/pdf_ College of Agriculture, Cagayan de Oro City,
files/Urine_Diversion_2006-1.pdf. Philippines, http://puvep.xu.edu.ph/publications.htm
or http://www2.gtz.de/Dokumente/oe44/ecosan/en-
Larsen, T. A. and Lienert, J. (2007) Novaquatis final philippine-allotment-garden-manual-2008.pdf.
report. NoMix – A new approach to urban water
management. Eawag, Dübendorf, Switzerland, Pradhan, K.S., Nerg, A., Sjöblom, A., Holopainen, J.,
www.novaquatis.eawag.ch/ publikationen/final_ Heinonen-Tanski, H. (2007) Use of Human Urine
report_E. Fertilizer in Cultivation of Cabbage (Brassica
oleracea)––Impacts on Chemical, Microbial, and
Magid, J. (2006) Estrogen in the Environment. In: Flavor Quality J. Agric. Food Chem., 55 (21), 8657-
Blackwater systems – Nordic Inventory. Full report 8663• DOI: 10.1021/jf0717891.
53
p r ac t i c a l g u i da n c e o n t h e u s e o f u r i n e i n c r o p p r o d u c t i o n
Rodhe L., Richert Stintzing A. and Steineck S., (2004) Thorup-Kristensen, K. (2001) Root growth and soil
‘Ammonia emissions after application of human nitrogen depletion by onion, lettuce, early cabbage
urine to clay soil for barley growth’. Nutrient Cycling and carrot. Acta Horticulturae. 563: 201-206.
in Agroecosystems, 68:191-198.
Tilley, et al., (2008) Compendium of Sanitation
Schouw, N.L., Danteravanich, S., Mosbaeck, H., Tjell, Systems and Technologies. http://www.eawag.ch/
J.C. (2002) Composition of human excreta—a case organisation/abteilungen/sandec/publikationen/
study from Southern Thailand. The Science of the compendium_e/index_EN.
Total Environment 286, 155–166.
WHO (2006) Guidelines for the safe use of wastewater,
Schroeder, E. (2010) Marketing human excreta, a study excreta and greywater use in agriculture and
of possible ways to dispose of urine and faeces aquaculture. Socio cultural, environmental and
from slum settlements in Kampala, Uganda. GTZ, economic Aspects.3 (7). World Health Organisation
Eschborn, Germany. (Online access 2006-10-26). www.who.int/sites.
Schönning, C. and Stenström, T.-A. (2004) Guidelines Villa-Castorena, M., Ulery, A.L., Catalán-Valencia,
for the safe use of urine and faeces in ecological E.A., Remmenga, M.D. (2003) Salinity and Nitrogen
sanitation systems. EcoSanRes Publications Series, Rate Effects on the Growth and Yield of Cile Pepper
Report 2004-1, www.ecosanres.org/pdf_files/ESR_ Plants. Soil Science Society of America Journal
Publications_2004/ESR1web.pdf. 67:1781-1789. Soil Science Society of America.
Simons J. and Clemens J. (2004) The use of separated Winker, M. (2009) Pharmaceutical residues in urine
human urine as mineral fertilizer, 595-600; in (eds.) and potential risks related to usage as fertilizer
Werner et al.: ecosan-closing the loop, 7.-11. April, in agriculture. PhD thesis, Technical University
2003, Lübeck, Germany, ISBN 3-00-012791-7. of Hamburg-Harburg, Institute of Wastewater
Management and Water Protection, Germany, http://
Sridevi, G., Srinivasamurthy, C.A., Bhaskar, C., doku.b.tu-harburg.de/volltexte/2009/557.
Viswanath, S. (2009) Evaluation of Source Separated
Human Urine (ALW) as a Source of Nutrients for Vinnerås, B. and Jönsson, H. (2002) The potential of
Banana Cultivation and Impact on Quality Parameter. faecal separation and urine diversion to recycle plant
Journal of Agricultural and Biological Science Vol. nutrients in household waste water. Bioresource
4, No. 5, September 2009 ISSN 1990-6145 ARPN. Technology 84:3, 275-283.
Sridevi, G., Srinivasamurthy, C. A., Bhaskar, S. and Vinnerås, B., Palmquist, H., Balmer, P. and Jönsson, H.
Viswanath, S. Studies on the effect of anthropogenic (2006) The characteristics of household wastewater
liquid waste (human urine) on soil properties, and biodegradable solid waste—A proposal for new
growth and yield of maize. Crop Res. 38 (1, 2 and Swedish design values. Urban Water, 3(1): 3-11.
3) : 11-14 (2009). Department of Soil Sciences and
Agricultural Chemistry University of Agricultural
Sciences, GKVK, Bangalore (Karnataka), India.
54
SEI - Africa
Institute of Resource Assessment
University of Dar es Salaam
P.O. Box 35097, Dar es Salaam
Tanzania
Tel: +255-(0)766079061
SEI - Asia
15th Floor Witthyakit Building
254 Chulalongkorn University
Chulalongkorn Soi 64
Phyathai Road Pathumwan
Bangkok 10330
Thailand
Tel: +(66) 22514415
SEI - Oxford
Suite 193
266 Banbury Road,
Oxford, OX2 7DL
UK
Tel: +44 1865 426316
SEI - Stockholm
Kräftriket 2B
SE -106 91 Stockholm
Sweden
Tel: +46 8 674 7070
SEI - Tallinn
Lai 34, Box 160
EE -10502, Tallinn
Estonia
Tel: +372 6 276 100
SEI - U.S.
11 Curtis Avenue
Somerville, MA 02144
USA
Tel: +1 617 627-3786
SEI - York
University of York
Heslington
York YO10 5DD
UK
Tel: +44 1904 43 2897
sei-international.org
ISBN 978-91-86125-21-9
Practical Guidance on the Use of Urine in Crop Production Richert, Gensch, Jönsson, Stenström and Dagerskog SEI
Toepassingsmogelijkheden voor urine in de landbouw
in Friesland
" ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, $
* (
,,,,,,,,,,, "!
*,!
0
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "!
*," = 0 ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ""
*,% ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "%
*,' > ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "%
*,* 6000
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "'
*,- ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "*
*,) <
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "*
*,$ >
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "*
*,: 3
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "*
*,!# 7
&
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "-
*,!!
0,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "-
*,!" /0
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "-
*,!% ?
,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, "-
*,!' 40,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ")
*,!* .,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, ")
#%&''"$
( %
)*
: C
0
#%&''"$
( '
)*
#%&''"$
( *
)*
#%&''"$
( -
)*
,
3
00
0
0,(
0 A
,< ,
400,0 00
0 0
0
,
00
,
> 00
00 ,6 00
/0 ;74 /
E 0
,<000 0 0
0
0A
+ /3.&(.,
E
D
2
0 00
00
0,
E
0
00
000
A
L @
M,
0
0D
•
0LM
LM,2
0
00
=
> E ,
• + ;74 0 L
M
,E0 0
A
= < ,
• L
& M A
00
L 0
&
B
M,
0
0
,
0;74 (.
0
,
• (4A
00
A
A
0 0
0 ,
0 0
3
/
+ ,
<
0A
=4++0A
0=&+ ,
400
N
00
,
#%&''"$
( )
)*
#%&''"$
( $
)*
#%&''"$
( :
)*
3
I0
)
D
0
D
• /0 1
• 0 0 L
M
1
• /
L 0M
L
M
0 1
• 400&
0
1
• 0
L 00
@
,M1
!
"
#
0
D
• /000
0
1
• 0 0 L
M 1
• 400&
0
1
• 0
L 00
@
,M1
• / 0
1
$"%
%
&'
0
D
• / 00
@
1
• /
0
1
• C0
01
(
")
*&
0
D
• /00&
0 01
• /0
L;?6M 1
• /
0
1
• 0
1
• 0
1
#%&''"$
( !#
)*
0
D
• /0
0LM
12 1
• 0
1
• /00
01
• /0 !
1
>
0
0,<
+
A
,00
,40
0
,
/
O 0
,
#%&''"$
( !!
)*
*
.
/01%
2
)%
!
% 334
(
0
0 0
L M
,E
L3
+
M
0A
,
A
A
LM 0
,7
0
,
( 5
>
A
0 ,/ 0
0
,
,
,
#%&''"$
( !"
)*
0 8'9,
3
K
8!9,0
0 008'9,
5
,E0I
8'9,
0
AK
08"9,4
0
0 0
,20
,20 D
• 0
0
0Q
• L MQ
• L
M,
< , ,
8"9,
,
/
00
0
0,
0
K
OL M8"9,
#%&''"$
( !%
)*
(=
0
0
,
','," +
30 +
I
,+
0
L M, K +
A
!L <'M,3 0 +
00
,
KL 0M
8-9,
+
,,3 0
0,
( (+
K8!"9,
0+
00
0
,0 +
0
0 ,4
8-9,
<
TT
'- 0 L
M
8$9,
#%&''"$
( !'
)*
.
#%&''"$
( !*
)*
#%&''"$
( !-
)*
#%&''"$
( !)
)*
""4
A
"##%,
8*9 D&&,
@ , ,
"##$,
8-9 <%
6
% "##$,
8)9, +?4(2-: "##) ,
A ,
8$9 +?4(2)# "##$ ,
A ,
8:9 C
"
*E 2 -% C
"##) D&&, ,
8!#9 !
)"##)
D&&, , ,&
8!!9 9
%
;<F#
4
6,?
( 000( Z4
+
6> (
,
!!"*"'- X "##",
8!"9 = A.
=, 5 , ; , *
D / 3
6
>
+
C
!"#$%"
""& '
()**+,/ "### ,**A$#,
8!%9 6 "##!,1
%
%
,
6
":,
8!'9 9
"
X,+ ,+
X,? ( 3
< /
S /
EA// / D&&,,
"##$,
8!*9 7
D&&,,0&
&
& "##$,
8!-9 =
E
2,= ,X, C,7
%#
"##$,
#%&''"$
( !$
)*
(3 G%
=
/7
=
7 <! ; 0
L M
8!*9
7 " *&
6 " "&
7 # !)&
( ! "&
+ # !%&
? # %#&
C * "[&
C # $"&
7 <" + 08!-9,
#%&''"$
( !:
)*
#%&''"$
( "#
)*
!
G
<0
G.
4% 334
+ )
E
0
0
( =L7 !M,
K 00
,L50 ,M]
KO
,C0A 0
A 0,40
0 Q
0 A
00A
0
0 ,3
00
,
0 0A
,= 0
O:#
+
A
K
,= 0AI
=
(L!::*M
,
A0L
A
M
$#R,
A
0 )R
0
0,
="E(4',2
2@ ,L!::$M
A0
-$R
,+
0 ,L!:::M
A0
,. L"##'M 0
0
A0
0
,>]OA
0
EA7 0 ,L"##)M
00,5 00
0
A0
00
L
0M,5
0
00,EK
D
,
7 L AM 7 ( 7 =
& & &
",*L","M #,!) !," 2= +
"##! +
%,)L%,'M #,%# !,# 2@ ,!::$,
)A: !:$-L
M
!,):A",-! #,"#A#,"! #,:A!,! =
Z(!::*
!#,% #,-: !,*-
/ !::%EA
7 0"##*
#%&''"$
( "!
)*
0
-
#%&''"$
( ""
)*
0
-
00
000
L
M @ A
L
M,6
00
0A
A]
O,<
0 00A0
A
,20 00,>
G
0
G 0 0 0
L23
M ]0
O
]00O
,
000
A
0
0
,
0
,
E
0
0
A0
00(0
0 0
0
0
,L
0
,M
00
A
00
0
,5 0
0
00
00,
+$ )
0
,4 0 00 A
00
K 0
0 0L C M
0
A
0 ,
0
,7
0
A
#%&''"$
( "%
)*
0
-
> 0
L
0M, 00 00
0,
(
K0
0
0,<
0,0
00 ,E 0
A
0
0
]
O,7
0
A
0Q
A
,C A
O0 0
0, 0
A
0
A
,2 00
0L](A
OM
00
0 00,40
] O
0 00
,+ 000,
<
0
A
,
.
06,;,+L(.M
K
,]O
0
0
0A
0
0
0A
0
00,5
0
0,>
0
0
,
6
00
G 00A
A 0 ,
++ &
%
000
A
0
0
,40
0
0
,K
0
0 0,4A
0
0
0
,40 00
K 0
] 0O,
;
A
00,
00
0
Q0 000 , 0
Q
000
L M0 0 LI 0 M,>
00 0 0
0 ,
400
0
0L]
A
OM0Q 000
0]O
L A
M0,E0
,>
0,5
,2
00A
G 0A 0
A
,6
,
0
0,> 00
0 000
,
#%&''"$
( "'
)*
0
-
+, C
E0 A
0 A,>
, ,
,4
0
A
0 A
A
000
, 7 A
0
A
K ,> 0 A
0
A ,< A
0
A
0,40 ,,,
0 A
O
0Q0
000,
+- G
6
0
A
,E0
,
,
0 ,3
0
0,70
0
,
5
0
0]
O
,6
0
,
+4 .
00
A
0
,
0
00,; 0
0D
B
0,
0
0,7TT
0
L. , "##'M,
2
0
0L
M
0
0
0,E0
= ; ?L!:-)M
> CL"##-M
0
0 ,> A
GA0
G00
A
0L= ; ? !:-)M,>
,
+A 7
%
20
A
,E0
L& M
A
?D
,<
,2
00A
0
,2
0
00,E
,,, ,? 0
A
0,0
0L
,
M
,
]
O
0000,
#%&''"$
( "*
)*
0
-
+3 9
:
7
C40
L; , "###M,4 ]0
0A
0O(
0 ,L
0
,M
0
,40
0
,C ,L"##%M
;?60
(
0A
K
0
,E00
L
!#M
K 0%*CX0
0A
A
,0-
,
ENX L!:::M
0
,
0B 000
0
,
=
A
TO
0 0
00
0 0,
40, ,
K
0
,
E ?L"##)M000
A
0
00
I
,50;?6&C
7 0 L"##)M
0
,
+ ;
4
]
0O 00
,2
K 0
,
00 0
,5
0
0A
0
00
0
K
0 0
L M^^0,
+
%
L3
CM 0
A
,>
,2 A
L> 0 "##$M
3
C,>
I A
00
]
O
L
,, (=M,0
L%"M
,>
0 00A
0
,
+$
E
0
0
0
0,>0
0
0
L
,C , "##%M 0
0L M 0 A
, 00I
0
0
0
00,2
0A
L0 I
,M,
#%&''"$
( "-
)*
0
-
#%&''"$
( ")
)*
0
-
#%&''"$
( "$
)*
' (
)#
#%&''"$
( ":
)*
' 1
00
@
,
5 00
G
A
G
0 L3D6@
5 D
(
5 M,
E
V5V
00
00 A ,E
0
0D
0
,2
Q
0
,5
,
]57O0
A
0 @
Q O
,
6@
5
< /L
; E M
@
,>
/
4C
@
, 0 ,7
,7
A
E + ,7
,6 ; 2
0
,
,( D
'
5
@
, 00
@
0
,
0
0
,6@
0 0,C
@
0 0
0,E0
0A
,= 0
00,
#%&''"$
( %#
)*
' 1
>
6
,, &
5
0 00 ,
<
000 0
,
E0
O A
,>
0
0A
0L
M ,
#%&''"$
( %!
)*
' 1
4
0
0
A
,<
0,<
0,70
,5
A0
0,E
0 0 ,6
0
0
,<
0
0G
G
,
,-
00
@
0
,E
0 0,2
0
A
0
,E
0
0
@
0,
000
,>
00
0
,
,4 G
. D
• 6@
5 D
(
5
• ;>? H> 0 1J"!"##$
• ?,X,<X,E,X H0
00
0
0JL"##)M
7
0
D
• ,X,C 6@
• ,<,=
• ,2,X,
• ,,+
• C,,0 6@
#%&''"$
( %"
)*
* +
!
- LEN !::$M,
7
A
E
:
L
M,E
00
0 0,
-A
0
0
,
0L M0A
, 0
A
000 ,2
-A
K0 0 0 ,>
K
0 0 A
0 LM0
,
20
0
0
0,> 0
0 ,
#%&''"$
( %%
)*
2
'
!,7
I+
0 5
%
0
%#
00 00
!R0
A
!##0,
6 0 I 0
,
3
L, ,. "##$M0 00
0
CI
,
00 A
0
TT 0,E
00
000
0
0
0 0
,
0
,
0
0
L 0 A
#%&''"$
( %'
)*
2
'
-( 9
9
> 00
0
L
M,
,
E 00
0
,
- I %#%,
-+
E
L
K
M 0
,4
0
0A
00,7 !
,
E
S
00
0
,E0
0
A
0
,E0
'##CX% ,
2]3 E
O 00
5 ;6,
0 0
A
A ,E
0
0 ,
0
0
0 0
,<0
.Z
A
+74/6
00,
2 00
00
L0M,E I
LC4M
,40
I
,40
0
A
,
7 !,C
> A
2
0
+ .,
LCX&%M
LR
M
S <
0 *R '##
C
3
; "*R !!##
, "##-
40 ; "#R*# !%##
3
;
5A
L
A 00A \!#R
M
(
C4
<
0
LCAEA(4'M
-, 9
2
0
0
0 A
,5
0 0
L; Z !::-M,
0
,0
0 A
0,
5 0
,
A
0
,
20 0
0
,
0
0,
20 00
0
0 0L M,
#%&''"$
( %*
)*
2
'
2
K
A
- 0
,6LM
0,E
,
-- <
E
A
00 ,2
0 D
3 4
K
000
A
,4
0
0
0 0
KLA
276M,
?
A
A
,C
0
0 0,
-4 8
#
E
0
0
,
0
0
0,E0 0
0
,2 0
HA
J,
0
0L"M,
0
0
*A!#c,
>
00;
A
00 0L"##%M,
0
0
,2 0
0
0,
",
L/0 M
#%&''"$
( %-
)*
2
'
-A 9
2 0
0
0 00
,40!
0("-A!'
'#%,3
0
*#CX0
00
L;0 , "##$M
0
# -*CXA0
A
0
0
!("-A!'0
0 0
,
0
,E 0
*##0,<
0
0 ,2
00
,
0,
%,2
0
!("-A!'0
A
L0A M,
-3 &
CI
0
0 0 A
O,
D
• >
0
0,
• C
,
• .O 0 0 & O
,
• .O0,
#%&''"$
( %)
)*
2
'
20
I 0
D
• <
0
I
0 ,
• 4
0 0
0 L0
M
A,
•
0
00,
• 7 0
0
0 , E 0 0
0 ,
- F
/
E
0L M
,
0
, I
0
0
*##0,2
00
,
0,
0 0 ,
S
0
,
2
A
03 E
0 0
A
0,
6
,
E 0 0
0
,
0
0,/ 0 00A
0
,
- )
;L"##%M+
,C 7 -L!!MD''A'$
EN?, +7,6, XE, +6,L!::$M2
A ,/ +
7
%$L-MD!)A"*L:M
; 7,6, /,L!::-M+
L M,/ +
7
%'L%A'MD$)A:'
;0 6,X, E,+,d >,< ,7,/ ,2
0 7,= ,= (,
7
.,=
=,,? ,"##$,<2++D<2++ Q;A?
2 26 C?A2 <,
,"##$,%,#,
,,,,3
0 A;
,
C C (0/, ; 7,6,L"##-M7
A ,
/ .
'#L!)MD%!*!A%!--
. X,E, 2,= C,= 6,<A
< 6,C (,(0 .,
L"##$M,C
D I ,(
?
]+ ? O !:A"#,
+
0> L"##!M,3 G
,
#%&''"$
( %$
)*
2
0
)%
D
G
2 334
4 7
;
00
"##*
,
K
0
0
B A
!"#B ,
"##:
L/5 !"#M
0
L/
.ZX":M
0LC 0
<I
*#M,6"##$ 0
A
,<
0 A
0,2
0
A
< !,
2
0A
0
,0
0
0
0
,0
A
E ;
> L+74A
/6 "##"M 0C
0L "##*M
0
/ L&;6 "##)
"##$M,
0
A
@ 0 ,
0
/ L.
"##$M,
4 F
"
00
,2
0 A
,0@
0
0,E
A
,0
0`%##A*##
I 0
LI
M, 0 0
0
,
#%&''"$
( %:
)*
5
6
!,>
K L
]O
M L
0
0M
0
0 ,
-*R0 ,00
`*# ##
`* ##
0
,(
" *0# ")0(
L
" * e
%# %(Q $*RM,4
0
0 0`"A
`"#0,
0
0
A
`" ##f
!f&
,<0 0
0
,6 00
0
0
K`! ##`* ##f,
4$ G
"
K
A
0
,6
0
0
,
L0M
,<0
0 A
,E
0
0
"# L !*
%*
M 0
)f
0 A
0 ,4 *#f
0
0 !*R
,
0
L`! *f0 `!# *# M
0 0,>
0
# *# )*0/&f0 0 0A
0
,
E
0
A
0 ,
O
,
>
0 I *#R
,40
0 0
0
,
6 0
0
0
0 0
TT
`!# ##L
M,
#%&''"$
( '#
)*
5
6
#%&''"$
( '!
)*
5
6
,0
3
78*(49*9::),
%&*;4
;3%()
+74/6L"##"M,+
G
,+74/6"##!A%: 3
"##",
4- G%
(
D750
; D
+D"##*
4
D
0 %##A
0*-
"*
,
(
D+ ? ;
; D40
+D"##'
4
D$$
A
,
(
D=N
; D5
+D"##"
4
D"*#
#%&''"$
( '"
)*
5
6
(
DE(
; D5
+D!::$
4
D%"
(
D(
0
; D5
+D!::-
4
D*!
