Sunteți pe pagina 1din 255

Diabetul zaharat

Definiie

Sindrom heterogen caracterizat printr-o tulburare


complex n reglarea metabolismului energetic al
organismului, care afecteaz deopotriv utilizarea
glucidelor, lipidelor i proteinelor, precum i celelalte
metabolisme; aceste alterri sunt datorate insuficienei
absolute sau relative de insulin. Modificrile biochimice pe
care aceste tulburri le antreneaz conduc la modificri
celulare funcionale urmate de leziuni anatomice ireversibile
n numeroase esuturi i organe.

Definiie
Nu este o boal n sensul tradiional al termenului

Sindrom
- alctuit dintr-un grup heterogen de tulburri cu
etiologie i patogenie diferite
- componentele sindromului au ca element comun
hiperglicemia

Etimologie
Diabeiu (greaca veche) = a se scurge ca printr-un sifon
(aluzie la poliuria marcat a acestor pacieni)
Thomas Willis (medic, anatomist i profesor la Oxford)
- 1674 - a descoperit c urina este dulce
- a adugat cuvntul mellitus (ca mierea)

Diabetes mellitus
(Diabet zaharat)

Epidemiologie
Aretaeus din Cappadocia (81-138) boala este rar
Date epidemiologice propriu-zise: nceputul sec. XX

Tendine epidemiologice ale diabetului n lume


Prevalena DZ a crescut peste tot n
lume:
- 1990 127 milioane diabetici
- 2000 151 milioane diabetici
- 2010 285 milioane diabetici
(6,6% dintre aduli)
Congres IDF decembrie 2013
- 2013 382 milioane diabetici
(8,3% din populaia adult a planetei)
- 2035 592 milioane diabetici
(10,1% din populaia adult a planetei)

Prevalena diabetului zaharat la nivel mondial


"Epidemia de diabet

IDF Diabetes Atlas 6th Ed. 2013

Pancreasul endocrin - noiuni de anatomie i


fiziologie
Insulele Langerhans

800.000 1.500.000
1 2 % din masa
pancreatic total
Celule: A, B, C, D

Hormonii secretai n celulele insulelor


Langerhans
Tipul
celular

Hormonul
produs

Glucagon

Hiperglicemiant prin glicogenoliz

Insulin
Peptidul C
Amilin

Hipoglicemiant prin mec. multiple


Efecte metab. incomplet cunoscute
Hiperglicemiant

C(PP)

Polipeptid
pancreatic

Influen pe motilitatea gastric i


absorbia principiilor nutritive

Efect pe metabolismul glucidic

Somatostatin Hiperglicemiant, inhib secreia


insulinei

Insulina structur, sintez, secreie

Secreia insulinei

Secreia insulinei
bazal insulinemia plasmatic = 10-12 U/ml
stimulat insulinemia plasmatic 50-75 U/ml

Receptorul de insulin

Controlul hormonal al glicemiei


Insulina
Efect net: scderea glicemiei

Hormoni de contrareglare
Efect net: creterea glicemiei

nlturrii glucozei din snge

nlturrii glucozei din snge

intrrii glucozei n celule

intrrii glucozei n celule

glicogenezei
glicogenezei
eliberrii glucozei din depozite eliberrii glucozei din
depozite
glicogenolizei
glicogenolizei
gluconeogenezei
lipolizei i cetogenezei
catabolismului proteic

gluconeogenezei

lipolizei i cetogenezei
catabolismului proteic

Clasificarea DZ (OMS,1998)
DZ tip 1 - autoimun
- idiopatic
DZ tip 2
Alte tipuri specifice - defecte genetice ale celulelor
- defecte genetice ale aciunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente i substane chimice
- infecii
- forme rare de diabet imun
- sindroame genetice rare
Diabetul gestaional

