Documente Academic
Documente Profesional
Documente Cultură
its Main sources for DNA and RNA sequences are direct submissions from individual researchers, genome sequencing projects and patent applications. The database is produced in an international collaboration with GenBank (USA) and the DNA Database of Japan (DDBJ). Each of the three groups collects a portion of the total sequence data reported worldwide, and all new and updated database entries are exchanged between the groups on a daily basis. The EMBL nucleotide sequence database forms part of the European Nucleotide Archive, an EBI project led by Guy Cochrane as part of the The Protein and Nucleotide Database Group (PANDA) under Ewan Birney. The EMBL Nucleotide Sequence Database can be accessed a variety of ways Like SRS system ,Batch Retrival, Simple sequence retrival, FTPserver etc.Data submission is allowed by Webin - WWW Nucleotide Sequence Submissions Sequin , Third Party Annotation (TPA) Submission, BARCODE Submission.Data search by BLAST & FASTA. EMBL Database contained 301,588,430,608 nucleotides in 199,575,971 entries (9th june 2011). EMBL Format
ID XX AC XX SV XX DT DT XX DE XX KW XX OS OC OC XX RN RX RA RT RT the RT RL XX RN RP RA RT RL X64011; SV 1; linear; genomic DNA; STD; PRO; 756 BP. X64011; S78972; X64011.1 28-APR-1992 (Rel. 31, Created) 30-JUN-1993 (Rel. 36, Last updated, Version 6) Listeria ivanovii sod gene for superoxide dismutase sod gene; superoxide dismutase. Listeria ivanovii Bacteria; Firmicutes; Bacillus/Clostridium group; Bacillus/Staphylococcus group; Listeria. [1] MEDLINE; 92140371. Haas A., Goebel W.; "Cloning of a superoxide dismutase gene from Listeria ivanovii by functional complementation in Escherichia coli and characterization of gene product."; Mol. Gen. Genet. 231:313-322(1992). [2] 1-756 Kreft J.; ; Submitted (21-APR-1992) to the EMBL/GenBank/DDBJ databases.
RL J. Kreft, Institut f. Mikrobiologie, Universitaet Wuerzburg, Biozentrum Am RL Hubland, 8700 Wuerzburg, FRG XX FH Key Location/Qualifiers FH FT source 1..756 FT /db_xref="taxon:1638" FT /organism="Listeria ivanovii" FT /strain="ATCC 19119" FT /mol_type="genomic DNA" FT RBS 95..100 FT /gene="sod" FT terminator 723..746 FT /gene="sod" FT CDS 109..717 FT /transl_table=11 FT /gene="sod" FT /EC_number="1.15.1.1" FT /db_xref="GOA:P28763" FT /db_xref="HSSP:P00448" FT /db_xref="InterPro:IPR001189" FT /db_xref="UniProtKB/Swiss-Prot:P28763" FT /product="superoxide dismutase" FT /protein_id="CAA45406.1" FT /translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAVSG FT FT DVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK" XX SQ Sequence 756 BP; 247 A; 136 C; 151 G; 222 T; 0 other; cgttatttaa ggtgttacat agttctatgg aaatagggtc tatacctttc gccttacaat gtaatttctt .......... 120 //
60
ID SQ DT AC DE KW OS OC RN RP RA RT RL XX OG RC DR FH FT CC
Identification Sequence Header Date Accession Number Description Key word Organism Species Organism Classification Reference Number Reference Position Reference Author Reference Title Reference Location Spacer line Organelle Reference comment Database cross reference Feature table header Feature table data Comment or notes
Begins each entry1 per entry 1 per entry 2 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry >=1 per entry Many per entry 0 or 1 per entry >=0 per entry >=0 per entry 0 or 2 per entry >=0 per entry >=0 per entry