(
D200N
; D5
+D!::-
4
D!$
(
D3N
; D5
+D!::*
4
D''
#%&''"$
( '%
)*
,
20 0
5 5,
@F,4
0
00,
E 0
0 0
0
,
0
0 ,E
I
/0A
/ ;74A /3.&6
E ,
#%&''"$
( ''
)*
7
'
'
CI
5 0
,2T0
]
O '' ,
0
B
00
00,
5A
0
B
CI
0
,
E
CI
A
C $#R
)%R
0,700
I 0
,40
0
,
5
$'R "R !'R
CI1
#%&''"$
( '*
)*
7
'
'
:,%,"
0
0
0
0,
,
%,E
L
0M0
#%&''"$
( '-
)*
7
'
'
0,>
,
7
A
0 Lg$#R
M,>
#%&''"$
( ')
)*
7
'
'
5
'"R *$R
1
#%&''"$
( '$
)*
7
'
'
< 0
,>A
0
#%&''"$
( ':
)*
7
'
'
CI
G @
+ ,
/ +
7
*'L!!A!"MD'#%A'!",
( A/ ?, 6,+
N ,/ X,C
0 7,6,; L"##%M
,/ +
7
'$L!MD
*)A-*,
( 7W0ZEW0 XNL"##)M,4
,
#%&''"$
( *#
)*
7
'
'
AA G%
;
<
'J
E(
200 ]( O
,3
]CIO
0
L"M,A
0A0
0
A
0
00,
C0
0 0 LM0 A
L!M,400
,3
!R
0
, 0
,
0
0
,4
CI 0
"!R
!!R
"#R
*%R
"-R )#R
3
$#R
!, <
0
E( 005,E !#,###CI
A
0
,
/A
I
C"##*,2 0
CI,C
( 00 L, ,7 X6 M,
+ 0
00
0 0,
>
( 0
L
M
0 00
,4
)#A:#R
,
.
0
,EC 0<I/
6 C "##)
C A
A
,E
0 A0A
0
0
C
0,2
0
, 00
CI0 0
0,
2=
/ ,
#%&''"$
( *!
)*
7
'
'
5
0
0 0
,E0 0,A
0 0,>
0,
0 A
K
A
,/ 3
0
A
,300
A
0
0
00,20
.Z
00,
", CI/ 6LD6 CM
I+
0 5
#%&''"$
( *"
)*
7
'
'
A3 G%
&
K
'J
@F
0
#%&''"$
( *%
)*
7
'
'
A G%
$0
)%
L.
;1B
M
:,!!,! 5 D
• 6
0
L,,
,
M
0
0
,4, ,6
,
• 6,
• 6
00
0,
• 6
,6
,E0
1
• 60 1P5 i(
i,
• 6 000
0
@
0 1
• <
,
• 00,(0
0,
,
•
0 0
0
L
M
,
• 0
0
0
,
•
,
•
K
• 2
0 0Q
,E
,,
,
,,
,
0
,
• 0,
•
,
• E 0
0A0,6
A
,
• E
0
,
• E
0 00
,
• E0 V0V0,
• E00 ,C 0
0,7
0
0,
• 00 0
A
,0
00
A
0
,
• 00
K0
,6
0
0
,0 0
,
•
0,
• X 0 0
0&0
0 0 0
• X
0 ,
• X 0
A
,
0
0
,
• X
LM,
• X
V
,
#%&''"$
( *'
)*
7
'
'
A
0,
• 4 K 0
00A
,
• ( D0
L
0 M
K
• +
,
• +
0
0,
• >
K
,,
• >,
• / 0,70 0
,
• / 0
,
• / 0
0
0
0
,
• /
A
0
#%&''"$
( **
)*
7
'
'
#%&''"$
( *-
)*
!#,",! =
=
0 0,20
/> E A
; 000
+ ,5 00
04++,60 ?
0L
00M0E
; 0000
+ ,
00
00
TT
, 0
/3.73
0
0
,
0
,
#%&''"$
( *)
)*
0
!,
F5;;=
=
!,0
!#,"," 6
4
,
0 0
0 0
L
M
L M,
0,E
0
A
,<
A
0 ,E0 0
0
0
00 A
,
,
0
0
,6
0
,5 6;
O'%
,
",
&&;G8D
g-#
<
+ &
2
.
0
, 50
4
L605A
E M
#%&''"$
( *$
)*
400 0
000
0
A
0 0, 0 !##00O
# ""*%
,3 0
0%
,20
!## 0O!%
,
"
0
,
20 0 ,
L+00M
0 A
,
C
0
A
0 0
0
A
L2
A&IM,30 0A
,L 0E 0'G-%A
M
!#,",% 6,
.0 L
M
0D
•
L
A ,
• L &
M,
• 6@
,
• <
,
&CN59
6
6@
%,
%
0
0 0,
50
0
0,
% 0
@
A
,
<
,
0
0 Q A
0,
,
#%&''"$
( *:
)*
!#,",' 6
,
ET 0
(
+
?
+
(
'D
3$ =
6
0E G; GE ,
00
,
0
00
0
00
,C
@
0
,
0
0
L
M0,; 0
0
,
+ A
,6 0 / /A
0 00
+0,
+0
+0
,5
00
+ A
,
? E I 0
000
00
A
+0,40+00
0
, 0
A
0 00
,
#%&''"$
( -#
)*
+0
0
,
,
= 0A
#%&''"$
( -!
)*
&1
*
&C/
G *
&C
G%=)%
& 334
=
0,E
<44CL<4
4
CM
,3
0 L0
0M L
M,2
A
0 0
,EA
,
0
+74/6;6,
0
0
0
L
M
0
,E0
0
I
0K
I
<44C,
3
00
A
,E0
<44C ,4
00 0
,0
A
0
L
00M
,
400 00
Q
,7
A
,
G
8
8
1
G881
>
0
<44CL<4
4
CM,2
00,
2
<44C
! !::%0 ,E00<44CA!::$
23,5 I
0 0
.
A
<44CA
A ,
7 " I
23
$-&")$<44C,7
0 0<44CA
,
#%&''"$
( -"
)*
/
;
'
6 -
23
$-&")$ <44C <44C <44C
5
5
? 5
4+ A *#R
+ "#R
+ "#R
+
? "#A'# ! "* ! # )
? A )* *# *#
? !###A!)*# )* -# "*
E !-A"* # )* # % # "
%##A'## %# "# !#
( )*#A!"## !## !## -*
5 "*##A'### %## "## )*
6 A !* !* *
N
<44C
0 0
O
A
,
N
7 %A?
(
"##!A
"##*L?<+ "##)M 0
LC< "##-M,
3LRM
LRM LRM
? # - * ' :' !
? # % # ) :: #
? ! ' !* % $% %
E % # '- ! *! #
# % % - :- !
( # #- # -- :: "$
5 # ! "' ' )* *
6 A A A
#%&''"$
( -%
)*
/
;
'
6 -
7 *A?
0LE<
0 "##"M,
3
C&0+ &0 &0( &0+ &0 &0(
? # #" # ! ! # # " - $ "# "
? # " # : !# ! # ' !% % %: :
? ! ) : " !#! ' "" % )%% - "!:)
E # #" # ! ! ' # ' !% : '! *
# ! # - ) ! ! * ': % !') *
( # #% # " ! : # ' !% % '#
5 # ) ' # '% $ "!: )!:% "!*'!
6 A A A A A A
7 -A?
0
$#Y5L( @XN "##%M,
&0 &0(
? ! !G' " - $G"$ -
? !# 'G%' ) !##G"%$
? !!%G)#! )")G'$!#
E \G# ) \G' )
!$ $G%! : !*#G"!:
( !* #G*# # !!'G%'%
5 )*%A"'%$ )-$*G!-)!'
6 A A
D
%
7 $A?
0 &0+L , "##%M,
#%&''"$
( -'
)*
/
;
'
6 -
7 :A?
0
,"##*L M = ,"##-LM
C
<+ "##!L
M,
L , "##%Q (=E M,
A
?
&0 &0(L("4*M &0 &0(L("4*M
? %# - !-! "" ' :% #
? !!-* -!"$ $"$ %'%*
? ""') !!$"% !)#) )#$-
E : % '$ : " $ !! *
*'! "$') !)" )!-
( '%*% "":#% )"' %##-
5 !"!$$ -'!": $")- %'%**
6 A A A A
7 !"A>
"###L , "##%M,
6 >
L!###0M
0 ? ? 5 ( E ?
A
%#: # #$# * :# %" # !! '" # #"' % #- ! '%
? -## # #)) * :* "$ $ " *# # #!# " $$ # *$
4
!*# # #-- % ") !$ ' - -% # #"! " %! ! *%
7
# "" !* ! ): " "# * # #* $ " % *
#%&''"$
( -*
)*
/
;
'
6 -
=
7 !%A?
L; "##)M,
#%&''"$
( --
)*
/
;
'
6 -
3
<0
( (
? # #! # #' ! *% ! '#
? # !# # %* $ '' ) -)
? ! '# * *% !-- % !*% -
E # #! # #) ! :# ! ))
# !) # )) !) #* !* *"
( # !% # -! % %! % #-
5 % "$ !* ") )%: $ ":##
5
<0
(
? # ""G# $* # ''G! $-
? " !'G) !" - *#G!* *
? "% %G!'% $ ') %G%!%
E #G# !* #G# %#
% $'G- ** : )*G!' "
( % #$G!# "* ) %:G"" %
5 !*'G*## *##A!#$-
+
L
[& , M
<0
(
? #,' #,!
? *," !,!
? !$,* ',#
E \ \
",$ #,-
( !,- #,%
5 !':,' %",!
A0 (A0 =(=A+"!A'A)
<0
( (
? ! "% - # #* # #!
? !- # $! ) *: # )$
? * %% !% ! '! # !*
E # #!' # #'* # ##$ # ##!
' "$ !% ' *! # '-
( !! % !# # '! # #*
5 '! - !"* !* - ! -%
6 ! :! " " A A
(("4* (
. > 0 . > 0 .
? ! !' ! #$ " !% ! "' ! -"
? %: : A )' ' A %) "
? *#! !#'$ :%- !"#* !!"*
E A A A A # !-
*! % A :* ) A -' $
( "' " A '* " A !) $
5 :#% "-:# !-$) %#:' !*'-
6 A A A A !# *
#%&''"$
( -)
)*
/
;
'
6 -
A
?
<0
( (
? - % !# * ' - - #
? "%: %:$ !)# ""%
? '-! )-$ %*# '-!
E ! : % " # - # )
!!! !$* %* ')
( $:" !'$: !'$ !:*
5 "':: '!-$ !-:) ""%%
6 A A A A
$ .
%
0
0 0
-*0(
0
,L<D
,M
0
,E0
<44C
,4
00 A
,40
00
,2A
,
E
?
?
?
#%&''"$
( -$
)*
/
;
'
6 -
#%&''"$
( -:
)*
+ G%
#&
"
% 333
L&0M 6 >
L!###0M
? ? 5 ( E ? 0 ? ? 5 ( E ?
+0L M"M "$*
0 0 # %) ! ) - $ " ) # %)# * - %: $ "*! # #:% # '") ! )! # -)$ # #:%# ! '# !# ##
0 # :# % ' !% - * : # ### ) % ) % !) # #!- # #*: # "% # !#" # #### # !% # !%
0 # :# % ' !% - * : # '!# !*: : %%! * !) # #!* # #*) # "% # #:$ # ##-$ " -- * *"
7 0 # !"% # *'" " !) # $)$ # #::$ ' !$ !* -'
L ("4*M -"
-! %# )* " !%-% # ') # ! '*# *!* # :* # ! # #$- # !#- ! :" # #-- # ##"# # )% # !%
*$ !# -- # !"!- # !! ) # #') ':# # :# # - # %%* # %$# ) #! # #-) # ###% " $" # *"
00 % "# "!- # )!# # "%- * # !*% !*":# # $$ # # # ### # ### # ## # ### # #### # ## # ##
(=A (A(=A "' "# *' # ')! # '- * # '"' ")! # -' # '' ! #)' " %:) "# :! " #-' # #!$$ !" #% " $'
!* !# *" # %!! # * * # #'' "-% # '$ # !! # !-! # *** % %" # #*: # ###* " $! # *!
7 ! -*) % '%: %% !- " "*) # ##"* !$ %: ' #!
= L ="4M%M %"
0 # '* # % "$ * "# # # ### * : # # # # ### # ### # #! # ##$ # #### # ## # ##
0
'# # '# # % -# # !! # # ### % ) ) ' " # ##! # ### # !# # #!$ # #### # #! # #!
0
-# # !% # % $ ' ! " # ### # ! % : !$ # ##" # ##* # !* # #"" # #### # ## # #)
0 # #% # % # % ! $ # ### # * ! " - # ### # ##" # ## # #!! # #### # ## # #!
0 # !% # % $ ' ! " # $!# ) ' '* " - # ##! # ##" # #* # ##) # ##'* # #' # "*
7 0 # ##' # ##: # %! # #-* # ##'* # #* # %'
= 0L ,,,M'M !)!
! -* '* # !): # !! % # #!* %" * * # :" # !*" ' !'# !- ') ! #%* # ##!' " :: # '-
0 0 0e0 0 # !: - $ !* # ! ' # ##* # $ ! ) %# # ##- # "#* # '* # #'! # ###" # #" # #*
0 0 0 # %- ' ! *) % !! : # ##* ! # % " %$ # #!' # !*$ " "# # '*- # ###" # #' # !"
0 0 # #' # # "! ! !# " # #!# # $ # - $ # ### # ### # !- # #)$ # ###! # #! # ##
0 0 ! %* '' # !%' # !$ % # ### ) % '$ # ! # ##" # #** # !) # #"% # #### # #! # #-
0 0 ! "* !# # "%) # %: # # ##* %" * * # " # ##" # #!' # %' # #** # #### # #* # #!
7 0 0 # !)* ' *) !: )$ ! -$$ # ##!$ % !! # )!
<D ,
#%&''"$
( )#
)*
6
#%&''"$
( )!
)*
8
00 00
A
0
,
A
K,
E
< I (
0
0*A:R!!A!-R,2
B(
A
0
0
,
20 0000
0B
,
• 20
0,
0
? ? L?"?M
,6
U
>
0,C 0?"?
A
0
0 00,
• L
0M
00
0,
6
0 ,7
L
M0 0
00
0,
0
00
,
•
00
A
0L M,X
A
000 ,
7
0
,A
0
0
,4
0
A
A
0
0
0
,
2
0
0
0 @ A
0
, A
,0
0,
0
00
A
0,
#%&''"$
( )"
)*
8
0
0 , &?"?&
0&
0&
?4"
,0 0 A 0
0 ,7
D
• 0
0
<6O ,C
L 0
M
0 <6O,0
0 0,
• 0
./5A
00
A
./50 ,
A
0L
0
M,
E
0
0
K0
,50
00A
0
,
C 0
K0
0A
0
0,
#%&''"$
( )%
)*
8
,40
0
,
6 C
0
0
,3 0
0
0 0 ,
> 0
0
,L4
0
0
00
00
A
0 ,M
9
? D
• 0 0
•
0L00M
•
0
000
•
0 0
0
000
0 ,
3 0
0
0 00
0
0L0
M
0
0 0,
> 00
D
• 0E G; GE
00
A
@
,6
; ,>0
0
; L/
E M,>
0,
• +0
L227M
00,<0 0
0
0 A
,E
3
/ /Q
0 0
,40+0
0
,
+ H64 E06
J
000
00
0 00,
0
0?"?
00
0
, 0 0
000
,
000
,5
00,
40
LM 0Q
00
K,
$
K
3
00
0
0,(
0 A
,< ,
400,0 00
0 0
0
,
00
,
> 00
00 ,
#%&''"$
( )'
)*
8
#%&''"$
( )*
)*
www.grontmij.nl
Grontmij
Zonnedauw 2
9202 PA Drachten
Postbus 91
9200 AB Drachten
T (0512) 33 52 33
F (0512) 51 02 00
noord@grontmij.nl
Verwijdering van medicijnresten en
hormoonverstorende stoffen uit urine
Quick-scan technieken
Definitief
Grontmij Nederland bv
De Bilt, 17 juni 2005
@ Grontmij , rev.
Verantwoording
Documentnummer :
Revisie :
Paraaf gecontroleerd :
Paraaf goedgekeurd :
@ Grontmij , rev.
blad 2 van
Inhoudsopgave
1 Inleiding.........................................................................................4
Literatuur....................................................................................................10
@ Grontmij , rev.
blad 3 van
1 Inleiding
STOWA heeft Grontmij opdracht gegeven een quick-scan uit te voeren naar
technieken die de medicijnen, medicijnresten, (natuurlijke en synthetisceh )
hormonen en hormoonverstorende stoffen in het ingezamelde (verdunde)
urine vergaand kunnen reduceren. Daartoe is een globale scan gemaakt van
de beschikbare literatuur. In onderhavige rapportage is hiervan het resultaat
gegeven. Als gesproken wordt over medicijnresten worden daarmee ook de
andere hierboven genoemde stoffen bedoeld. Waar specifiek wordt ingegaan
op de andere stofgroepen wordt dat vermeld.
@ Grontmij , rev.
blad 4 van
2 Overzicht technieken
Bij de toepassing van technieken voor de behandeling van urine, zoals voor-
gesteld in STOWA (2005), lijkt de verwijdering van de medicijnresten een
goede nageschakelde stap te kunnen zijn. In STOWA (2005) is een overzicht
gegeven van:
- Struviet precipitatie (niet biologisch). Daarbij komt een vaste stof vrij,
die vrij is van medicijnresten. In de vrijkomende waterstroom bevin-
den zich de medicijnresten. Er wordt geen afbraak van medicijnresten
verwacht.
- Biologische N verwijdering. Daarbij wordt ammonium en ni-
traat/nitriet omgezet in stikstofgas wat vervluchtigd. In de overblij-
vende waterstroom bevinden zich de medicijnresten. Deze worden
door de korte verblijftijden in het systeem naar verwachting nauwe-
lijks afgebroken. Wel vindt verwijdering plaats door adsorptie aan het
slib.
@ Grontmij , rev.
blad 5 van
Overzicht technieken
Ozonbehandeling
Ozon is selectief voor medicijnresten en wordt in gedoseerde vorm toegepast.
Een verwijdering tot 60% is aangetoond (Pronk et al., 2004), waarbij de ande-
re organische stoffen (ureum) slechts deels werden afgebroken. Als nabehan-
deling van een biologische methode wordt verwacht dat ozonisatie nog effec-
tiever is (Larsen et al., 2004). In effluent wordt een vergaande reductie van een
deel van de stoffen gevonden bij ozonbehandeling (Joss, 2004).
UV-behandeling
Met UV-behandeling is veel ervaring als methode voor desinfectie. Als refe-
rentie voor afvalwaterbehandeling is literatuur beschikbaar, voor urine is nog
geen ervaring opgedaan.
AOP
Onder geavanceerde oxidatie (AOP) wordt verstaan een combinatie zoals
UV/H2O2, Ozon/UV, Ozon/H2O2. Het voordeel van deze technologiecombi-
natie is dat bij een juist ontwerp geen schadelijke bijproducten ontstaan. Er is
geen ervaring met AOP voor verwijdering van medicijnresten uit urine. Bij
rwzi’s is een verwijdering van meer dan 90% gemeten voor medicijnen (Ter-
nes, 2005).
2.4 Membraanfiltratie
Membraanfiltratie is een scheidingsmethode op grond van deeltjesgrootte
(micro- en ultrafiltratie) en op grond van molecuulgewicht (nanofiltratie en
reverse osmosis). Geneesmiddelen zullen door micro- en ultrafiltratie niet
worden tegengehouden. Nanofiltratie en reverse osmosis zijn wel in staat om
een groot gedeelte van de medicijnresten tegen te houden. Bijzondere vormen
van membraanfiltratie zijn bijvoorbeeld electrodialyse, waarbij scheiden
plaats vindt op basis van lading van moleculen.
Nanofiltratie
Pronk et al. (2004, 2004a) beschrijft onderzoek naar de verwijdering van aan
urine gedoseerde ethinylestradiol, propranolol, ibuprofen, diclofenac en car-
bamezapin. Van deze stoffen werd 92%-98% door het membraan tegenge-
houden. Ureum werd volledig door het membraan doorgelaten, ammonium
voor meer dan 50% en fosfaat werd tegengehouden. Hierbij blijven twee
stromen over:
1. Geconcentreerde stroom met fosfaat en medicijnresten. Fosfaat kan ver-
wijderd worden door struviet te vormen, waarbij geneesmiddelen niet in
de struvietmatrix worden opgenomen.
2. Stikstofrijke waterstroom waaruit de stikstof geconcentreerd kan worden
tot meststof.
@ Grontmij , rev.
blad 6 van
Overzicht technieken
Electrodialyse
In dit proces worden geladen componenten uit de urine gebonden aan het
geladen membraan. Daarbij wordt de urine opgeconcentreerd. Het concen-
traat kan biologisch verwerkt worden, in combinatie met struvietvorming
voor P-verwijdering. De medicijnresten zullen in het restproduct overblijven
(Pronk et al., 2004). Het lijkt erop dat de zouten in oplossing blijven (concen-
traat) en de medicijnresten adsorberen aan de electrodialyse membranen.
@ Grontmij , rev.
blad 7 van
3 Conclusies en aanbevelingen
3.1 Conclusies
Vanuit verschillende studies is naar voren gekomen dat medicijnen, medicijn-
resten, hormonen en hormoonverstorende stoffen in RWZI’s afkomstig zijn
van de menselijke urine. Een klein deel wordt ook in de feces gevonden. Ge-
scheiden inzameling en behandeling van urine kan de emissie van deze stoffen
naar het oppervlaktewater vergaand reduceren.
Een combinatie van technieken zou een effectieve optie kunnen zijn.
3.2 Aanbevelingen
Over de verwijdering van medicijnen, medicijnresten, hormonen en hor-
moonverstorende stoffen die zich in de urine bevinden is weinig bruikbare
informatie beschikbaar. De beschikbare informatie is versnipperd aanwezig
en tot op heden niet samengebracht in een goed overzicht. Gezien de moge-
lijkheden om met behandeling van gescheiden ingezamelde urine de reductie
van medicijnen, medicijnresten, hormonen en hormoonverstorende stoffen
afkomstig van huishoudens vergaand te reduceren, wordt aanbevolen om een
goed overzicht van de beschikbare kennis op te stellen. Daarbij zal aansluiting
gezocht moeten worden bij enige grote projecten die in Zwitserland, Zweden
en Duitsland op dit moment worden uitgevoerd.
@ Grontmij , rev.
blad 8 van
Conclusies en aanbevelingen
@ Grontmij , rev.
blad 9 van
Literatuur
STOWA (2005). Separate collection and treatment of urine and new poten-
tials for wastewater treatment. Auteur: J. Wilsenach, TUDelft. (con-
cept, druk in voorbereiding)
@ Grontmij , rev.
blad 10 van
lated to the overall project duration: January 1st, 2001 to June 30th,
2004 of the EU-project POSEIDON. August 2004, version January
18th 2005. www.eu-poseidon.com (17 juni 2005).
@ Grontmij , rev.
blad 11 van
Nuttige inzet van urine als meststof voor energiegewassen
3UDNWLMNSURHIWRHSDVVLQJXULQH
]RUJORFDWLH$QGHUHQ
1XWWLJHLQ]HWYDQXULQHDOVPHVWVWRIYRRUHQHUJLHJHZDVVHQ
'HILQLWLHI
2SGUDFKWJHYHUV
672:$:DWHUVFKDS+XQ]HHQ$DV3URYLQFLH'UHQWKH:DWHUEHGULMI*UR
QLQJHQHQ:DWHUOHLGLQJPDDWVFKDSSLM'UHQWKH
*URQWPLM1HGHUODQG%9
+RXWHQRNWREHU
-G:UHYLVLH'
,QKRXGVRSJDYH
6DPHQYDWWLQJ
,QOHLGLQJ
$FKWHUJURQGYDQKHWSURMHFW
'RHOVWHOOLQJLQWHJUDDOSURMHFW
'RHOVWHOOLQJHQRQGHU]RHNVYUDJHQIDVHGHSUDNWLMNSURHI
%HJHOHLGLQJVJURHS
/HHVZLM]HU
6DPHQYDWWLQJFRQFOXVLHVHQDDQEHYHOLQJHQ
,QOHLGLQJ
6DPHQYDWWLQJHQFRQFOXVLHV
$DQEHYHOLQJHQ
-G:UHYLVLH'
3DJLQDYDQ
,QKRXGVRSJDYHYHUYROJ
%LMODJH ,QIRUPDWLHSURHIYHOG
%LMODJH .DUDNWHULVWLHNHQRSVODJWDQNXULQH
%LMODJH ,QGHOLQJSURHIYHOGHQLQIRUPDWLHPHHWRSVWHOOLQJ
%LMODJH 0HGLFLMQHQ
%LMODJH %HPHVWLQJ
%LMODJH $JUDULVFKHZHUN]DDPKHGHQ
%LMODJH *HXURQGHU]RHN
%LMODJH *HZDVRQWZLNNHOLQJ
%LMODJH 4XLFNVFDQOLWHUDWXXU
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJ
'RHOSUDNWLMNSURHI
2SGH]RUJORFDWLH1LMHQGWH$QGHUHQ'UHQWKHLVLQHQHHQSUDNWLMNSURHIJHKRX
GHQZDDUELMRSGHORFDWLHYHU]DPHOGHKXPDQHXULQHDOVPHVWVWRILVWRHJHSDVWRSHHQQDDVWJH
OHJHQJHFUHsHUGSURHIYHOG'RHOYDQGHSURHIZDVRPLQGHSUDNWLMNHUYDULQJRSWHGRHQPHWGH
WRHSDVVLQJYDQXULQHDOVPHVWVWRILQGHODQGERXZHQRPGHLQYORHGYDQXULQHEHPHVWLQJRSGH
RQWZLNNHOLQJHQRSEUHQJVWYDQKHWJHZDVWHRQGHU]RHNHQ(HQQHYHQGRHOYDQGHSURHIZDVRP
LQ]LFKWWHNULMJHQLQGHXLWVSRHOLQJYDQPHGLFLMQUHVWHQHQQXWULsQWHQ
2QGHU]RHNVORFDWLH
2SGHRQGHU]RHNVORFDWLHEHYLQGHQ]LFKHHQ]RUJERHUGHULMHHQNDQWRRUJHERXZHQHHQZHUN
SODDWV'HJHERXZHQRSGHORFDWLHYDQ]LMQYRRU]LHQYDQVFKHLGLQJVWRLOHWWHQHQGHXULQHZRUGW
LQWZHHRQGHUJURQGVHWDQNVLQKRXGLHGHUPRSJHYDQJHQ1DDVWGHJHERXZHQEHYLQGW]LFK
HHQSURHIYHOGGDWYRRUKHHQLQJHEUXLNZDVDOVVFKDSHQZHLGH'HXULQHXLWGHRQGHUJURQGVH
WDQNVLVDOVPHVWVWRIWRHJHSDVWRSKHWSURHIYHOG
,QZDVGHSURHIJHULFKWRSGHSUDNWLVFKHDVSHFWHQGLHUHOHYDQW]LMQELMGHWRHSDVVLQJYDQ
XULQHDOVPHVWVWRIELMGHWHHOWYDQHHQODQGERXZJHZDVQDPHOLMNGHEHPHVWLQJVDSSDUDWXXU
JHXUJHZDVRSEUHQJVWHQDOVQHYHQDVSHFWRRNGHXLWVSRHOLQJYDQPHGLFLMQHQHQQXWULsQWHQ
+LHUWRHLVKHWSURHIYHOGLQWZHHGHOHQYHUGHHOGZDDUELMppQGHHOLVEHPHVWPHWXULQHHQppQ
GHHOWUDGLWLRQHHOLVEHPHVWPHWYDUNHQVGULMIPHVW$OVJHZDVLVHQHUJLHPDwVYHUERXZG9RRUDI
DDQGHEHPHVWLQJLVHHQEHPHVWLQJVSODQRSJHVWHOGZDDUELMRQGHUDQGHUHGHXULQHXLWGHSXWWHQ
LVEHPRQVWHUGHQJHDQDO\VHHUGHQGHEHPHVWHQGHZDDUGHGDDUYDQLVEHSDDOG(HQORRQZHUNHU
XLWGHRPJHYLQJKHHIWGHEHQRGLJGHYHOGZHUN]DDPKHGHQXLWJHYRHUG
,QKHWSURHIYHOGLVHHQPHHWRSVWHOOLQJDDQJHEUDFKWRPKHWLQILOWUDWLHZDWHUWHNXQQHQRSYDQJHQ
HQDDQYXOOHQGWHEHPRQVWHUHQWHQHLQGHXLWVSRHOLQJYDQJHQHHVPLGGHOHQHQQXWULsQWHQQDDUKHW
JURQGZDWHUWHNXQQHQQDJDDQ9DQZHJHKHWQLHWIXQFWLRQHUHQYDQGH]HPHHWRSVWHOOLQJKHHIWGLW
SURMHFWRQGHUGHHOQLHWJHOHLGWRWEUXLNEDUHPHHWUHVXOWDWHQ
9DQZHJHGHUHVXOWDWHQYDQGHSURHILQLVGHSURHIRS]HWYRRUHQLJV]LQVJHZLM]LJG'H
JHXUZDDUQHPLQJHQLQZDUHQDDQOHLGLQJKHWRQGHU]RHNQDDUVWDQNRYHUODVWLQWHLQ
WHQVLYHUHQ2PPHHULQ]LFKWWHNULMJHQLQGHPDWHYDQJHXUKLQGHULVHHQPRQVWHUYDQXULQHJH
QRPHQZDDURSHHQJHXURQGHU]RHNLVXLWJHYRHUGLQHHQSURIHVVLRQHHOJHXUODERUDWRULXP2RNLV
LQLQGHSURHIHHQPHQJVHOYDQKXPDQHXULQHHQYDUNHQVGULMIPHVWRQGHU]RFKWRPGDWGLW
TXDQXWULsQWHQVDPHQVWHOOLQJPRJHOLMNYRRUGHODQGERXZSUDNWLMNHHQLQWHUHVVDQWHPHVWVWRINDQ
]LMQ'HJHXUKLQGHULVHYHQHHQVRQGHU]RFKWDDQGHKDQGYDQHHQHHQYRXGLJHHQTXrWH'HJH
FRQVWDWHHUGHVWHUNHPDWHYDQYHUGXQQLQJYDQGHXULQHLQKHHIWWRWGHEHVOLVVLQJJHOHLGLQ
KHWDVSHFWµEHPHVWHQGHZDDUGHHQJHZDVRSEUHQVW¶DFKWHUZHJHWHODWHQ
5HVXOWDWHQ
%LMGHXLWYRHULQJYDQGHSURHILQHQ]LMQGLYHUVHSUDNWLMNHUYDULQJHQRSJHGDDQ*H
FRQFOXGHHUGZRUGWGDWKHWWHFKQLVFKPRJHOLMNLVXULQHWRHWHSDVVHQPDDUGDDUQDDVW]LMQHURRN
HQNHOHSUDNWLVFKHNQHOSXQWHQHQDDQGDFKWVSXQWHQDDQKHWOLFKWJHNRPHQ2SEDVLVYDQGHEH
YLQGLQJHQXLWGHWZHHMDULJHSUDNWLMNSURHI]LMQGHYROJHQGH]DNHQJHFRQFOXGHHUG
• %HPHVWLQJVDSSDUDWXXU+HWLVWHFKQLVFKPRJHOLMNPHWJDQJEDUHEHPHVWLQJVDSSDUDWXXUXULQH
RSWHSRPSHQHQRSKHWODQGDDQWHZHQGHQ,QGLHQXULQHDOVPHVWVWRILQGHODQGERXZZRUGW
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJ
-G:UHYLVLH'
3DJLQDYDQ
,QOHLGLQJ
$FKWHUJURQGYDQKHWSURMHFW
'HLQ]DPHOLQJHQEHKDQGHOLQJYDQKXLVKRXGHOLMNDIYDOZDWHULVGHODDWVWHGHFHQQLDYRRUDOJHULFKW
JHZHHVWRSGHDDQOHJYDQJURRWVFKDOLJHULRROV\VWHPHQHQGHHQGRISLSH]XLYHULQJYDQKHWYHU
]DPHOGHDIYDOZDWHULQULRROZDWHU]XLYHULQJVLQVWDOODWLHV5:=,¶V'HODDWVWHMDUHQZRUGWVWHHGV
PHHUJHGDFKWDDQDQGHUHPRJHOLMNKHGHQ]RDOVLQ]DPHOLQJHQYHUZHUNLQJYDQJHVFKHLGHQGHHO
VWURPHQ
'HDDQGDFKWJDDWGDDUELMRQGHUDQGHUHXLWQDDUKHWDSDUWLQ]DPHOHQHQYHUZHUNHQYDQKXPDQH
XULQHYDQGHVWLNVWRIHQYDQKHWIRVIDDWGLHELMGH]XLYHULQJHQDDQNRPHQ]LMQDINRP
VWLJYDQXULQH(HQPRJHOLMNKHLGRPXULQHQDLQ]DPHOLQJWHYHUZHUNHQLVGHWRHSDVVLQJYDQGH
DSDUWLQJH]DPHOGHXULQHDOVPHVWVWRI(HQGHUJHOLMNHWRHSDVVLQJGLHQWGDQHHQGXEEHOGRHOQO
RQWWUHNNLQJYDQVWLNVWRIHQIRVIDDWDDQGH]XLYHULQJ]RGDWGHQRRG]DNHOLMNHYHUZLMGHULQJYDQ
GH]HFRPSRQHQWHQELMGH]XLYHULQJJHUHGXFHHUGZRUGWHQKHUJHEUXLNYDQGHQXWWLJHFRPSRQHQ
WHQVWLNVWRIHQIRVIDDWDOVPHVWVWRI
2PPHHULQ]LFKWWHNULMJHQLQGHPRJHOLMNKHLGHQZHQVHOLMNKHLGYDQJURRWVFKDOLJHWRHSDVVLQJ
YDQXULQHVFKHLGLQJLQ1HGHUODQGLVRQGHU]RHNQRGLJRDQDDUGHWRHSDVVLQJDOVPHVWVWRI'H
PRJHOLMNKHLGRPGLWRQGHU]RHNLQWHYXOOHQGHHG]LFKYRRULQRSGHORFDWLH³1DWXXUZHUN
SODDWV$QGHUHQ´ZDDUPHQYRRUQHPHQVZDVDFKWZRRQHHQKHGHQYRRUJHHVWHOLMNJHKDQGLFDS
WHQLQHHQ]RUJERHUGHULMHQHHQNDQWRRUUXLPWHHQZHUNSODDWVWHUHDOLVHUHQ1DDVWGHEHERXZLQJ
EHYLQGW]LFKHHQSHUFHHOZDDUKHWWHOHQYDQJHZDVVHQPRJHOLMNLV
'H]RUJERHUGHULMLVRQWZLNNHOGGRRU9DQERHLMHQHHQRUJDQLVDWLHGLH]LFKLQ]HWRP]RUJRSPDDW
WHELHGHQDDQYHUVWDQGHOLMNJHKDQGLFDSWHQ9DQERHLMHQKDGUHHGVHUYDULQJRSJHGDDQPHWGH
JHVFKHLGHQLQ]DPHOLQJYDQXULQHPHWGULHXULQHVFKHLGLQJVWRLOHWWHQLQKHW$PEDFKWVKX\VLQ0HS
SHOHHQGDJRSYDQJYRRUYHUVWDQGHOLMNJHKDQGLFDSWHQHQZDVEHUHLGPHHWHZHUNHQDDQGH
RSVFKDOLQJYDQGHJHVFKHLGHQLQ]DPHOLQJHQGHSUDNWLVFKHWRHSDVVLQJYDQGHXULQH
'RHOVWHOOLQJLQWHJUDDOSURMHFW
,QGHFHPEHULVKHWSURMHFWSODQYDQKHWSURMHFW³1XWWLJHLQ]HWYDQXULQHDOVPHVWVWRIYRRU
HQHUJLHJHZDVVHQ´YDVWJHVWHOGGRRUGHGHHOQHPHQGHSDUWLMHQ]LHSDUDJUDDI+RRIGGRHO
YDQKHWSURMHFWLVGHKDDOEDDUKHLGYDQKHWJHEUXLNYDQXULQHDOVPHVWVWRIRQGHU]RHNHQHQWH
GHPRQVWUHUHQ'LWSURMHFWEHVWDDWXLWWZHHIDVHQ
2QGHU]RHNQDDUGHJHYROJHQYRRUKHWERGHPPLOLHXHQGHJURQGZDWHUNZDOLWHLWELMGHWRH
SDVVLQJYDQGHXULQHYDQGHORFDWLH$QGHUHQDOVPHVWVWRIYRRUKHWYHUERXZHQYDQJHZDV
VHQRQGHU]RHNVIDVH
3UDNWLMNHUYDULQJRSGRHQPHWGHWRHSDVVLQJYDQXULQHLQGHWHHOWYDQHHQHQHUJLHJHZDV
SUDNWLMNIDVH
,QGHRQGHU]RHNVIDVHIDVH]LMQGHRQGHU]RHNVYUDJHQEHDQWZRRUGGRRUGHXLWYRHULQJYDQ
HHQODERUDWRULXPRQGHU]RHNZDDUELMDGVRUSWLHHQDIEUDDNSDUDPHWHUV]LMQYDVWJHVWHOGYRRUHHQ
DFKWWDOJHVHOHFWHHUGHPHGLFLMQHQ
2SEDVLVYDQGHDIEUDDNSDUDPHWHUV]LMQLQKHWRQGHU]RHNGHPLOLHXULVLFR¶VEHUHNHQG'HUHVXO
WDWHQ]LMQVHSDUDDWJHUDSSRUWHHUG
-G:UHYLVLH'
3DJLQDYDQ
,QOHLGLQJ
2SKRRIGOLMQHQ]LMQGHFRQFOXVLHVXLWKHWRQGHU]RHNDOVYROJW
• KHWULVLFRYRRUFRQWDPLQDWLHYDQKHWJURQGZDWHUGRRUppQYDQGHJHVHOHFWHHUGHJHQHHVPLG
GHOHQGRRUEHPHVWLQJPHWXULQHRSGHORFDWLH$QGHUHQLVODDJELMHHQNRUWGXUHQGHWRHSDV
VLQJHQNHOHMDUHQ
• RSODQJHUHWHUPLMQNXQQHQFDUEDPD]HSLQHEH]DILEUDDWFORILEULQH]XXUHQLEXSURIHQHHQULVL
FRYRUPHQ(UGLHQHQDDQYXOOHQGHH[SHULPHQWHQXLWJHYRHUGWHZRUGHQRPQDWHJDDQRIGLW
GDDGZHUNHOLMNKHWJHYDOLV
'HXLWNRPVWHQYDQGLWODERUDWRULXPRQGHU]RHNUHVXOWHHUGHLQYROGRHQGHGUDDJYODNELQQHQGH
EHJHOHLGLQJVFRPPLVVLHRPJHGXUHQGHWZHHMDDUXULQHRSKHWSURHIYHOGDDQWHEUHQJHQHQGH
SUDNWLMNIDVHDDQWHYDQJHQ
2QGHUKDYLJHUDSSRUWDJHEHWUHIWGHUDSSRUWDJHYDQGHSUDNWLMNIDVHIDVH
'RHOVWHOOLQJHQRQGHU]RHNVYUDJHQIDVHGHSUDNWLMNSURHI
+HWEHODQJULMNVWHGRHOYDQGHSUDNWLMNIDVHLVKHWRSGRHQYDQSUDNWLMNHUYDULQJPHWGHWRHSDVVLQJ
YDQXULQHLQGHWHHOWYDQHHQHQHUJLHJHZDV1HYHQGRHOVWHOOLQJLQGH]HIDVHLVGHXLWYRHULQJYDQ
HHQYRXGLJHPHWLQJHQWHQDDQ]LHQYDQGHYHUVSUHLGLQJYDQJHQHHVPLGGHOHQQDDUGHRQGHU
JURQG
3ULPDLUHGRHOVWHOOLQJSUDNWLMNSURHI
'HSULPDLUHGRHOVWHOOLQJYDQGHSUDNWLMNSURHILVKHWEHVFKRXZHQYDQGHYROJHQGHDVSHFWHQ
• :DDUORRSMHLQGHSUDNWLMNWHJHQDDQELMKHWWRHSDVVHQYDQXULQHLQGHODQGERXZWDY
° 'HWRHSDVEDDUKHLGYDQJDQJEDUHEHPHVWLQJVDSSDUDWXXURSSRPSHQGRVHUHQHQYHU
VSUHLGHQ
° *HXUKLQGHU
° $FFHSWDWLHYDQVWDNHKROGHUVHQRPZRQHQGHQ
• :DWLVGHLQYORHGYDQEHPHVWLQJPHWXULQHRSGHRQWZLNNHOLQJHQRSEUHQJVWYDQKHWJHZDV
WHQRS]LFKWHYDQUHJXOLHUHEHPHVWLQJELMJHOLMNEHPHVWLQJVQLYHDX"
1HYHQGRHOVWHOOLQJHHQYRXGLJHPHWLQJHQWDYYHUVSUHLGLQJQDDURQGHUJURQG
'HSUDNWLMNSURHIKHHIWQLHWDOVGRHORPGHLQKHWODERUDWRULXPRSJHGDQHNHQQLVWDYKHWJHGUDJ
YDQJHQHHVPLGGHOHQLQGHSUDNWLMNWHWRHWVHQYHULILFDWLHLQKHWYHOGYDQGHUHVXOWDWHQRQGHU
]RHNVYUDDJ'HVRQGDQNVLVJHGXUHQGHKHWSURMHFWEHVORWHQRPWLMGHQVGHSUDNWLMNSURHIWRFK
HQNHOHHHQYRXGLJHPHWLQJHQWHYHUULFKWHQLQUHODWLHWRWKHWPRJHOLMNHYHUVSUHLGLQJVULVLFRYDQ
JHQHHVPLGGHOHQHQRRNQXWULsQWHQQDDUGHRQGHUJURQG
'HRQGHU]RHNVYUDJHQWHQEHKRHYHYDQGLWQHYHQGRHO]LMQ
• ZDW]LMQGHVDPHQVWHOOLQJHQEHODVWLQJYDQKHWLQILOWUHUHQGHJURQGZDWHURSHHQGLHSWHYDQ
FPHQFPPHWPHGLFLMQHQ"
• NXQQHQGH]HVDPHQVWHOOLQJHQEHODVWLQJYHUNODDUGZRUGHQXLWGHVDPHQVWHOOLQJYDQGHRS
JHEUDFKWHXULQHGHKRHYHHOKHLGQHHUVODJRYHUVFKRWGHVDPHQVWHOOLQJYDQGHERGHPHQGH
DIEUDDNHQDGVRUSWLHSDUDPHWHUVGLHLQKHWODERUDWRULXPRQGHU]RHN]LMQDIJHOHLG"
• PRHWHQGHFRQFOXVLHVWDYGHYHUVSUHLGLQJYDQJHQHHVPLGGHOHQQDDUKHWGLHSHUHJURQGZD
WHUGLHRSEDVLVYDQKHWODERUDWRULXPRQGHU]RHN]LMQJHIRUPXOHHUGELMJHVWHOGZRUGHQRSED
VLVYDQGHYHOGPHWLQJHQ"
• ZDWLVGHEHODVWLQJPHWQXWULsQWHQYDQKHWLQILOWUHUHQGHZDWHURSGH]HGLHSWHQYDQFPHQ
FPHQLQKRHYHUUHYHUVFKLOWGH]HEHODVWLQJWHQRS]LFKWHYDQUHJXOLHUHEHPHVWLQJ"
9DQZHJHKHWQLHWIXQFWLRQHUHQYDQGHPHHWRSVWHOOLQJKHHIWGLWSURMHFWRQGHUGHHOQLHWJHOHLGWRW
EUXLNEDUHPHHWUHVXOWDWHQHQGLWSURMHFWRQGHUGHHOLVLQGHORRSYDQKHWSURMHFWGDQRRNYHUZLM
GHUG
%HJHOHLGLQJVJURHS
'HSUDNWLMNSURHILVXLWJHYRHUGLQRSGUDFKWYDQ672:$:DWHUVFKDS+XQ]HHQ$DV3URYLQFLH
'UHQWKH:DWHUEHGULMI*URQLQJHQHQ:DWHUOHLGLQJPDDWVFKDSSLM'UHQWKH'HEHJHOHLGLQJVJURHS
EHVWRQGXLWGHYROJHQGHSHUVRQHQ
• %MDUWXU6ZDUW672:$
-G:UHYLVLH'
3DJLQDYDQ
,QOHLGLQJ
• -DQ(JEHUWV(OHYHOG2WWR.OXLYLQJ:DWHUVFKDS+XQ]HHQ$DV
• 5HLQ%RXZHUSURYLQFLH'UHQWKH
• 3HWHUYDQGHU0DDV:DWHUODERUDWRULXP1RRUGYHUWHJHQZRRUGLJHUYDQ:DWHUEHGULMI*URQLQ
JHQHQ:DWHUOHLGLQJPDDWVFKDSSLM'UHQWKH
• +DQV-DQVHQ9DQERHLMHQ
• %HUW'XNHU:RRQFRQFHSW
/HHVZLM]HU
,QKRRIGVWXNZRUGWGHRQGHU]RHNVRS]HWYDQGHSURHIXLWHHQJH]HW,QKRRIGVWXNZRUGHQKHW
YHUORRSHQGHUHVXOWDWHQYDQGHSUDNWLMNSURHIEHVSURNHQ,QKRRIGVWXNZRUGHQGHUHVXOWDWHQ
YDQGHSUDNWLMNSURHIVDPHQJHYDWZRUGHQFRQFOXVLHVJHWURNNHQHQZRUGHQDDQEHYHOLQJHQYRRU
YHUYROJJHGDDQ
-G:UHYLVLH'
3DJLQDYDQ
2QGHU]RHNVRS]HWSUDNWLMNSURHI
,QOHLGLQJ
'HSUDNWLMNSURHI³1XWWLJHLQ]HWYDQXULQHDOVPHVWVWRIYRRUHQHUJLHJHZDVVHQ´LVXLWJHYRHUGJH
GXUHQGHWZHHJURHLVHL]RHQHQQOLQHQ'LWKRRIGVWXNEHVFKULMIWGHRS]HWYDQGH
SUDNWLMNSURHI$FKWHUHHQYROJHQV]LMQGHORNDWLHGHXULQHRSVODJWDQNVKHWEHVFKLNEDUHSURHIYHOG
GHPHHWRSVWHOOLQJWEYYHUVSUHLGLQJPHGLFLMQHQHQQXWULsQWHQQDDUGHRQGHUJURQGGHJHZDV
NHX]HKHWEHPHVWLQJVSODQKHWJHXURQGHU]RHNHQGHRSKHWSURHIYHOGXLWJHYRHUGHZHUN]DDP
KHGHQEHVFKUHYHQ
3URHIORNDWLH
'HORNDWLHZDDUGHSUDNWLMNSURHILVXLWJHYRHUGEHYLQGW]LFKWHUSODDWVHYDQ1LMHQGWH$QGHUHQ
SURYLQFLH'UHQWKHOLJJLQJORFDWLH]LHELMODJH
2SGHORFDWLHEHYLQGHQ]LFKGH]RUJERHUGHULMYDQ9DQERHLMHQPHWQHJHQHHQKHGHQYRRUEHZR
QLQJGRRUYHUVWDQGHOLMNJHKDQGLFDSWHQ]LHILJXXUKHWNDQWRRUYDQ/DQGVFKDSVEHKHHU
'UHQWKH]LHILJXXUHQHHQZHUNSODDWVYDQ9DQERHLMHQ
*HGXUHQGHZHUNGDJHQPDNHQFLUFDSHUVRQHQYDQGHODDWVWHWZHHDFFRPPRGDWLHVJHEUXLN
(UEHYLQGHQ]LFKXULQHVFKHLGLQJVWRLOHWWHQRSGHORFDWLH
)LJXXU=RUJERHUGHULM9DQERHLMHQWH$QGHUHQ
6FKHLGLQJVWRLOHWWHQHQRSVODJXULQH
2SGHSURHIORFDWLHZRUGWGHXULQHGRRUGHDDQZH]LJHVFKHLGLQJVWRLOHWWHQJHVFKHLGHQRSJHYDQ
JHQ(HQYRRUEHHOGYDQKHWWRHJHSDVWHW\SHVFKHLGLQJVWRLOHWLVWH]LHQLQILJXXU:DQQHHU
]LWWHQGJHSODVWZRUGWNRPWGHXULQHLQKHWYRRUVWHGHHOYDQKHWWRLOHWWHUHFKW'H]HXULQHZRUGW
YLDHHQJHVFKHLGHQOHLGLQJVVWHOVHODSDUWDIJHYRHUGQDDUHHQYHU]DPHOWDQN+HWWRLOHWKHHIWHHQ
VSRHONQRSYRRUHHQVSRHOLQJYDQRIOLWHUYDQKHWVSRHOYROXPHOSHUVSRHOLQJ
YHUGZLMQWGRRUGHXULQHDIYRHUHQNRPWVDPHQPHWGHXULQHLQGHYHU]DPHOWDQNWHUHFKW
+HWJURRWVWHGHHOYDQKHWVSRHOZDWHUVWURRPWRYHUQDDUKHWDFKWHUVWHGHHOYDQKHWWRLOHWHQGLW
ZRUGWDIJHYRHUGYLDKHWKRRIGULRRO
-G:UHYLVLH'
3DJLQDYDQ
2QGHU]RHNVRS]HWSUDNWLMNSURHI
'HXULQHHQHHQNOHLQGHHOYDQKHWVSRHOZDWHUZRUGWYHU]DPHOGLQWZHHRQGHUJURQGVHWDQNVPHW
EHLGHHHQLQKRXGYDQP,QIRUPDWLHRYHUGHRQGHUJURQGVHWDQNLVZHHUJHJHYHQLQELMODJH
,QKHWEHVWHNYDQGHDDQOHJYDQGHRQGHUJURQGVHWDQNVLVDDQJHJHYHQGDWGHWDQNVRQGHUOLQJ
DIVOXLWEDDUPRHWHQ]LMQ,PPHUVYRRUWRHSDVVLQJDOVPHVWVWRIGLHQWGHXULQHHHQKDOIMDDURSJH
VODJHQWH]LMQRPSDWKRJHQHQFRQWDPLQDWLHXLWWHVOXLWHQ'HWDQNVEHYLQGHQ]LFKLQKHWJD]RQHQ
KHJWXVVHQGH]RUJLQVWHOOLQJHQKHWJHERXZYDQ/DQGVFKDSVEHKHHU]LHILJXXU%HUHNHQGLV
GDWFLUFDPRQYHUGXQGHXULQHSHUMDDUJHSURGXFHHUGZRUGWRSGHORFDWLHYRRUEHUHNHQLQJ]LH
ELMODJH
*HERXZ/DQGVFKDSVEHKHHU'UHQWKH
3XWGHNVHOVXULQHWDQNV
)LJXXU/RFDWLHVYDQGHRSVODJWDQNVYRRUXULQHRSGHSURMHFWORFDWLH1LMHQGWH$QGHUHQ
)LJXXU7RLOHWSRWYRRUJHVFKHLGHQRSYDQJYDQXULQHYRRUVWHGHHOHQIHFHVDFKWHUVWHGHHO'LWW\SH
WRLOHWSRW1RUGLFYDQGHILUPD*XVWDYVEHUJKHHIWHHQXULQHDIYRHUOHLGLQJEXLWHQGHSRW
-G:UHYLVLH'
3DJLQDYDQ
2QGHU]RHNVRS]HWSUDNWLMNSURHI
3URHIYHOG
7HQEHKRHYHYDQGHXLWYRHULQJYDQGHSUDNWLMNSURHILVHHQJUDVYHOGQDDVWGH]RUJORFDWLHJH
EUXLNW+HWSHUFHHOKHHIWHHQRSSHUYODNWHYDQRQJHYHHUP+HWYHOGZHUGYRRUKHHQPHW
VFKDSHQEHZHLG9RRUDIJDDQGHDDQKHWJHEUXLNDOVSURHISHUFHHOLVKHWSURHIYHOGYLVXHHOJHwQ
VSHFWHHUGHQERGHPNXQGLJRQGHU]RFKWPHWEHKXOSYDQERULQJHQ'HDDQYXOOHQGHLQIRUPDWLH
RYHUKHWSURHIYHOGRSEDVLVYDQGH]HLQYHQWDULVDWLHLVZHHUJHJHYHQLQELMODJH7HQEHKRHYH
YDQGHSUDNWLMNSURHILVKHWDFKWHUVWHGHHOYDQDIGHZHJHQKHWSDUNHHUWHUUHLQYDQGLWWHUUHLQ
JHEUXLNW'LWEHWUHIWKHWPHHVWZHVWHOLMNJHOHJHQGHHOYDQKHWJUDVYHOG9RRUHHQLPSUHVVLHYDQ
KHWSURHIYHOGYRRUDIJDDQGHDDQKHWJHEUXLNZRUGWYHUZH]HQQDDUILJXXU
)LJXXU,PSUHVVLHYDQKHWSURHIYHOG
*HZDVNHX]H
%LMGHSUDNWLMNSURHILVJHNR]HQYRRUGHWHHOWYDQHHQHQHUJLHJHZDVRPGDWWRHSDVVLQJYDQXULQH
LQGHWHHOWYDQHHQFRQVXPSWLHJHZDVPRJHOLMNRSSV\FKRORJLVFKHEH]ZDUHQ]RXNXQQHQVWXLWHQ
%LMWRHSDVVLQJYDQXULQHLQQLHWYRHGVHOJHZDVVHQHQHUJLHJHZDVVHQJHZDVVHQYRRULQGXVWULsOH
YHUZHUNLQJRIYHHYRHGHUJHZDVVHQLVGLWEH]ZDDUNOHLQHURIDIZH]LJ
0DwVLVHHQYULMHHQYRXGLJWHWHOHQJHZDVHQGHWHHOWNDQJHKHHODDQHHQORRQZHUNHUZRUGHQ
XLWEHVWHHG2RNLVKHWHHQ]HHUJHVFKLNWWRHWVJHZDVRPGHODQGERXZNXQGLJHZDDUGHYDQ
PHVWVWRIIHQWHEHSURHYHQ$DQYXOOHQGLQIRUPDWLHRYHUGHJHZDVNHX]HLVRSJHQRPHQLQ
ELMODJH
3URHIRS]HW
%HPHVWLQJ
2PLQ]LFKWWHYHUNULMJHQLQGHYHUVFKLOOHQWXVVHQWRHSDVVLQJYDQXULQHHQJDQJEDUHEHPHVWLQJ
GULMIPHVWLQGHPDwVWHHOWLVKHWSURHIYHOGLQWZHHJHOLMNHVWXNNHQRSJHGHHOG]LHELMODJH,Q
LVHHQEHPHVWLQJVSODQRSJHVWHOGRPGHEHQRGLJGHEHPHVWLQJWHEHSDOHQHQHHQRYHU
HHQNRPVWLJHEHPHVWLQJVVLWXDWLHLQEHLGHSURHIYHOGHQWHEHZHUNVWHOOLJHQ'HEDVLVYDQKHWEH
PHVWLQJVSODQZRUGWJHYRUPGGRRUGHRRUVSURQNHOLMNHYRHGLQJVWRHVWDQGYDQKHWSURHISHUFHHO
GHVDPHQVWHOOLQJYDQGHDDQWHEUHQJHQKXPDQHXULQHYDQGH]RUJORFDWLHHQGHDDQWHEUHQJHQ
YDUNHQVGULMIPHVW'DDUQDDVWGLHQWPHWKHWDDQEUHQJHQYDQGHPHVWDDQGHJHEUXLNVQRUPHQ
ZHWWHOLMNPD[LPDDOWRHJHVWDQHJLIWYRRUVWLNVWRIHQIRVIDDWWHZRUGHQYROGDDQ
'RRU%/**%HGULMIV/DERUDWRULXPYRRU*URQGHQ*HZDVRQGHU]RHNLVHHQEHPRQVWHULQJXLW
JHYRHUGRPLQ]LFKWWHNULMJHQLQGHYRHGLQJVWRHVWDQGYDQGHERGHP,QKHWODERUDWRULXPYDQ
%/**LVKHWPRQVWHUJHDQDO\VHHUG'HUHVXOWDWHQYDQGH]HODERUDWRULXPDQDO\VH]LMQRSJHQR
PHQLQELMODJH1DDVWGHDQDO\VHUHVXOWDWHQLVGRRU%/**WHYHQVHHQEHPHVWLQJVDGYLHVYRRU
PDwVRSJHVWHOGHQELMKHWRQGHU]RHNVUDSSRUWELMJHYRHJG
,QPDDUWLVHHQPRQVWHUYDQGHXULQHJHQRPHQRPLQ]LFKWWHNULMJHQLQGHKRHYHHOKHLG
QXWULsQWHQGLHDDQZH]LJ]LMQLQGHKXPDQHXULQHYDQGHSXWWHQRSGH]RUJORFDWLHWEYKHWRS
VWHOOHQYDQKHWEHPHVWLQJVSODQ'LWPRQVWHULVGRRU%/**JHDQDO\VHHUGRSGH%HPHVWHQGH
ZDDUGH'HRQGHU]RHNVUHVXOWDWHQ]LMQRSJHQRPHQLQELMODJH
-G:UHYLVLH'
3DJLQDYDQ
2QGHU]RHNVRS]HWSUDNWLMNSURHI
2SEDVLVYDQGHUHVXOWDWHQYDQGHEHPRQVWHULQJYDQGHERGHPYDQKHWSURHIYHOGHQYDQGH
KXPDQHXULQHLVLQVDPHQZHUNLQJPHW3UDNWLMNRQGHU]RHN3ODQWHQ2PJHYLQJGKU:&$YDQ
*HHOHHQH[SHUWRSKHWJHELHGYDQEHPHVWLQJERGHPHQSURHIRS]HWWHQHHQEHPHVWLQJVSODQ
RSJHVWHOG,QELMODJHLVKHWRSJHVWHOGHEHPHVWLQJVSODQZHHUJHJHYHQ9RRUKHWEHPHVWLQJV
SODQLVGHVWLNVWRIZHUNLQJYDQKXPDQHXULQHRSJHVWHOGHQGLHYDQYDUNHQVGULMIPHVWRS
XLWJDDQGHYDQERXZODQGLQMHFWLHZDDUELMGHPHVWFPGLHSLQGHJURQGZRUGWJH
EUDFKW
2SEDVLVYDQGHUHVXOWDWHQYDQGHSURHILQLVGHSURHIRS]HWLQJHZLM]LJGWRY
]LHKRRIGVWXN+HWZDVYDQZHJHGH]HZLM]LJLQJQLHWQRRG]DNHOLMNYRRUGHSURHIYDQ
YRRUDIJDDQGDDQGHEHPHVWLQJHHQEHPHVWLQJVSODQRSWHVWHOOHQ,QKHHIWGHSURHI]LFK
JHULFKWRSGHPDWHYDQJHXUKLQGHUHQLVHHQPHQJVHOYDQXULQHPHWYDUNHQVGULMIPHVWDDQJH
EUDFKW7RHSDVVLQJYDQXULQHGDWHHQYHHOKRJHUHVWLNVWRIIRVIDDWYHUKRXGLQJKHHIWGDQYDU
NHQVPHVWLVLQGHSUDNWLMNQDPHOLMNPRJHOLMNLQWHUHVVDQWRPWHFRPELQHUHQPHWYDUNHQVPHVWWHU
DDQYXOOLQJYDQKHWVWLNVWRIWHNRUWLQYDUNHQVGULMIPHVW1DGHUHLQIRUPDWLHRYHUGHRS]HWYDQGH
EHPHVWLQJYDQKHWSURHIYHOGLQLVZHHUJHJHYHQLQELMODJH
,Q]RZHODOVLVGRRUGHORRQZHUNHUQDDVWGHXULQHHQYDUNHQVGULMIPHVWWHYHQVHHQ
DDQYXOOHQGHNXQVWPHVWJLIWDDQJHEUDFKW
*HZDVRSEUHQJVW
2PGHYHUVFKLOOHQLQJHZDVRSEUHQJVWKHWPHWXULQHEHPHVWHGHHOWRYKHWJDQJEDDUEHPHVWH
GHHOWHEHSDOHQLVLQGHPDwVRSEUHQJVWPHWEHKXOSYDQHHQZHHJEUXJYDQGHORRQZHU
NHUYDQEHLGHSURHIYHOGHQEHSDDOG
2QGHU]RHNXLWVSRHOLQJPHGLFLMQHQHQQXWULsQWHQ
7HQEHKRHYHYDQKHWRQGHU]RHNQDDUGHXLWVSRHOLQJYDQPHGLFLMQHQHQQXWULsQWHQQDDUGHRQ
GHUJURQGLVGRRU*URQWPLMHHQPHHWRSVWHOOLQJDDQJHEUDFKWYRRUKHWRSYDQJHQHQEHPRQVWHUHQ
YDQKHWLQILOWUDWLHZDWHURSGHWZHHYHUVFKLOOHQGEHPHVWHGHOHQYDQKHWSURHISHUFHHO(HQVFKH
PDWLVFKHZHHUJDYHYDQKHWRQWZHUSYDQGHPHHWRSVWHOOLQJLVZHHUJHJHYHQLQILJXXU(HQ
XLWJHEUHLGHEHVFKULMYLQJYDQGHPHHWRSVWHOOLQJHQGHDDQOHJLVZHHUJHJHYHQLQELMODJH+HW
RQWZHUSEHVWDDWXLWYLHUNXQVWVWRIRSYDQJEDNNHQLQJHJUDYHQRSHHQGLHSWHYDQHQP
PLQXVPDDLYHOGZDDUYDQWZHHRSKHWPHWXULQHEHPHVWHGHHOHQWZHHRSKHWUHJXOLHUPHWYDU
NHQVPHVWEHPHVWHGHHO'H]HRSYDQJEDNNHQ]LMQLHGHUYRRU]LHQYDQHHQVODQJGLHLVYHUERQ
GHQPHWGHELMEHKRUHQGHEHPRQVWHULQJVORFDWLHYLHURSYDQJEXL]HQYDQ39&7HQEHKRHYHYDQ
KHWRQGHU]RHNQDDUGHXLWVSRHOLQJYDQPHGLFLMQUHVWHQHQQXWULsQWHQLVHHQEHPRQVWHULQJVSODQ
RSJHVWHOG
)LJXXU6FKHPDWLVFK]LMDDQ]LFKWPHHWRSVWHOOLQJRSYDQJHQEHPRQVWHULQJLQILOWUDWLHZDWHUSHUSURHISHU
FHHO5HFKWVIRWRYDQGHDDQOHJYDQGHPHHWRSVWHOOLQJ
-G:UHYLVLH'
3DJLQDYDQ
2QGHU]RHNVRS]HWSUDNWLMNSURHI
,QHQLVYRRUDIJDDQGDDQGHEHPHVWLQJHHQPRQVWHUYDQGHXULQHXLWGHRSVODJWDQNV
JHQRPHQRPLQ]LFKWWHNULMJHQLQGHDDQZH]LJHPHGLFLMQHQLQGHRSJHYDQJHQXULQH'HPHGL
FLMQFRQFHQWUDWLHV]LMQLQKHWODERUDWRULXPEHSDDOG,QKHHIWGHDQDO\VHSODDWVJHYRQGHQLQ
KHWODERUDWRULXPYDQ2PHJDPLQ$PVWHUGDPHQLQLQKHWODERUDWRULXPYDQ9LWHQVLQ
/HHXZDUGHQ'HDQDO\VHUHVXOWDWHQ]LMQZHHUJHJHYHQLQELMODJH
8LWYRHULQJDJUDULVFKHYHOGZHUN]DDPKHGHQ
7HQEHKRHYHYDQKHWXLWYRHUHQYDQGHSUDNWLMNSURHI]LMQYHUVFKLOOHQGHODQGERXZNXQGLJHZHUN
]DDPKHGHQXLWJHYRHUGRDKHWDDQEUHQJHQYDQGHEHPHVWLQJJURQGEHZHUNLQJLQ]DDLHQHQ
RRJVWHQ0DDWVFKDS+DUWOLHI/DPPHUVHHQEHGULMIGLHRDORRQZHUNDFWLYLWHLWHQXLWYRHUWXLW
'RQGHUHQKHHIWGHEHQRGLJGHZHUN]DDPKHGHQLQHQXLWJHYRHUG9RRUDIJDDQGDDQ
GHXLWYRHULQJYDQGHYHUVFKLOOHQGHZHUN]DDPKHGHQ]LMQGH]H]RZHOLQDOVLQPHWGH
ORRQZHUNHUDIJHVWHPG,QELMODJH]LMQIRWR¶VYDQYHUVFKLOOHQGHZHUN]DDPKHGHQRSJHQRPHQ
*HXURQGHU]RHN
,QLVJHXUKLQGHUELMKHWRSSRPSHQYDQGHXULQHHQELMKHWXLWULMGHQYDQGHXULQHRQGHU]RFKW
GRRUKHWHQTXrWHUHQYDQHQNHOHSHUVRQHQ2SEDVLVYDQGHUHVXOWDWHQYDQHUZDVVSUDNH
YDQJHXUKLQGHUKHHIWLQHHQXLWJHEUHLGHHQTXrWHULQJSODDWVJHYRQGHQ2RNLVLQHHQ
ODERUDWRULXPRQGHU]RHNGRRU35$2GRXUQHWXLWJHYRHUG
7HQEHKRHYHYDQGLWJHXURQGHU]RHNLVHHQPRQVWHUYDQGHXULQHXLWppQYDQGHRSVODJWDQNV
JHQRPHQGHWDQNZDDULQGHXULQHPLQLPDDOHHQKDOIMDDURSJHVODJHQLVJHZHHVW+HWPRQVWHU
LVDDQHHQSDQHOYRRUJHOHJGHQEHRRUGHHOGRSJHXUGUHPSHOHQKHGRQLVFKHZDDUGH2PGH
JHXUWHNXQQHQYHUJHOLMNHQPHWGHJHXUYDQJDQJEDUHEHPHVWLQJLVLQGLWRQGHU]RHNRRNGH
JHXUYDQYDUNHQVGULMIPHVWRQGHU]RFKW2RNLVGHJHXUYDQHHQPHQJVHOYDQXULQHHQYDUNHQV
GULMIPHVWRQGHU]RFKW(HQXLWJHEUHLGHEHVFKULMYLQJYDQGHHQTXrWHVHQGHSULQFLSHVYDQHHQ
SURIHVVLRQHHOJHXURQGHU]RHN]LMQZHHUJHJHYHQLQELMODJH
&RPPXQLFDWLHHQYHUVODJOHJJLQJ
'HSUDNWLMNSURHILVLQHQGRRU*URQWPLMJHFR|UGLQHHUG*HGXUHQGHGHSURHI]LMQHQ
NHOHPDOHQGHWXVVHQUHVXOWDWHQHQNQHOSXQWHQPHWGHEHJHOHLGLQJVJURHSEHVSURNHQHQ]LMQGH
YRRUJHQRPHQZHUN]DDPKHGHQYRRUGHYRRUWJDQJYDQKHWSURMHFWDDQJHSDVW
*HGXUHQGHGHSUDNWLMNSURHILQLVGRRU/DQGVFKDSVEHKHHU'UHQWKHHHQORJERHNELMJHKRX
GHQ7HYHQV]LMQIRWR¶VYDQGHYHUVFKLOOHQGHZHUN]DDPKHGHQJHPDDNWHQ]LMQRSUHJHOPDWLJH
WLMGHQIRWR¶VYDQKHWSURHIYHOGJHPDDNW
,QLVGHSURHIJHYROJGGRRU*URQWPLM'DDUELMLVHYHQHHQVGHJHZDVJURHLJHYROJGHQ]LMQ
HUIRWR¶VYDQGHYHUVFKLOOHQGHGRRUGHORRQZHUNHUXLWJHYRHUGHZHUN]DDPKHGHQJHPDDNW
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
,QOHLGLQJ
,QGLWKRRIGVWXNZRUGHQGHUHVXOWDWHQYDQGHSUDNWLMNSURHILQHQEHVFKUHYHQ$FKWHU
HHQYROJHQVZRUGWLQJHJDDQRSGHEHPHVWHQGHZDDUGHYDQXULQHGHHUYDULQJHQPHWGHJH
EUXLNWHEHPHVWLQJVDSSDUDWXXUGHJHZDVJURHLHQRSEUHQJVWGHJHXUHUYDULQJHQHQGHXLWVSRH
OLQJYDQPHGLFLMQHQHQQXWULsQWHQ7RWVORWZRUGWLQJHJDDQRSRYHULJHNQHOSXQWHQGLHHUYDUHQ
]LMQELMGHXLWYRHULQJYDQGHSUDNWLMNSURHI]RDOVFRPPXQLFDWLHPHWGHUGHQHQKHWWRLOHWJHEUXLN
1XWULsQWHQJHKDOWHLQGHXULQH
'HFRQFHQWUDWLHVQXWULsQWHQLQGHXULQHXLWGHRSVODJWDQNVHQGHDDQJHEUDFKWHYDUNHQVGULMIPHVW
LQHQ]LMQZHHUJHJHYHQLQWDEHO]LHRRNELMODJH
'HXULQHLVLQWZHHPDDOJHDQDO\VHHUGGRRU%/**%HGULMIV/DERUDWRULXPYRRU*URQGHQ
*HZDVRQGHU]RHN,QPDDUWLVHHQPRQVWHUJHDQDO\VHHUGWEYKHWRSVWHOOHQYDQKHWEH
PHVWLQJVSODQHQLQMXQLLVGHXULQHEHPRQVWHUGGLHRSJHEUDFKWLV9DQGHYDUNHQVPHVWLV
LQDOOHHQHHQPRQVWHUJHDQDO\VHHUGYDQGHGDDGZHUNHOLMNRSJHEUDFKWHYDUNHQVPHVW
,QLVHHQPRQVWHUYDQGHXULQHGLHRSJHEUDFKWLVJHDQDO\VHHUGGRRUKHWODERUDWRULXPYDQ
9LWHQVLQ/HHXZDUGHQ'HYDUNHQVPHVWLVWRHQQLHWJHDQDO\VHHUG]LHRRNELMODJH
7DEHO1XWULsQWHQLQGHXULQHHQGHYDUNHQVGULMIPHVWLQHQ
8ULQHPDDUWMXQL 8ULQHMXQL 9DUNHQVGULMIPHVWMXQL
6WLNVWRI J1NJ J1NJ J1NJ
)RVIDDW J32NJ J3NJ J32NJ
J3NJ J3NJ
.DOL J.2NJ J.2NJ
2SEDVLVYDQOLWHUDWXXUJHJHYHQVEHYDW]XLYHUHXULQHFLUFD
jJ1NJHQjJ3NJ'HDQDO\VHVYDQGHXULQH
RSGHSURHIORFDWLHODWHQHHQYHHOODJHUQXWULsQWHQJHKDOWH
]LHQ'HQXWULsQWHQJHKDOWHQLQGHXULQH]LMQHUJODDJYRRU
ZDWEHWUHIWVWLNVWRINHHUODJHUGDQYDQGHJHEUXLNWHYDU
NHQVGULMIPHVW'LWEHWHNHQWGDWELMHHQJHOLMNHEHPHVWHQGH
ZDDUGHVWLNVWRIHUDFKWPDDO]RYHHOYHUGXQGHXULQHRS
JHEUDFKWPRHWZRUGHQWHQRS]LFKWHYDQLQGH]HSURHIRS
JHEUDFKWHYDUNHQVGULMIPHVW
9HUGXQQLQJVIDFWRU )LJXXU8ULQHLQGHRSYDQJSXW
2SEDVLVYDQGHDQDO\VHJHJHYHQVYDQVWLNVWRIEOLMNWGDWGH
EHPRQVWHUGHXULQHLQGHWDQNRSJHEUDFKWHXULQHHHQIDF
WRUWRWNHHUPRHW]LMQYHUGXQG'LWLVPHHUGDQYHUZDFKWRSEDVLVYDQKHWW\SHWRLOHWYHU
ZDFKWLQJFLUFDWRWPDDO,QSDUDJUDDIZRUGWQDGHULQJHJDDQRSPRJHOLMNHRRU]DNHQ
YDQGH]HYHUGXQQLQJ
*URQWPLM7RHSDVVLQJVPRJHOLMNKHGHQYRRUXULQHLQGHODQGERXZLQ)ULHVODQG'UDFKWHQ
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
%HPHVWLQJVDSSDUDWXXURSSRPSHQHQDDQEUHQJHQXULQH
3URHI
,QKHWJURHLVHL]RHQYDQLVGHKHOIWYDQKHWSHUFHHOEHPHVWPHWYDUNHQVPHVWHQGHDQGHUH
KHOIWPHWXULQHXLWGHRSVODJWDQNV
'HXULQHLVPHWJHEUXLNYDQHHQFRQYHQWLRQHOH]RGHEHPHVWHURSJHSRPSWHQDDQJHEUDFKW7LM
GHQVKHWSRPSHQHQDDQEUHQJHQKHEEHQ]LFKJHHQWHFKQLVFKHSUREOHPHQELMGHPDFKLQHYRRU
JHGDDQ
9DQZHJHGHODJHVWLNVWRIFRQFHQWUDWLHLQGHXULQHLVLQHHQKRJHGRVHULQJJURRWYROXPH
DDQJHKRXGHQRPWHYROGRHQDDQGH]HOIGHEHPHVWHQGHZDDUGHDOVGHEHPHVWHQGHZDDUGHYDQ
GHYDUNHQVPHVWRSKHWQDEXULJHSHUFHHO'HGRVHULQJEHGURHJFLUFDWRWPSHUKHFWDUH
*DQJEDUHGRVHULQJHQYRRUKHWDDQEUHQJHQYDQGLHUOLMNHPHVWYDULsUHQLQGHSUDNWLMNYDQWRW
PSHUKHFWDUH9DQZHJHGH]HKRJHGRVHULQJWUDGGHXULQHGHHOVXLWGHVOHXIMHVHQHUZDV
KHUHQGHUVSUDNHYDQSODVYRUPLQJ
%LMXLWWUHGLQJXLWGHVOHXIMHVZDDUELMSODVYRUPLQJRSWUDG]DOHHQUHODWLHIKRJHDPPRQLDNYHU
YOXFKWLJLQJ]LMQRSJHWUHGHQZDDUGRRUVWLNVWRIYRRUKHWJHZDVYHUORUHQLVJHJDDQ
2SEDVLVYDQGH]HUHVXOWDWHQLVEHVORWHQELMGHSUDNWLMNSURHILQQLHWPHHUWHIRFXVVHQRS
GHEHPHVWHQGHZDDUGHYDQGHXULQHHQGHJHZDVRSEUHQJVWPDDUKHWRQGHU]RHNWHFRQFHQWUH
UHQRSJHXURYHUODVW]LHRRNSDUDJUDDI
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
)LJXXU$DQEUHQJHQYDQGHXULQHRSKHWSURHIYHOGLQ
$OVXULQH]RXZRUGHQWRHJHODWHQDOVPHVWVWRILQGHODQGERXZ]XOOHQYRRUGHWRHGLHQLQJVZLM]H
ZDDUVFKLMQOLMNGH]HOIGHUHJHOVJHOGHQDOVYRRUGLHUOLMNHPHVW9RRUGHWRHGLHQLQJYDQGLHUOLMNH
PHVWJHOGWHHQZHWWHOLMNHLQZHUNSOLFKWRPGHDPPRQLDNHPLVVLHXLWGHPHVWWHPLQLPDOLVHUHQ
9ORHLEDUHPHVWPRHWGDDUWRHLQGHJURQGZRUGHQJHEUDFKWRILQWHQVLHIPHWGHJURQGZRUGHQ
JHPHQJG]RGDQLJGDWKHWQLHWPHHU]LFKWEDDURSKHWJURQGRSSHUYODNOLJW7RHGLHQLQJPHWHHQ
]RGHEHPHVWHUZDDUELMGHPHVWLQVOHXIMHVERYHQLQGHJURQGZRUGWDDQJHEUDFKWPDJPLWVGH
PHVWQLHWXLWGHVOHXIMHVWUHHGW
%LMWRHGLHQLQJPHWHHQ]RGHEHPHVWHUWUHHGWPHHUDPPRQLDNYHUYOXFKWLJLQJVYHUOLHVRSGDQELM
HHQERXZODQGLQMHFWHXUHQLVGHVWLNVWRIZHUNLQJELM]RZHOKHWDDQEUHQJHQYDQGHXULQHDOVGH
YDUNHQVGULMIPHVWODJHU
*HZDVJURHLHQRSEUHQJVW
0RQLWRULQJJHZDV
*HGXUHQGHGHSURHILVKHWSURHIYHOGUHJHOPDWLJEH]RFKWGRRU/DQGVFKDSVEHKHHU'UHQWKHLQ
HQ*URQWPLMLQ7LMGHQVGH]HEH]RHNHQ]LMQJHHQELM]RQGHUKHGHQJHFRQVWDWHHUG,Q
ILJ]LMQHQNHOHDIEHHOGLQJHQZHHUJHJHYHQ0HHUIRWR¶VYDQGHJHZDVRQWZLNNHOLQJ]LMQRS
JHQRPHQLQELMODJH9LVXHHOZDUHQHULQJHHQRSYDOOHQGHYHUVFKLOOHQWHFRQVWDWHUHQWXV
VHQGHJHZDVJURHLRSKHWPHWXULQHEHPHVWHSHUFHHOHQKHWPHWYDUNHQVPHVWEHPHVWHSHUFHHO
'LW]HOIGHZDVKHWJHYDOLQYRRUKHWPHWXULQHEHPHVWHSHUFHHOHQKHWPHWKHWPHQJVHO
YDUNHQVPHVWXULQHEHPHVWHSHUFHHO
)LJXXU0DwVRSMXQLMXOLHQDXJXVWXV
*HZDVRSEUHQJVW
3URHI
2SRNWREHULVGHPDwVYDQKHWSURHIYHOGJHRRJVW2SEDVLVYDQRSEUHQJVWPHWLQJHQ
GRRUGHORRQZHUNHUEHGURHJGHRSEUHQJVWWHUSODDWVHYDQKHWPHWXULQHEHPHVWHGHHOLQWRWDDO
NJHQKHWPHWYDUNHQVGULMIPHVWEHPHVWHGHHOLQWRWDDONJPDwV'HRSSHUYODNWHYDQ
EHLGHSHUFHOHQZDVJHOLMN
2SEDVLVYDQGH]HRSEUHQJVWEHSDOLQJNDQQLHWHHQGXLGLJZRUGHQJHFRQFOXGHHUGGDWXULQHPLQ
GHUJHVFKLNWLVDOVPHVWVWRIYRRUKHWWHOHQYDQHQHUJLHPDwVGDQYDUNHQVPHVW,PPHUVHU]LMQ
QRJPHHUYDULDEHOHQDDQZH]LJGDQDOOHHQKHWYHUVFKLOLQW\SHEHPHVWLQJXULQHHQYDUNHQV
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
)LJXXU2RJVWSURHIYHOGLQ
'HJHRRJVWHPDwVLVGRRUGHORRQZHUNHUYHUJLVWLQGHRSKHWORRQEHGULMIDDQZH]LJHYHUJLVWLQJV
LQVWDOODWLH0HWGHRRJVWYDQKHWSURHIYHOGVGXVELRJDVJHSURGXFHHUG
*HXU
*HXUKLQGHUVWDNHKROGHUV
,QKHWQDYROJHQGHZRUGWRQGHUVFKHLGJHPDDNWWXVVHQJHXUZDDUQHPLQJHQELMKHWRSSRPSHQYDQ
GHXULQHHQELMKHWDDQEUHQJHQYDQGHXULQH
3URHI
• 2SSRPSHQ
'HORRQZHUNHUJDILQDDQGDWELMKHWRSSRPSHQYDQGHXULQHXLWGHRSVODJWDQNVSUDNHZDV
YDQVWDQNRSKHWPRPHQWGDWGHRSSRPSVODQJLQGHXULQHZHUGJHVWRNHQGXVQLHWELMKHWRSH
QHQYDQGHSXW
• $DQEUHQJHQ
%LMKHWDDQEUHQJHQYDQGHXULQHLQJDIGHORRQZHUNHUDDQGDWHUHYHQHHQVVSUDNHZDV
YDQHHQYHUVFKULNNHOLMNHVWDQN'HVWDQNYDQGHXULQHZDVYRRUGHORRQZHUNHUQLHWWHKDUGHQ
OHWWHUOLMNµGHMRQJHQVJLQJHQELMQDRYHUKXQQHN¶'HJHXUZHUGDOV]HHUVWHUNHUYDUHQRQGDQNV
KHWIHLWGDWGHORRQZHUNHUUHJHOPDWLJPHWPHVWZHUNW
'HPHQVHQGLHZHUN]DDP]LMQRSGHORFDWLHELM6WLFKWLQJ/DQGVFKDSVEHKHHU'UHQWKHKDGGHQLQ
HYHQHHQVWLMGHQVKHWDDQEUHQJHQYDQGHXULQHODVWYDQVWDQN'HZDDUJHQRPHQJHXUGLH
WLMGHQVKHWRSSRPSHQORVNRPWHQ]LFKYHUVSUHLGGRRUKHWJHERXZJHGXUHQGHKHWXLWULMGHQZHUG
DOVYUHVHOLMNSHQHWUDQWHQZHHwJRPVFKUHYHQ'HJHXUYDQGHYDUNHQVGULMIPHVWZHUGQLHW]R]HHU
DOVVWRUHQGHUYDUHQ
'HJHXUZDDUQHPLQJHQLQZDUHQDDQOHLGLQJKHWRQGHU]RHNQDDUVWDQNRYHUODVWLQWH
LQWHQVLYHUHQ%HVORWHQZHUGQLHWDOOHHQGHJHXUWHODWHQEHRRUGHOHQGRRUVWDNHKROGHUVPDDU
WHYHQVHHQSURIHVVLRQHHOJHXURQGHU]RHNWHODWHQXLWYRHUHQ
3URHI
7HQEHKRHYHYDQKHWJHXURQGHU]RHNLVEHVORWHQGHHQHKHOIWYDQKHWSHUFHHOWHEHPHVWHQPHW
DOOHHQXULQHHQHQNHOHGDJHQODWHUYRRUHHQDSDUWHEHRRUGHOLQJPHWHHQPHQJVHOYDQXULQHHQ
YDUNHQVGULMIPHVW
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
• 2SSRPSHQ
2SKHWWHUUHLQ]LMQWZHHRSVODJWDQNVDDQZH]LJGLHRQGHUOLQJDIJHVORWHQNXQQHQZRUGHQ7HQ
EHKRHYHYDQGHEHPHVWLQJVSURHIPHLZHUGDOOHHQGHXULQHJHEUXLNWXLWGHRSVODJWDQN
ZDDULQGHXULQHDOHHQKDOIMDDURSJHVODJHQLVJHZHHVW,QDSULOZDUHQEHLGHWDQNVYRORRNGH
WDQNZDDULQGHXULQHWRWGDWPRPHQWZDVDDQJHYXOG'H]HPHHVWYHUVHXULQHLVLQDSULO
RSJHSRPSWHQDIJHYRHUGQDDUHHQ5:=,RPGDWHUDQGHUVJHHQWDQNPHHUEHVFKLNEDDU]RX]LMQ
YRRUQLHXZDDQWHYRHUHQXULQH
(HQPHGHZHUNHUYDQ:RRQFRQFHSWLVLQDSULODDQZH]LJJHZHHVWELMKHWRSSRPSHQHQDI
YRHUHQRPHYHQWXHOHJHXUKLQGHUZDDUWHQHPHQ'HPHGHZHUNHUYDQ:RRQFRQFHSWKHHIWJH
FRQVWDWHHUGGDWHU]RZHORQJHURHUGDOVQDLQWHQVLHIURHUHQYDQGHXULQHJHHQJHXUZDVZDDUWH
QHPHQXLWGHJHRSHQGHSXWPHWYHUVHXULQH2RNHHQPHGHZHUNHUYDQ9DQERHLMHQKHHIWJH
URNHQHQVWHOGHYDVWGDWHUJHHQRQZHOULHNHQGHJHXUZDDUWHQHPHQZDV
7LMGHQVKHWRSSRPSHQYDQGHXULQHXLWGHWDQNZDDULQGHXULQHHHQKDOIMDDURSJHVODJHQLVJH
ZHHVWWHQEHKRHYHYDQGHEHPHVWLQJVURHIPHWXULQHZDVHHQPHGHZHUNHUYDQ*URQWPLMDDQ
ZH]LJ=LMQEHYLQGLQJHQZDUHQGDWHUWLMGHQVKHWRSSRPSHQYDQGHXULQHVSUDNHZDVYDQHHQ
OLFKWHJHXU
• $DQEUHQJHQ
2PGHJHXUHUYDULQJHQWLMGHQVKHWDDQEUHQJHQYDQXULQHHQKHWPHQJVHOYDQXULQHHQYDUNHQV
PHVWWHRQGHU]RHNHQ]LMQGHPHGHZHUNHUVYDQ/DQGVFKDSVEHKHHU'UHQWKHJHsQTXrWHHUG'H
YRRUJHOHJGHHQTXrWHV]LMQRSJHQRPHQLQELMODJH
,Q]LMQGRRUDFKWYHUVFKLOOHQGHPHQVHQHQTXrWHVLQJHYXOGRSGHGDJGDWGHXULQHLVDDQ
JHEUDFKW8LWGHUHVXOWDWHQYDOWRSWHPDNHQGDWGHUHDFWLHVXLWHHQORSHQ=REOLMNHQHQNHOHSHU
VRQHQQLHWVWHKHEEHQJHPHUNWHQHU]LMQSHUVRQHQGLHGHJHXUDOVLQGULQJHQGKHEEHQHUYDUHQ
'HPHHUGHUKHLGSHUVRQHQKHHIWQLHWVJHPHUNW2SYDOOHQGLVGDWppQSHUVRRQVSUHHNWRYHU
HHQ]XULJHGULMIPHVWJHXU
(U]LMQLQYLMIHQTXrWHVLQJHYXOGRSGHGDJGDWKHWPHQJVHOYDQGHYDUNHQVGULMIPHVWHQ
XULQHLVDDQJHEUDFKW'HUHVXOWDWHQYDQGH]HHQTXrWH]LMQHHQGXLGLJHU2SGHGDJYDQDDQ
EUHQJHQLVGRRUDOOHJHsQTXrWHHUGHQKLQGHUELQQHQKHWJHERXZHQEXLWHQRQGHUYRQGHQ'H
JHXUZRUGWDOVVFKHUSHQSHQHWUDQWRPVFKUHYHQHQGHPDWHYDQKLQGHUPHWHHQZDDUGHYDQ
WRWRSHHQVFKDDOYDQWRWJHNDUDNWHULVHHUG0HQKHHIWHQNHOHXUHQWRWHHQKDOYHGDJ
KLQGHURQGHUYRQGHQ
7LMGHQVKHWDDQEUHQJHQYDQ]RZHOGHXULQHDOVKHWPHQJVHOYDQXULQHHQYDUNHQVGULMIPHVWZDV
HHQPHGHZHUNHUYDQ*URQWPLMDDQZH]LJ=LMQEHYLQGLQJHQZDUHQGDWHUWLMGHQVKHWDDQEUHQJHQ
YDQXULQHQDXZHOLMNVVSUDNHZDVYDQVWDQN'HORRQZHUNHUFRQVWDWHHUGHGDWHULQZHO
VSUDNHZDVYDQJHXUPDDUGDWGHVWDQNLQYHHOHUJHUZDV2RNPHUNWHKLMRSGDWGHYDU
NHQVGULMIPHVWYHHOPHHUVWRQN'LWZHUGRRNEHYHVWLJGGRRUGHPHGHZHUNHUYDQ*URQWPLM
*HXURQGHU]RHNODERUDWRULXP
'RRU35$2GRXUQHWEYLVJHXURQGHU]RHNLQKHWODERUDWRULXPXLWJHYRHUGWHQEHKRHYHYDQGH
YHUJHOLMNLQJYDQGHYROJHQGHGULHPHVWVRRUWHQ
• 9HUGXQGHKXPDQHXULQHXLWGH]HOIGHWDQNGLHYRRUGHEHPHVWLQJYDQGHHQHKHOIWYDQKHW
SHUFHHOLVJHEUXLNW
• 9DUNHQVGULMIPHVW
• (HQPHQJVHOYDQYHUGXQGHKXPDQHXULQHHQYDUNHQVGULMIPHVWKHW]HOIGHPHQJVHODOVYRRU
GHEHPHVWLQJYDQGHWZHHGHKHOIWYDQKHWSHUFHHOLVJHEUXLNW
'HSULQFLSHVYDQHHQSURIHVVLRQHHOJHXURQGHU]RHN]LMQZHHUJHJHYHQLQELMODJH
*HXUZRUGWEHRRUGHHOGRSJHXUVWHUNWHJHXUFRQFHQWUDWLHHQRSJHXUHUYDULQJKHGRQLVFKH
ZDDUGH
8LWKHWJHXURQGHU]RHN]LMQGRRU35$2GRXUQHWGHYROJHQGHFRQFOXVLHVJHWURNNHQ
• 'HYROJHQGHJHXUFRQFHQWUDWLHV]LMQJHPHWHQ
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
° 9DUNHQVGULMIPHVWRX(P
° 0HQJVHOYDQYDUNHQVGULMIPHVWHQKXPDQHXULQHRX(P
° 9HUGXQGHKXPDQHXULQHRX(P
• 'HJHXUFRQFHQWUDWLHYDQGHPRQVWHUVYDQYDUNHQVGULMIPHVWLVRQJHYHHUHHQIDFWRUKRJHU
GDQGHJHXUFRQFHQWUDWLHYDQGHPRQVWHUVYDQYHUGXQGHKXPDQHXULQH
• (HQPHQJVHOYDQYDUNHQVGULMIPHVWHQKXPDQHXULQHJHHIWHHQJHXUFRQFHQWUDWLHGLHWXVVHQ
GHZDDUGHQYDQYDUNHQVGULMIPHVWHQKXPDQHXULQHLQOLJW
• 8LWGHKHGRQLVFKHPHWLQJHQNRPWQDDUYRUHQGDWYDUNHQVGULMIPHVWDOVPLQGHURQDDQJHQDDP
ZRUGWEHRRUGHHOGGDQKXPDQHXULQHRIHHQPHQJVHOYDQYDUNHQVGULMIPHVWHQKXPDQHXULQH
• +HWPHQJVHOYDQYDUNHQVGULMIPHVWHQKXPDQHXULQHUHVXOWHHUWLQGHODDJVWHKHGRQLVFKH
ZDDUGHQ'LWPHQJVHOLVDOVKHWPHHVWRQDDQJHQDDPEHRRUGHHOGGRRUKHWSDQHO'HYHU
VFKLOOHQ]LMQJHULQJ
• 'HJHXUYDQGHPRQVWHUVLVLQYHUKRXGLQJWRWDQGHUHJHXUHQDOVUHODWLHIRQDDQJHQDDPEH
RRUGHHOG
+HWYROOHGLJHRQGHU]RHNVUDSSRUWYDQ35$2GRXUQHWLVRSJHQRPHQLQELMODJH
*HQHHVPLGGHOHQ
,QILOWUDWLHSURHYHQPHWRSYDQJEDNNHQ
(ULVHHQSURHIRSVWHOOLQJDDQJHOHJGRPGHLQILOWUDWLHYDQJHQHHVPLGGHOHQQDDUKHWZDWHUYRH
UHQGSDNNHWWHNXQQHQPHWHQ]LHELMODJH
9DQZHJHGHVLWXDWLHWHUSODDWVHYDQKHWSURHIYHOGLQGH]RPHUYDQLVGHEHPRQVWHULQJYDQ
KHWLQILOWUDWLHZDWHUWHQEHKRHYHYDQKHWRQGHU]RHNQDDUGHXLWVSRHOLQJYDQPHGLFLMQHQHQQXWUL
HQWHQQLHWPHHU]LQYROJHDFKWHQGDDURPVWRSJH]HW'HUHVXOWDWHQYDQGHJHSODQGHEHPRQVWH
ULQJ]RXGHQ]HNHUQLHWUHSUHVHQWDWLHI]LMQ(QNHOHRRU]DNHQYDQGHVWRS]HWWLQJZDUHQ]LHRRN
ELMODJH
• ,QGHRSYDQJSXWWHQLVYHHOPHHUZDWHUJHPHWHQGDQPRJHOLMNZDVRSEDVLVYDQGHQHHUVODJ
KRHYHHOKHLG(UNXQQHQKLHUYRRUYHUVFKLOOHQGHRRU]DNHQ]LMQ+HWXLW]RHNHQYDQGHGDDGZHUNH
OLMNHRRU]DDNLVDOVWHFRPSOH[HQWHGXXUEHRRUGHHOGPHGHRPGDWGLWRQGHUGHHOHHQQHYHQ
GRHOYDQKHWSURHISURMHFWEHWUHIW
• 'HORRQZHUNHUKDGKHWSURHISHUFHHOQLHWRYHUGZDUVPDDURYHUODQJVLQWZHHsQJHGHHOGHQ
KDGERYHQGLHQQLHWEHPHVWWHUSODDWVHYDQGHRSYDQJEDNNHQ+HWZDVKLHUGRRUQLHWPRJHOLMN
LQILOWUDWLHYDQXULQHPHWJHQHHVPLGGHOHQWHPHWHQHQERYHQGLHQZDVKHWPHWHQYDQKHWYHUVFKLO
LQEHODVWLQJGRRUXULQHHQYDUNHQVPHVWQLHWPRJHOLMN
*HQHHVPLGGHOHQFRQFHQWUDWLHVLQGHXULQHWDQNV
9ROXPHXULQHLQGHWDQNVHQYHUGXQQLQJVIDFWRU
,QMXQLFLUFDMDDUQDRSHQLQJYDQGHORFDWLHLVGHXULQHXLWGHRSVODJWDQNVEHPRQVWHUG
HQJHDQDO\VHHUG7HQWLMGHYDQGHPRQVWHUQDPHEHYRQG]LFKFLUFDPYHUGXQGHXULQHLQGH
WDQNV(ULVEHUHNHQGGDWSHUMDDURSGHORFDWLHFLUFDPXULQHJHSURGXFHHUGZRUGW]LHELMODJH
2SEDVLVYDQGHDDQJHWURIIHQKRHYHHOKHLGYDQPYHUGXQGHXULQHHQGHEHUHNHQGHKRH
YHHOKHLGYDQP]XLYHUHXULQHZRUGWHHQYHUGXQQLQJYDQFLUFDPDDODIJHOHLG
*HQHHVPLGGHOHQJHEUXLN
,QELMODJHLVKHWJHQHHVPLGGHOHQJHEUXLNLQGH]RUJERHUGHULMLQ$QGHUHQYROJHQVRSJDYHLQGH
]RPHUYDQHQYROJHQVRSJDYHLQMDQXDULZHHUJHJHYHQ,QGH]HELMODJHLVWHYHQVGH
EHUHNHQLQJZHHUJHJHYHQYDQGHWHYHUZDFKWHQFRQFHQWUDWLHJHQHHVPLGGHOHQLQGHXULQHWDQNV
LQMXQLWHQWLMGHYDQGHPRQVWHUQDPH%LMGH]HFRQFHQWUDWLHEHUHNHQLQJLVGHYUDFKWJH
QHHVPLGGHOHQEHUHNHQGGLHYROJHQVYHUZDFKWLQJLQGHYRRUDIJDDQGHSHULRGHLQGHWDQNWHUHFKW
LVJHNRPHQHQLVGHFRQFHQWUDWLHEHUHNHQGXLWJDDQGHYDQHHQYROXPHYDQPXULQHLQGH
WDQNVWHQWLMGHYDQGHEHPRQVWHULQJ
$QDO\VHUHVXOWDWHQ
'HXULQHXLWGHRSVODJWDQNLVLQRSJHQHHVPLGGHOHQJHDQDO\VHHUGLQKHWODERUDWRULXPYDQ
2PHJDPLQ$PVWHUGDPHQLQLQKHWODERUDWRULXPYDQ9LWHQVLQ/HHXZDUGHQEHLGHMDUHQ
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
PRQVWHUQDPHYRRUDIJDDQGHDDQWRHGLHQLQJRSKHWSHUFHHO'HDQDO\VHUHVXOWDWHQ]LMQZHHUJH
JHYHQLQELMODJH9DQGHWRHJHGLHQGHJHQHHVPLGGHOHQ]LMQELMKHWODERUDWRULXPYDQ2PHJDP
DOOHHQFDUEDPD]HSLQHHQOLWKLXPJHDQDO\VHHUGHQELMKHWODERUDWRULXPYDQ9LWHQVDOOHHQFDUED
PD]HSLQH
,QWDEHO]LMQGHJHQHHVPLGGHOHQFRQFHQWUDWLHVLQHQDOOHHQYDQGLHSDUDPHWHUV
GLHJHPHWHQ]LMQLQJHKDOWHQERYHQGHUDSSRUWDJHJUHQVZHHUJHJHYHQ$OOHHQFDUEDPD]HSLQH
HQOLWKLXPNRPHQYRRURSGHDDQJHOHYHUGHOLMVWHQJHQHHVPLGGHOHQGLHGRRUGHFOLsQWHQYDQGH
]RUJERHUGHULMZRUGHQLQJHQRPHQ'HRYHULJHDDQJHWURIIHQJHQHHVPLGGHOHQ]LMQUHJXOLHUHJH
QHHVPLGGHOHQGLHLQJHQRPHQNXQQHQ]LMQGRRUDQGHUHJHEUXLNHUVYDQGHORFDWLH0HWURSROROHQ
VRWDORO]LMQELMYRRUEHHOGJDQJEDUHEqWDEORNNHUVHQQDSUR[HQHQGLFORIHQDF]LMQ]HHUUHJXOLHUJH
EUXLNWHSLMQVWLOOHUVRQWVWHNLQJVUHPPHUV
7DEHO*HQHHVPLGGHOHQFRQFHQWUDWLHVYDQXULQHPRQVWHUVXLWRSVODJWDQNORNDWLH$QGHUHQDOOHHQ
YDQGHSDUDPHWHUVGLHDDQJHWURIIHQ]LMQLQJHKDOWHQERYHQGHUDSSRUWDJHJUHQV
3DUDPHWHU *HPHWHQFRQFHQWUDWLH *HPHWHQFRQFHQWUDWLH
ÔJO ÔJO
&DUEDPD]HSLQH
&RIIHLQH
0HWURSRORO
/LWKLXP
QDSUR[HQ
VRWDORO
SDUDFHWDPRO
GLFORIHQDF
,QWDEHOLVYRRUGHEHPRQVWHULQJYDQQDDVWGHSDUDPHWHUVPHWJHKDOWHQERYHQGH
UDSSRUWDJHJUHQVZHHUJHJHYHQZDWYROJHQVGHEHUHNHQLQJHQ]LHELMODJHGHFRQFHQWUDWLHLQ
GHRSVODJWDQNV]RXPRHWHQ]LMQ'HEHUHNHQGHFRQFHQWUDWLHLVJOREDDOHHQIDFWRUKRJHUGDQ
GHJHPHWHQFRQFHQWUDWLH'LWEHWHNHQWGDWGHJHPHWHQFRQFHQWUDWLHLQGHRSVODJWDQNVFLUFDQH
JHQPDDOODJHULVGDQEHUHNHQGLVYRRU]XLYHUHXULQH
+HWYHUVFKLOLQJHPHWHQHQEHUHNHQGHFRQFHQWUDWLHNDQYHUVFKLOOHQGHRRU]DNHQKHEEHQ(QNHOH
KLHUYDQ]LMQ
• (UZRUGWGRRUGHEHZRQHUVPLQGHUYDQGHXULQHVFKHLGLQJVWRLOHWWHQJHEUXLNJHPDDNWGDQ
YHUZDFKW
• +HWVFKHLGLQJVSHUFHQWDJHYDQGHWRLOHWWHQLVODJHUGDQGHZDDUYDQXLWLVJHJDDQ
• (UZRUGHQGRRUGHEHZRQHUVPLQGHUJHQHHVPLGGHOHQLQJHQRPHQGDQYHUZDFKW
• 'HXLWVFKHLGLQJVSHUFHQWDJHVYDQGHJHQHHVPLGGHOHQGRRUGHPHQV]LMQODJHUGDQGHSHU
FHQWDJHVGLHLQGHOLWHUDWXXUYHUPHOGZRUGHQ
• HHQGHHOYDQGHJHQHHVPLGGHOHQEUHNHQDIWLMGHQVRSVODJGLWNDQQLHWKHWJHYDO]LMQELM
OLWKLXPHHQHOHPHQW
7DEHO9HUJHOLMNLQJDQDO\VHUHVXOWDWHQJHQHHVPLGGHOHQLQXULQHXLWGHWDQNDOOHHQJH
QHHVPLGGHOHQERYHQGHWHFWLHJUHQV]LMQZHHUJHJHYHQHQEHUHNHQGHFRQFHQWUDWLHVRSEDVLVYDQ
LQQDPHJHJHYHQVHQXLWVFKHLGLQJVSHUFHQWDJHVXLWVFKHLGLQJ LQQDPH
XLWVFKHLGLQJVSHUFHQWDJH
3DUDPHWHU *HPHWHQFRQFHQWUDWLH 9HUZDFKWHFRQFHQWUDWLH )DFWRU%HUH
YROJHQVEHUHNHQLQJHQ NHQGJHPHWHQ
ÔJO ÔJO
&DUEDPD]HSLQH
&RIIHLQH
0HWURSRORO
/LWKLXP
9HUGXQQLQJVIDFWRU
2SEDVLVYDQHHQFRPELQDWLHYDQ]RZHOGHQXWULsQWHQJHKDOWHQDOVGHJHQHHVPLGGHOHQJHKDOWHQ
OLMNWKHWKHWPHHVWYRRUGHKDQGOLJJHQGGDWHULQGHWDQNPLQGHUXULQHWHUHFKWNRPWGDQYHU
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
ZDFKWHQOLMNWGHYHUGXQQLQJVIDFWRUGLFKWHULQGHEXXUWYDQGHWHOLJJHQGDQYDQGHGLHZDV
DIJHOHLGRSEDVLVYDQGHYHUZDFKWHKRHYHHOKHGHQXULQH
2YHULJHUHVXOWDWHQ
1DDVWGHUHVXOWDWHQWHQDDQ]LHQYDQGHRQGHU]RHNVYUDJHQ]LMQHUJHGXUHQGHGHSURHIRRNDQ
GHUHEHYLQGLQJHQJHGDDQ'H]H]LMQLQGH]HSDUDJUDDIEHVFKRXZG
$DQOHJJHVFKHLGHQVDQLWDWLHV\VWHHP
,QKHW3URJUDPPDYDQ(LVHQHQKHWEHVWHNWHQEHKRHYHYDQGHDDQOHJYDQGHRSVODJWDQNVZDV
RSJHQRPHQGDWGHYHUELQGLQJWXVVHQGHRSVODJWDQNVDIJHVORWHQPRHWNXQQHQZRUGHQ7RFK
ZDUHQGHRSVODJWDQNVYRRUXULQHLQHHUVWHLQVWDQWLHDDQGHERYHQNDQWPHWHHQOHLGLQJPHWHO
NDDUYHUERQGHQ'LWEHWHNHQGHGDWLQGLHQGHHQHWDQNYROLVGHXULQHQDDUGHDQGHUHWDQNNRQ
VWURPHQ&RQVHTXHQWLHKLHUYDQLVGDWLQEHLGHWDQNVVWHHGVYHUVHXULQHWHUHFKWNRQNRPHQHQ
HHQWDQNQLHWDI]RQGHUOLMNNRQZRUGHQDIJHVORWHQ%LMGHDDQOHJLVGXVDIJHZHNHQYDQKHW3UR
JUDPPDYDQ(LVHQ
:RRQFRQFHSWKHHIWHUYRRUJH]RUJGGDWGHDIVOXLWNOHSRSMDQXDULDOVQRJLVJHSODDWVW
'RRUGH]HNOHSLVKHWPRJHOLMNGHWDQNVYDQHONDDUDIWHVOXLWHQHQGHXULQHHQNHOHPDDQGHQ
VHSDUDDWRSWHVODDQ]LHILJXXU
-G:UHYLVLH'
3DJLQDYDQ
5HVXOWDWHQSUDNWLMNSURHI
8LWHHQJHVSUHNYDQGHSURMHFWOHLGHUYDQ:RRQFRQFHSWPHWPHQVHQYDQ9DQERHLMHQHQHHQ
FOLsQWLVJHEOHNHQGDWHUJURWHKRHYHHOKHGHQZDWHUGRRUGHWRLOHWWHQJDDQELMVFKRRQPDDNZHUN
]DDPKHGHQ+LHUELMZRUGWGULIWLJJHEUXLNJHPDDNWYDQDOOHVRRUWHQVFKRRQPDDNPLGGHOHQRD
EOHHNPLGGHOHQ
,QGHWRLOHWWHQYLQGWXULQHVFKHLGLQJZDQQHHU]LWWHQGJHSODVWZRUGWRRNGRRUPDQQHOLMNHJHEUXL
NHUV9DQERHLMHQKHHIWDDQJHJHYHQGDWGLYHUVHEHZRQHUVQRJVWHHGVVWDDQGSODVVHQHYHQDOV
GHPDQQHOLMNHZHUNQHPHUVELM/DQGVFKDSVEHKHHU'UHQWKH'DDUQDDVWZHUGELM/DQGVFKDSVEH
KHHU'UHQWKHDDQJHJHYHQGDWHUUHJHOPDWLJQDHHQJURWHERRGVFKDSHQNHOHNHUHQQDJHVSRHOG
GLHQWWHZRUGHQRPYROGRHQGHZHJVSRHOHIIHFWWHYHUNULMJHQ,HGHUHNHHUGDWHUVSRHOZDWHUJH
EUXLNWZRUGWNRPWHHQGHHOYDQKHWVSRHOZDWHUFLUFDLQGHXULQHWDQNVWHUHFKW2YHUPDWLJH
VSRHOLQJ]RQGHUWRHYRHJLQJYDQXULQHQDDUGHWDQNVOHLGWWRWHHQJURWHUHYHUGXQQLQJYDQGHXUL
QHLQGHRSVODJWDQNVGDQYHUZDFKW
8LWYRHULQJDJUDULVFKHZHUN]DDPKHGHQHQFRPPXQLFDWLH
2QGDQNVFRQFUHWHDIVSUDNHQPHWGHORRQZHUNHUEOLMNWLQGHSUDNWLMNGDWGHORRQZHUNHURSVRP
PLJHPRPHQWHQ]LMQHLJHQSODQWUHNWRYHULJHQVPHWGHEHVWHEHGRHOLQJHQ=RLVKHWSHUFHHOLQ
GRRUGHORRQZHUNHULQGHOHQJWHULFKWLQJLQWZHHsQJHGHHOGHQQLHWLQGHEUHHGWH]RDOV
DDQJHJHYHQZDVRPGDWGLWPLQGHUGUDDLEHZHJLQJHQPHW]LFKPHHEUHQJWHQGHORRQZHUNHUYDQ
PHQLQJZDVGDWHUWZHHPHHUJHOLMNZDDUGLJHSHUFHOHQ]RXGHQRQWVWDDQ'HORRQZHUNHUKHHIW
QLHWEHVHIWGDWGHRSYDQJEDNNHQYRRUGHLQILOWUDWLHSURHYHQ]LFKKLHUGRRUQLHWPHHURSYHUVFKLO
OHQGHSHUFHOHQEHYRQGHQ
4XLFNVFDQOLWHUDWXXU
'HEHYLQGLQJHQXLWGHWZHHMDULJHSUDNWLMNSURHI]LMQPLGGHOVHHQTXLFNVFDQJHWRHWVWDDQOLWHUD
WXXU'HNRUWHZHHUJDYHYDQGHUHVXOWDWHQKLHUYDQLVRSJHQRPHQLQELMODJH
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJFRQFOXVLHVHQDDQEHYHOLQ
JHQ
,QOHLGLQJ
'RRUKHWXLWYRHUHQYDQGHSURHI]LMQLQHQGLYHUVHSUDNWLMNHUYDULQJHQRSJHGDDQ
ZDDUGRRUYHUVFKLOOHQGHNQHOSXQWHQHQDDQGDFKWVSXQWHQDDQKHWOLFKW]LMQJHNRPHQ
3HURQGHU]RHNVDVSHFWZRUGHQLQGLWKRRIGVWXNNRUWGHUHVXOWDWHQVDPHQJHYDW'DDUQDDVWZRU
GHQSHUDVSHFWGHFRQFOXVLHVZHHUJHJHYHQ7RWVORWZRUGHQDDQEHYHOLQJHQJHGDDQ
6DPHQYDWWLQJHQFRQFOXVLHV
%HPHVWHQGHZDDUGH
• 'HXULQHLQGHRSVODJWDQNVZDVjPDDOYHUGXQGWRY]XLYHUHXULQH
• 'HQXWULsQWHQJHKDOWHQLQGHXULQH]LMQHUJODDJYRRUZDWEHWUHIWVWLNVWRINHHUODJHUGDQYDQ
GHJHEUXLNWHYDUNHQVGULMIPHVW
• 'HFRQFHQWUDWLHVWLNVWRIYDQGHJHEUXLNWHYHUGXQGHXULQHZDVFD[ODJHUGDQYDQ]XLYH
UHXULQH
• 2PYROGRHQGHVWLNVWRIDDQWHEUHQJHQRPHQHUJLHPDwVRSKHWSURHIYHOGWHWHOHQLVHHQ]HHU
JURWHGRVHULQJQRGLJ
&RQFOXVLHEHPHVWHQGHZDDUGH
$OVJHYROJYDQYHUGXQQLQJLVGHEHPHVWHQGHZDDUGHYDQGHXULQHRSGH]RUJORFDWLHHUJODDJ
'LWPDDNWGHYHUGXQGHXULQHYDQGH]HORFDWLHQLHWDDQWUHNNHOLMNYRRUODQGERXZNXQGLJHWRH
SDVVLQJ(UPRHWQDPHOLMNHHQJURWHUHKRHYHHOKHLGZRUGHQRSJHSRPSWHQDDQJHEUDFKWZDWH[
WUDPDFKLQHHQDUEHLGVNRVWHQPHW]LFKPHHEUHQJW
%HPHVWLQJVDSSDUDWXXURSSRPSHQHQDDQEUHQJHQXULQH
• +HWLVPRJHOLMNGHYHUGXQGHXULQHXLWRSVODJWDQNVRSWHSRPSHQHQRSKHWSURHIYHOGDDQWH
EUHQJHQPHWGH]RGHEHPHVWHUGLHLQGH]HSURHIJHEUXLNWLV
• +HWLVWHFKQLVFKPRJHOLMNXULQHHQYDUNHQVGULMIPHVWLQGHWDQNWHPHQJHQHQRSKHWSURHIYHOG
DDQWHEUHQJHQPHWGH]RGHEHPHVWHUGLHLQGH]HSURHIJHEUXLNWLV
• %LMKHWDDQEUHQJHQYDQWRWPDDOYHUGXQGHXULQHPHWHHQ]RGHEHPHVWHULQHHQKRHYHHO
KHLGGLHGH]HOIGHEHPHVWHQGHZDDUGHZDWEHWUHIWVWLNVWRIKHHIWDOVYDUNHQVPHVWWUDGGH
YHUGXQGHXULQHXLWGHVOHXIMHVHQWUDGSODVYRUPLQJRS9HUPRHGHOLMNKHHIWGLWWRWHHQKRJH
DPPRQLDNHPLVVLHJHOHLG
• %LMKHWDDQEUHQJHQYDQYHUGXQGHXULQHLQHHQ]HOIGHKRHYHHOKHLGDOVJHEUXLNHOLMNLVYRRUYDU
NHQVPHVWFDPKDWUDGJHHQSODVYRUPLQJRS
&RQFOXVLHEHPHVWLQJVDSSDUDWXXU
'H]RGHEHPHVWHUGLHLQGH]HSURHILVJHEUXLNWLVJDQJEDUHEHPHVWLQJVDSSDUDWXXULQGHSUDN
WLMN2SEDVLVKLHUYDQNDQZRUGHQJHFRQFOXGHHUGGDWLQGHSUDNWLMNDSSDUDWXXUYRRUKDQGHQLV
LQGLHQXULQHDOVPHVWVWRILQGHODQGERXZZRUGWWRHJHSDVW(U]LMQGXVJHHQH[WUDLQYHVWHULQJHQ
LQRIRQWZLNNHOLQJYDQPDFKLQHVHQDSSDUDWXXUQRGLJ
*HZDVJURHLHQRSEUHQJVW
• 9LVXHHO]LMQHUJHHQELM]RQGHUKHGHQRIRSYDOOHQGHYHUVFKLOOHQLQJHZDVJURHLZDDUJHQRPHQ
WXVVHQKHWSHUFHHOGDWPHWXULQHLVEHPHVWHQKHWSHUFHHOGDWPHWYDUNHQVPHVWLVEHPHVW
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJFRQFOXVLHVHQDDQEHYHOLQJHQ
• 'HJHZDVRSEUHQJVWYDQKHWPHWYDUNHQVPHVWEHPHVWHGHHOZDVHHQIDFWRUNHHUKRJHU
WHQRS]LFKWHYDQGHJHZDVRSEUHQJVWYDQKHWPHWXULQHEHPHVWHGHHOLQ
• 'HRRU]DDNYDQGLWYHUVFKLOLQRSEUHQJVWLVQLHWHHQGXLGLJDDQKHWYHUVFKLOLQPHVWVRRUWWRH
WHVFKULMYHQYDQZHJHGHLQYORHGYDQYHUVFKLOOHQGHIDFWRUHQDOVGHYODNWHOLJLJQJYDQKHW
SURHIYHOGGHLQKRPRJHQLWHLWYDQGHERGHPGHK\GURORJLVFKHVLWXDWLHHQPRJHOLMNHDPPR
QLDNHPLVVLH
&RQFOXVLHJHZDVJURHLHQRSEUHQJVW
%LMWRHSDVVLQJYDQGHYHUGXQGHXULQHRSGHORFDWLHLQGHWHHOWYDQHQHUJLHPDwV]LMQYLVXHHOJHHQ
ELM]RQGHUKHGHQDDQKHWJHZDVJHFRQVWDWHHUG0HWGHUHVXOWDWHQYDQGHSURHINDQJHHQXLW
VSUDDNZRUGHQJHGDDQRYHUGHYHUVFKLOOHQLQGHRSEUHQJVWYDQHQHUJLHPDwVELMWRHSDVVLQJYDQ
XULQHRSGH]RUJORFDWLHYHUJHOHNHQPHWJDQJEDUHEHPHVWLQJELMGHWHHOWYDQHQHUJLHPDwVLQGH
SUDNWLMN
*HXU
• %LMKHWRSSRPSHQHQDDQEUHQJHQYDQGHXULQHLQLVJHXUKLQGHURQGHUYRQGHQGRRUGH
ORRQZHUNHUHQGHPHGHZHUNHUVYDQ/DQGVFKDSVEHKHHU
• ,QZHUGGRRUGHORRQZHUNHUHQGRRUPHGHZHUNHUVYDQ9DQERHLMHQHQ/DQGVFKDSVEH
KHHUQDXZHOLMNVKLQGHURQGHUYRQGHQWLMGHQVKHWRSSRPSHQHQWLMGHQVHQQDKHWDDQEUHQJHQ
YDQGHXULQH
• 2SEDVLVYDQKHWJHXURQGHU]RHNLQKHWODERUDWRULXPLVGHJHXUYDQGHXULQHPLQGHUDDQJH
QDDPEHRRUGHHOGWHQRS]LFKWHYDQGHJHXUYDQYDUNHQVGULMIPHVW'HJHXUYDQHHQPHQJVHO
YDQXULQHHQYDUNHQVGULMIPHVWLVKHWPLQVWDDQJHQDDP'HYHUVFKLOOHQWXVVHQGHUHVXOWDWHQ
YDQKHWXULQHPRQVWHUVKHWPRQVWHUYDUNHQVGULMIPHVWHQKHWPRQVWHUYDQKHWPHQJVHOYDQ
XULQHPHWYDUNHQVGULMIPHVWZDUHQHFKWHUNOHLQ
&RQFOXVLHJHXU
(ULVHHQYHUVFKLOLQJHXUZDDUQHPLQJWXVVHQGHEHZHUNLQJHQPHWXULQHLQHQ,QGH
XULQHGLHLQZHUGJHEUXLNWEHYRQG]LFKRRNYHUVHXULQH'HXULQHGLHLQZHUGJHEUXLNW
LVPLQLPDDOPDDQGHQRSJHVODJHQJHZHHVW0RJHOLMNLVGH]HRSVODJWLMGGHUHGHQYRRUHHQ
EHSHUNWHUHJHXUKLQGHU'LWNRPWRYHUHHQPHWGHEHYLQGLQJHQYDQ0-RKDQVVRQ'H]HKHHIW
JHFRQVWDWHHUGGDWGHJHXUYDQRSJHVODJHQXULQHPLQGHUZRUGWLQGHORRSYDQGHWLMG
'HJHXUKLQGHUNDQELMKHWDDQEUHQJHQYDQYHUGXQGHXULQHRIHHQPHQJVHOYDQYDUNHQVGULMI
PHVWPHWXULQHPRJHOLMNLHWVJURWHU]LMQWHQRS]LFKWHYDQEHPHVWLQJPHWYDUNHQVGULMIPHVW+HW
YHUVFKLO]DOQDDUYHUZDFKWLQJNOHLQ]LMQ'HYHUZDFKWLQJLVQLHWGDWJHXUKLQGHUSUDNWLMNWRHSDVVLQJ
YDQXULQHLQGHODQGERXZLQGHZHJ]DOVWDDQ
8LWVSRHOLQJYDQPHGLFLMQHQ
• +HWPHWHQYDQLQILOWUDWLHYDQPHGLFLMQHQQDDUGHRQGHUJURQGLVPLVOXNWYDQZHJHKHWQLHW
IXQFWLRQHUHQYDQGHPHHWRSVWHOOLQJ
• 9DQGHJHQHHVPLGGHOHQGLHGRRUGHEHZRQHUVYDQGH]RUJERHUGHULMZRUGHQLQJHQRPHQ
NRPHQDOOHHQOLWKLXPHQFDUEDPD]HSLQHYRRULQGHDQDO\VHSDNNHWWHQYDQGHODERUDWRULD
• /LWKLXPHQFDUEDPD]HSLQH]LMQDDQJHWURIIHQLQGHXULQHLQGHRSVODJWDQNVHFKWHUZHOLQFRQ
FHQWUDWLHVODJHUGDQYHUZDFKWRSEDVLVYDQGHLQQDPHJHJHYHQV'LWNDQGXLGHQRSHHQOD
JHUHWRHYRHUYDQXULQHGRRUGHEHZRQHUVQDDUGHXULQHRSVODJWDQNVYHHOEXLWHQRIVWDDQG
JHSODVW
&RQFOXVLHXLWVSRHOLQJYDQPHGLFLMQHQ
&DUEDPD]HSLQHHQOLWKLXPEHLGHJHQHHVPLGGHOHQGLHLQGH]RUJLQVWHOOLQJZRUGHQLQJHQRPHQ
]LMQWHUXJJHYRQGHQLQGHXULQHRSVODJWDQNVRRNQDHHQKDOIMDDURSVODJYDQGHXULQH&DUED
PD]HSLQHLVppQYDQGHJHQHHVPLGGHOHQZDDUYDQLQKHWRQGHU]RHNGRRUGH:85LVJHEOHNHQ
GDWGLHRSODQJHWHUPLMQHHQULVLFRNXQQHQYRUPHQYRRUFRQWDPLQDWLHYDQJURQGZDWHU
3HUVRRQOLMNHPHGHGHOLQJ0DWV-RKDQVVRQ9(51$(FRORJ\6WRFNKROP
.XMDZD5RHOHYHOGHWDO
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJFRQFOXVLHVHQDDQEHYHOLQJHQ
*HVFKHLGHQDDQOHJVDQLWDWLHV\VWHHP
• 'HWDQNVZDUHQQLHWFRQIRUPEHVWHNDDQJHOHJG'HWDQNVZDUHQQLHWDI]RQGHUOLMNDIVOXLWEDDU
HQQLHWDOOHOHLGLQJHQZDUHQYDQ3(
&RQFOXVLHDDQOHJJHVFKHLGHQVDQLWDWLHV\VWHHP
'HDDQOHJYDQHHQGHUJHOLMNQLHXZV\VWHHPNDQQLHWDOOHHQRSEDVLVYDQHHQEHVWHNXLWJHYRHUG
ZRUGHQPDDUPRHW]RUJYXOGLJEHJHOHLGZRUGHQRPGDWHU]LFKNHX]HVYRRUGRHQYRRUGHDDQ
QHPHUGLHYRRUDIQLHWYRRU]LHQNXQQHQZRUGHQ+HWLVJHHQVWDQGDDUGZHUNHQGHFRPPXQLFDWLH
LVHHQEHODQJULMNRQGHUGHHOLQGH]H
7RLOHWJHGUDJ
• 9HHOPDQQHOLMNHEHZRQHUVYDQGH]RUJLQVWHOOLQJHQYDQGHRYHULJHJHERXZHQEOLMNHQVWDDQG
WHSODVVHQ
• %LMKHWVFKRRQPDNHQYDQGHWRLOHWWHQZRUGWUHJHOPDWLJYHHOZDWHUJHEUXLNWHQZRUGHQYHHO
FKHPLVFKHVFKRRQPDDNPLGGHOHQJHEUXLNW
• %LMKHWGRRUVSRHOHQYDQGHµJURWHERRGVFKDS¶ZRUGWYRRUHHQHIIHFWLHYHGRRUVSRHOLQJYDDN
GRRUJHVSRHOG
&RQFOXVLHWRLOHWJHGUDJ
'HZRRQJURHSLVHHQODVWLJHSRSXODWLHRP]LWWHQGSODVVHQDDQWHOHUHQ(HQPDDOVWDDQGSODV
VHQDDQJHOHHUGYHUDQGHUMHQLHW]RPDDU
(HQJRHGHYRRUOLFKWLQJRYHUKHWWRLOHWJHEUXLNHQKHWGRHOYDQGHJHVFKHLGHQXULQHRSYDQJLV
QRRG]DNHOLMNHQPRHWVWHHGVZRUGHQJHDFWXDOLVHHUG
8LWYRHULQJDJUDULVFKHZHUN]DDPKHGHQ
• 'HORRQZHUNHUKHHIW]LFKQLHWDOWLMGDDQGHYRRUVFKULIWHQYRRUGHZHUN]DDPKHGHQJHKRXGHQ
YDDNPHWGHEHVWHEHGRHOLQJHQ
&RQFOXVLHXLWYRHULQJDJUDULVFKHZHUN]DDPKHGHQ
%HPHVWLQJPHWXULQHHQXLWYRHULQJYDQSUDNWLMNSURHYHQLVYRRUORRQZHUNHUVJHHQVWDQGDDUGZHUN
HQYHUHLVWHHQYRRUWGXUHQGHKHOGHUHFRPPXQLFDWLHHQVWUDNNHEHJHOHLGLQJYDQGHXLWWHYRHUHQ
ZHUN]DDPKHGHQ
8ULQHKRHYHHOKHGHQ
• ,QDSULOLVPXULQHYDQGHORFDWLHDIJHYRHUGRPGDWEHLGHWDQNVYROZDUHQHQVOHFKWV
ppQWDQNJHEUXLNWNRQZRUGHQYRRUEHPHVWLQJ
&RQFOXVLHVWDYPDQDJHPHQWYDQXULQHKRHYHHOKHGHQ
• 9DQZHJHGHUDQGYRRUZDDUGHGDWGHXULQHPLQLPDDOHHQKDOIMDDUVHSDUDDWPRHWZRUGHQRS
JHVODJHQNDQGHLQKRXGYDQppQWDQNLQKHWYRRUMDDUZRUGHQJHEUXLNWHQGHLQKRXGYDQGH
DQGHUHWDQNLQKHWQDMDDU$DQJH]LHQHULQKHWQDMDDUQRJHHQJHZDVDDQZH]LJLVRIHULV
LQPLGGHOVJHRRJVWNDQGHXULQHLQKHWQDMDDUQLHWPHHUZRUGHQJHEUXLNWYRRUGHPDwVWHHOW
'LWEHWHNHQWGDWHURSGHORFDWLHMDDUOLMNVFDPXULQHPRHWZRUGHQRSJHSRPSWHQDIJH
YRHUG
• 'HWRHSDVVLQJYDQGHXULQHLQGHODQGERXZYUDDJWHHQEHSDDOGPDQDJHPHQW'HXULQHPRHW
QDPHOLMNRSKHWMXLVWHWLMGVWLSEHVFKLNEDDUNRPHQYHHODOLQKHWYRRUMDDUYRRUGHLQ]DDLYDQ
HHQJHZDV,QGLHQHHQWDQNELMYRRUEHHOGLQPHLYROLVHQZRUGWDIJHVORWHQ]RGDWHUJHHQ
YHUVHXULQHPHHUELMNDQNDQGHXULQHSDVLQVHSWHPEHURNWREHUZRUGHQWRHJHSDVW,QGH]H
SHULRGHLVHUPRJHOLMNPLQGHUEHKRHIWHDDQVWLNVWRIPHVWVWRIIHQRIPDJKHWPRJHOLMNDOVJH
YROJYDQZHWJHYLQJQLHWPRJHQZRUGHQXLWJHUHGHQ
-G:UHYLVLH'
3DJLQDYDQ
6DPHQYDWWLQJFRQFOXVLHVHQDDQEHYHOLQJHQ
$DQEHYHOLQJHQ
2SJURQGYDQGHEHYLQGLQJHQLQGH]HSUDNWLMNSURHIZRUGHQGHYROJHQGHDDQEHYHOLQJHQJHGDDQ
• 8LWGH]HSUDNWLMNSURHILVJHEOHNHQGDWKHWWHFKQLVFKZDWEHWUHIWJHEUXLNDSSDUDWXXUPRJHOLMN
LVXULQHWRHWHSDVVHQLQGHODQGERXZ9DQZHJHKHWRQFRQWUROHHUEDUHWRLOHWJHGUDJYDQGH
EHZRQHUVHQKHWKRJHUHJHEUXLNYDQJHQHHVPLGGHOHQGRRUGHFOLsQWHQYDQGH]RUJERHUGHULM
PHWQDPHFDUEDPD]HSLQHZRUGWDDQEHYROHQGHWRHSDVVLQJRSGH]RUJERHUGHULMQLHWODQJHU
YRRUWWH]HWWHQ
• %LMSUDNWLMNWRHSDVVLQJYDQXULQHLQKHWDOJHPHHQ]DOHHQKRJHUHFRQFHQWUDWLHQXWULsQWHQDDQ
ZH]LJPRHWHQ]LMQGDQELMGH]HSUDNWLMNSURHIKHWJHYDOLVJHZHHVW'LWEHWHNHQWGDWYHUGXQ
QLQJWRWHHQPLQLPXPGLHQWWHZRUGHQEHSHUNW+LHUELMNDQJHGDFKWZRUGHQDDQKHWDDQSDV
VHQYDQKHWWRLOHWV\VWHHPRDELMYRRUNHXUZDWHUOR]HXULQRLUVGRRUPDQQHOLMNHJHEUXLNHUV
HQRIPLQGHUVSRHOZDWHUHQHHQJRHGHYRRUOLFKWLQJDDQGHJHEUXLNHUV
• 2PDPPRQLDNHPLVVLHWHYRRUNRPHQGLHQWQDKHWDDQEUHQJHQYDQGHXULQHGHXULQH]RVQHO
PRJHOLMNLQGHJURQGWHZRUGHQJHZHUNW
• 9RRUNRPHHQWHKRJHYROXPHGRVHULQJ
• %HSHUNJHXUKLQGHUHQDPPRQLDNHPLVVLHGRRUWRHSDVVLQJHHQERXZODQGLQMHFWHXURIPDFKL
QHVGLHYORHLEDUHPHVWNXQQHQLQMHFWHUHQ]RDOVELMYRRUEHHOGGHVSDDNZLHOEHPHVWHU]LHILJ
• +RXGWELMGHDDQOHJYDQGHDDQWDOOHQHQGHYROXPHVYDQXULQHRSVODJWDQNVUHNHQLQJPHWHHQ
IOH[LEHOEHPHVWLQJVUHJLHP
• =RUJYRRUHHQJRHGHFRPPXQLFDWLHHQHHQJRHGHEHJHOHLGLQJELMGHDDQOHJYDQV\VWHPHQ
HQGHXLWYRHULQJYDQGHEHPHVWLQJZDQQHHUGLWYRRUGHHHUVWHNHHUJHGDDQZRUGW
)LJXXU6SRUWYHOGYDULDQWVSDDNZLHOEHPHVWHUOLQNVEURQORRQEHGULMIWDPPLQJDQO/DQGERXZYDULDQW
VSDDNZLHOEHPHVWHUUHFKWVEURQZZZDJHUODQGQO
• 2QGHU]RHNGHEHPHVWHQGHZDDUGHYDQ]XLYHUHXULQHHQGHHIIHFWHQRSGHRSEUHQJVWHQ
HYHQWXHOHQHYHQHIIHFWHQRSSURHIYHOGHQGLHJHVFKLNW]LMQYRRUVHPLZHWHQVFKDSSHOLMNH
GRHOHLQGHQ
• 2QGHU]RHNGHHIIHFWHQYDQKHWDDQEUHQJHQYDQHHQPHQJVHOYDQ]XLYHUHXULQHHQYDUNHQV
GULMIPHVWRSSURHIYHOGHQGLHJHVFKLNW]LMQYRRUVHPLZHWHQVFKDSSHOLMNHGRHOHLQGHQ
• 2QGHU]RHNGHPHHVWNDQVULMNHDJUDULVFKHWRHSDVVLQJHQEYELRORJLVFKHODQGERXZDOJHQ
NZHHN
• 2QGHU]RHNGHEHSHUNLQJHQWHQJHYROJHYDQGHPHVWZHWJHYLQJHQGHQRRG]DNHOLMNHDDQSDV
VLQJHQKLHUYDQ
• 2QGHU]RHNKHWJHGUDJHQHIIHFWHQYDQPHGLFLMQHQYRRUKHWDTXDWLVFKPLOLHXHQERGHPRS
ODQJHWHUPLMQ
'HVSDDNZLHOEHPHVWHULVRQWZLNNHOGYRRUGHWRHGLHQLQJYDQYORHLEDUHNXQVWPHVWEHWUHIWYHHOODJHUHKRHYHHOKHGHQ
YORHLVWRISHUKHFWDUH
-G:UHYLVLH'
3DJLQDYDQ
29.4.2010
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 1
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 2
1
29.4.2010
What is a fertilizer?
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 3
Classification of Fertilizers
• Liquid ↔ Solid
• Mineral ↔ Organic
Fertilizer type
mineral organic
Nutrient concentration high low
> 8% < 1-5%
Nutrient availability high partially available
(Timing & Efficiency) N - hardly available
P - medium term like MF
K like MF
Soil structure - Improvement
CEC - Improvement
Hygiene - Treatment required
Price high Treatment required
(Clemens, 2005)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 4
2
29.4.2010
Change of perspective
Folie 5
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
Properties of products
Folie 6
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
3
29.4.2010
Urine
Muskolus, 2006
Folie 7
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
Folie 8
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
4
29.4.2010
Potassium Ammonium
Urine’s fertiliser products
Phosphate
Mostly derived in high-tech solutions
Achieved through a combination of Tettenborn, 2007
various treatment steps
Limiting factor in production: energy
costs
Different plant availability of different
Stercorit
Tettenborn, 2007
MAP products according to specific
crop (Simons, 2008)
Tettenborn, 2007
Folie 9
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain
29.4.2010
History – E. Wolff
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 10
5
29.4.2010
6
4
2
0
c u u/s m (Clemens, 2005)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 11
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 12
6
29.4.2010
(FAZ.NET, 2008)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 13
(FAZ.NET, 2008)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 14
7
29.4.2010
Urine as fertiliser
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 15
Pharmaceuticals
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 16
8
29.4.2010
Schematic Approach
PHASE I
Screening Pflanzen-
versuche
Feedback
PHASE II
First Results
Analysis Verified Results
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 17
Database
Sub-
Article Place
stance
Transformation
Media
products
Degradation
e.g. Sorption, Biodegradation
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 18
9
29.4.2010
Database
Sub-
Article Place stance
380 of 760 310 330
Transformation
Media
products
1670
Water, Wastewater, Soil, Plants
2050 1700 420 350
Degradation
e.g. Sorption, Biodegradation
490 330
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 19
Evaluation of Database
Uptake Phytotoxcity
Datasets 162 348
Substances 14 30
Plant species 25 30
Plant families 16 11
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 20
10
29.4.2010
Uptake Phytotoxicity
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 21
Uptake Phytotoxicity
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 22
11
29.4.2010
Evaluation of Database
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 23
Evaluation of Database
Factor
Substance Plant species Reported impacts
(DB/U)
Chloroquine soybean Phytotoxic: neg. on w, h, r, s, l 182
Chlorotetracycline spring wheat Phytotoxic: pos. on h, r 82
Chlorotetracycline pinto bean Phytotoxic: neg. on w, h, r, s, l 82
Bioaccumulation:
Chlorotetracycline green onion 51
0.013 ng kg-1 FW in stalk & leaves
Bioaccumulation:
Chlorotetracycline cabbage 51
0.01 ng kg-1 FW in stalk & leaves
Metronidazole soybean Phytotoxic: neg. on w, h, r, s, l 67
Oxytetracycline spring wheat Phytotoxic: pos. on h, r 2
Oxytetracycline pinto bean Phytotoxic: neg. on w, h, r, s, l 2
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 24
12
29.4.2010
Evaluation of Database
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 25
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 26
13
29.4.2010
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 27
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 28
14
29.4.2010
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 29
Dairy Cow
(Weight: 600 kg / Milk production: 50 kg d-1)
Dry matter:
CZ uptake:
?
approx. 19 kg d-1 (DLG, 2005)
1.4 mg d-1
Human being: 0.8 - 2 g d -1 (Mutschler et al., 2001)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 30
15
29.4.2010
?
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 31
Pot experiments
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 32
16
29.4.2010
Germination Tests
5 pharmaceuticals used
At different concentration levels to identify analytical
Winker et al. 2008. Comparison of
and theoretical
pharmaceutical concentrations in
phytotoxicologic effects. human urine in Germany. Water
Research 42 (14), pp. 3633 -3640.
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 33
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 34
17
29.4.2010
Germination Tests
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 35
Conclusion I
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 36
18
29.4.2010
Conclusion II
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 37
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 38
19
29.4.2010
NH3-Emissions
25
cummulated NH 3 volatilization
20
15
[kg N ha -1]
slurry
urine/slurry
10 urine
0
0 20 40 60 80 100
hours after application [h]
(Clemens, 2005)
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 39
19-22 April 2010 | S2Small 2010 - IWA Conference | Girona | Spain Folie 40
20
Three years of operation of the urine-diversion system
in GTZ headquarters in Germany; user opinions and
maintenance challenges
S. Blume* and M. Winker*
INTRODUCTION
The main building (“Building 1”) of the GTZ headquarters which consists of four
buildings and is located near Frankfurt, Germany, was renovated from 2004 to 2006
after being in use for 30 years. As part of this renovation, principles of
environmentally friendly construction for the water and energy management of the
building were included. This contained a urine separation system with 50 waterless
urinals, 25 source separating or urine-diversion (UD) flush toilets, and a urine storage
tank of 10 m³ to allow the separate collection of urine.
The background of this ecosan initiative is described in SuSanA (2009) and the
objectives were to demonstrate the implementation of such a resource-oriented
sanitation system, to reduce the amount of water used in the GTZ building, and to
research important aspects for Germany such as social acceptance and reuse of urine
in agriculture. This third objective started now within SANIRESCH, an
accompanying research project funded by the German ministry (since mid 2009) and
was initiated by the former head of GTZ’s ecosan program, Christine Werner.
Operation of the system started in 2006 and the experiences gained since then with
user behaviour, user acceptance, and with the technical components are described in
this paper.
Figure 1: Left: UD flush toilet and its schematic side view; right:: waterless urinal.
The toilets and urinals are located in the core of the building in the restrooms closest
to the canteen and the large meeting rooms (Figure 2). In the wings in each floor
(aside the top floor) are bathroom equipped with conventional toilets and urinals
available. Hence, persons working in the building on a daily base have the choicechoic
between the two different options aside those in the top floor where bathrooms are
only located in the core section.
section The usage is that of typical office building which is
mainly frequented from Monday to Friday from 9 am to 5 pm. On average around
120 l of urine is collected per day.
Figure 2: Schematic design of the restroom locations at an average floor of the 10-
storey building which is double-Y
double shaped.
User surveys with questionnaires
uestionnaires
Two user surveys were undertaken since the operation started in 2006. 2006 The first one
was carried out in September 2008 to evaluate the general acceptance of the toilets by
the users. The second survey was performed in May 2009 and had a more specific
focus on toilet hygiene issues as a result of the earlier questionnaire.
Both surveys were conducted electronically (using the websites Surveygizmo and
Surveymonkay). In the first one, about 900 GTZ employees working in the
headquarters were contacted independently of their office location within the four
GTZ buildings at this site. All contacted employees were employed within the
Department of Planning and Development, which is GTZ’s department for the
worldwide technical support of its programs. The questionnaire took approx. 5 min to
complete. Apart from statistical parameters about the employees and the general
perception of reuse oriented sustainable sanitation systems, it covered topics of toilet
design, hygiene, odour, ease of use and reuse.
The second questionnaire (in May 2009) was focussed on hygienic aspects and an
improvement of the hygienic situation. This questionnaire was sent to only 50 GTZ
employees, whose offices are located close to the respective restrooms in the core of
Building 1 (Figure 2). This selection was done to focus on employees who use the UD
flush toilets and waterless urinals daily. It was designed so that it could be answered
within 3 min. Apart from statistical information such as distance to the toilets,
regularity of usage, age and gender, the questions tried to determine what measures
could encourage users to sit down on toilets in an office building.
Attitudes of cleaning and maintenance staff
The cleaning staff (employed by an external service provider) and GTZ facility
management staff were contacted regularly in connection with user feedback and
technical problems. As the waterless urinals and UD flush toilets were new, the
personnel had to find out how to maintain the system. In fact, it took some time to
discover the crucial aspects and to rectify technical problems.
Table 1: Parameters used for measuring of the users’ acceptance by comparing the
source separating with a conventional system. Numbers show percentages (%) of total
answers (218) for toilets and (88) answers of the male urinal users.
Perception UD flush toilets Waterless urinals Both
compared to Optical Clean- Optical Clean- Ease of
Odour Odour
conv. system appearance liness appearance liness use
Better 12 5 7 17 14 8 5
Same 76 45 61 77 52 32 57
Worse 12 51 32 6 34 60 39
When asked for their private decisions, almost
a 50% or respondents stated that they
would move to a flat with UD flush toilets whilst 27% are not sure and 25% would
not. 17% would even pay a higher price for buying such an apartment (40% maybe
and 43% not). Asked about the waterless urinals, 37% would support that other GTZ
offices
fices install waterless urinals, 41% had no opinion and 22% would not support such
measures.
Although the technical functionality and hence acceptance of the UD flush toilets is
not good, a remarkable 90% of the participants are positive towards the idea to collect
urine and faeces separately
ly from each other and to use them as fertiliser
er in agriculture.
71% would even buy crops which have been fertilised
fertili ed with human excreta according
to WHO guidelines (WHO, 2006). Even more people (82%) would buy none-edible none
products which have been fertilised
fertili with human excreta. When asked for their opinion
if urine shouldd be allowed as fertiliser for organic agriculture, 45% agreed
agree and 42%
might agree while 12% do not support this concept.
concept On a personal level, one
o third of
the participants would use and further 39% said they might use urinee for their own
balcony plants.
Figure 3: User opinions regarding the resource oriented sanitation in GTZ Building 1
according to Survey 1 (total of 218 participants).
The reactions for acceptance of food fertilised with urine is in line with other similar
investigations. Muskolus (2008) interviewed inhabitants in Berlin as well as people
with an agricultural background,
background and 62% % of both groups stated that they would buy
food produced with urine as fertiliser.
fert Also in Switzerland, 72% % of different user
groups (also partially users of UD flush toilets) consider these techniques as a good
idea and 86% would even move into a flat equipped with such a concept (Lienert et
al., 2006; Larsen and Lienert, 2006). This is a much higher percentage than
th found in
Survey 1 undertaken at GTZ and is most likely due to technical and maintenance
problems (see below).
Survey 2: User views regarding sitting on toilets
This survey investigated the enhancement of the hygienic perception by the users to
encourage them to sit on the toilet. Age distribution of the participants was similar to
Survey 1, and 40% of the respondents were female and 60% male. As only 25 people
responded (out of 50 approached) the survey results are not necessarily representative
but provide a general idea. 52% of respondents said that they used the UD flush toilets
on a regular basis.
They employees were asked which hygienic devices they would prefer to entice them
to sit on the toilet.. Sitting is necessary in order to activate the urine valve (otherwise
urine flows to the faeces section and mixes with the brownwater). Almost 50% of
respondents would prefer disinfection spray which is applied with toilet paper to clean
the toilet seat, 8% would favour
favo paper covers and 35% other devices. The respondents
stated that they would apply these hygienic devices either on a regular basis (26%),
only if the toilets were not clean (21%) or not at all (17%).
The participants were also asked if they would sit down on the toilet if the above
mentioned hygiene devices were available (results results summarised in Figure 4). The
question was a restatement of the earlier ones to receive more precise information of
users’ attitudes towards sitting on a public toilet.
toilet The results confirmed that most
users would prefer a disinfection spray (52%)(52 or a paper cover (48%)
%), and 35% of
users find it sufficient to use toilet paper used as cover (35%).. The willingness to sit is
52% of respondents if they had a disinfection spray spray available compared to only 17%
of respondents if no hygiene device was available.
To avoid odor problems with the waterless urinals different cleaning agents were
tested. Best results were achieved with the “MB Aktivreiniger” of Urimat. This is an
environmentally friendly cleaning agent with microbiologically active ingredients.
Furthermore, a permanent deodorant air diffuser was installed in the toilet room in the
first floor.
Figure 5: Left: Soft urine precipitations inside a urine valve. Right: the same valve
after cleaning soaking in citric acid for several days (source: L. Ulrich, 2009).
Low nitrogen content of the collected urine
Low nitrogen concentrations were observed in the urine collection tanks at GTZ: With
2,800 mg l-1 the measured nitrogen concentration for the stored urine is two thirds less
than typical literature values for pure urine of 8,000 mg l-1 (Meinzinger and
Oldenburg, 2009). The main reason for this is probably that nitrogen loss occurs in the
form of ammonia gas being emitted through the tank’s ventilation system, which has
also been reported at the Eawag building (Goosse et al., 2009). Urine tanks should not
be ventilated, only pressure equalized (v. Münch et al., 2009) but in this case, a
10 mm vent pipe from the urine tanks goes all the way to the top of Building 1,
causing more ventilation than desired. It is also possible that the urine is diluted with
flush water if users flush while being seated or if the urine valve is broken.
Recommendations for maintenance
Based on the three years of experience, now the following maintenance routines
(supervision that they are really being adhered to is crucial and not always easy) are
recommended:
• Every evening the waterless urinals have to be cleaned (wiped down manually).
• On highly frequented toilets (on ground floors close to canteens and meeting
rooms) additional cleaning on an hourly base is recommended using a wet cloth
and subsequently spraying the detergent containing fragrant substances as well.
• The smell stops (flat rubber tubes) have to be taken out daily and cleaned with
detergent and rinsed with water.
• As the rubber of the smell stops fatigues and then sticks together, the smell stops
have to be replaced about once per year.
• The daily cleaning routine for UD flush toilets is in principle the same as for
conventional ones although it is more time consuming to clean away faeces stains
due to the more complicated bowl design.
• For precipitation prevention the urine valve needs to be soaked once per month
with citric acid for a period of 24 hours. This is done by filling 200 ml of the citric
acid into the open valve (seat pressed down to open the valve).
• Annually, the functionality of the urine valves should be controlled and once per
year clogged valves should be cleaned or replaced.
CONCLUSIONS
The overall result from the user surveys is that the users appreciate the resource
oriented sanitation concept (recycling of nutrients and water savings) but are unhappy
with the inconveniences caused by the technical design of the UD flush toilets.
Furthermore, it was shown that a crucial point for users is perceived or actual toilet
hygiene: People’s willingness to sit down on the toilet could be raised significantly if
disinfection devices were available.
For a wider acceptance, further technical development of the UD flush toilets would
be necessary. A high turn-over in cleaning staff and communication difficulties makes
it difficult to communicate the necessary cleaning routines which take a little bit more
extra time and are new for the cleaning staff. Hence, before such urine-diversion flush
toilets can be widely spread, clear cleaning and maintenance routines are required.
On a positive note, this demonstration and research project has attracted wide
attention for the ecosan approach within GTZ (implementing development
cooperation projects worldwide) and outside of GTZ. Each year, many international
delegations and student groups take part in guided tours of the installations, which
raises their awareness about resource oriented sanitation systems.
ACKNOLWLEDGEMENTS
The authors wish to thank Christine Werner (AGIRE programme, GTZ, Morocco) for initiating the
project in her position as team leader of the GTZ Ecosan team, Lukas Ulrich (former GTZ intern; now:
ETH Zurich, Switzerland) for devising and conducting the second survey and Dr. Elisabeth von Münch
for critical review of this paper.
REFERENCES
Goosse P., Steiner M., Udert K. & Neuenschwander W. 2009. NoMix Toilettensysteme. Erste Monitoring
Ergebnisse im Forum Chrisbach. GWA 7, 567-574.
Larsen T. and Lienert J. 2007. Novaquatis final report. NoMix - A New Approach to Urban Water Management.
Eawag, Dübendorf, Switzerland. URL: http://www2.gtz.de/Dokumente/oe44/ecosan/de-Nomix-Toilettensystem-
erste-Monitoringergebnisse.pdf.
Lienert J. & Larsen T.. 2006. Considering user attitude in early development of environmentally friendly
technology: A case study of NoMix toilets. Environ. Sci.Technol. 40(16), 4838-4844.
Lienert J., Thiemann K., Kaufmann-Hayoz R. & Larsen T. 2006. Young users accept NoMix toilets - a
questionnaire survey on urine source separating toilets in a college in Switzerland. Wat. Sci. Technol. 54(11-12),
403-412.
Meinzinger F. & Oldenburg M. 2009. Characteristics of source-separated household wastewater flows - a
statistical assessment. Water Sci. Technol. 59(9), 1785-1791
SuSanA (2009). Case study of sustainable sanitation projects. Urine and brownwater separation at Eschborn,
Germany. Sustainable Sanitation Alliance. URL: http://www.susana.org/images/documents/06-case-studies/en-
susana-cs-germany-eschborn-house-1-2009.pdf.
v. Münch E.& Dahm P. 2009. Waterless Urinals. A Proposal to Save Water and Recover Urine Nutrients in Africa.
In: 34th WEDC International Conference, Addis Ababa, Ethiopia. URL: http://www2.gtz.de/Dokumente/
oe44/ecosan/en-waterless-urinals-a-proposal-to-save-water-and-recover-urine-nutrients-in-africa-2009.pdf.
v. Münch E., Olt, C. and Winker M. 2009. Technology review | Urine diversion components. GTZ, Eschborn,
Germany. URL: http://www.gtz.de/en/dokumente/gtz2009-en-technology-review-urine-diversion.pdf.
WHO. 2006. WHO Guidelines for the Safe Use of Wastewater, Excreta and Greywater. Vol. IV, Excreta and
Greywater use in Agriculture, WHO/UNEP/FAO. URL: http://www.who.int/water_sanitation_health/
wastewater/gsuww/en/index.html.