Diabetul zaharat tip 1


Poate apare la orice vrst, dar mai frecvent sub 30 ani
Dei exist o predispoziie genetic, majoritatea
pacienilor nu au antecedente familiale de DZ
Debut relativ abrupt, cu simptome evidente i tendin la
cetoacidoz
De obicei, pacienii sunt slabi
Rezult n urma distrugerii celulelor -pancreatice
Insulina plasmatic este foarte redus sau absent
Anticorpi circulani: antiinsulin, anticelule , anti-GAD
Pacienii sunt dependeni de insulin

Etiopatogenia DZ 1 autoimun
Predispoziie genetic
Factor de mediu (viral, toxic, alimentar)
Activare autoimun insulit
Scderea capacitii -secretoare; afectarea fazei secretorii
iniiale, dar insulinemia plasmatic este normal
Diabet clinic manifest; insulinemie plasmatic sczut,
hiperglicemie, apar simptomele
Apariia complicaiilor

Diabetul zaharat tip 2

Apare, de obicei, dup vrsta de 40 ani


80% din cazuri: obezi
Perioad prediagnostic lung
Simptomatologie de debut tears sau absent, fr
tendin la cetoacidoz
Asocierea a dou defecte celulare: rezistena la insulin
i deficiena funciei -celulare
Cel puin iniial, capacitatea secretorie -pancreatic
este relativ pstrat, rspunznd bine la diet i ADO;
ulterior, unii vor necesita insulinoterapie

Etiopatogenia DZ 2
Factori genetici transmitere poligenic
Rezisten crescut la aciunea insulinei
Hiperinsulinism funcional
Deficien n secreia insulinic hiperglicemie persistent
Scderea absolut a secreiei insulinice
DZ 2 insulinonecesitant

Clasificarea DZ (OMS,1998)
DZ tip 1 autoimun (1A)
- idiopatic (1B)
DZ tip 2
Alte tipuri specifice - defecte genetice ale celulelor
- defecte genetice ale aciunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente i substane chimice
- infecii
- forme rare de diabet imun
- sindroame genetice rare
Diabetul gestaional

Diagnosticul clinic al DZ
Poliurie
Polidipsie
Polifagie
Scdere ponderal
Astenie

Caracteristicile generale ale DZ 1 i 2


Particularitate

Tipul 1

Tipul 2

Ereditate

Concordan 30-50%

Concordan 90%

Baza genetic

Defect n programarea IR i/sau insulinoimunitii


deficien

Semne de
autoimunitate

Prezente

Absente

Debut

Sub 40 de ani

Peste 40 de ani

IMC

Sczut

Crescut (80%)

Insulinemia
plasmatic

Sczut

Crescut

Tendina la
cetoz

Marcat

Absent

Tratament oral

Ineficient

Eficient

Criterii de diagnosticare a DZ
(diagnosticul paraclinic)
Cel puin dou glicemii a jeun 126 mg/dl (7 mmol/l)
sau
Prezena simptomelor i o glicemie ntmpltoare (n
orice moment al zilei) 200 mg/dl (11,1 mmol/l)
sau
O glicemie 200 mg/dl (11,1 mmol/l) la 2 ore dup
administrarea a 75 g glucoz (TTGO)
N.B. - glicozuria NU este un criteriu de dg.
- NU se recomand ca dg. de DZ s se bazeze pe
glicemii efectuate pe glucometre
- HbA1c NU se folosete pentru diagnosticul DZ

Glucoza plasmatic versus glucoza din sngele


total

Glucoza din plasm

Glucoza din sngele total

126 mg/dl (7 mmol/l)

110 mg/dl (6,1 mmol/l)

200 mg/dl (11,1 mmol/l)

171 mg/dl (9,5 mmol/l)

Criterii de interpretare a glicemiei bazale

70-110 mg/dl normal


110-125 mg/dl glicemie bazal modificat
126 mg/dl diabet zaharat probabil;
confirmarea se face dup a doua dozare

Criterii de interpretare a TTGO


Glicemie n plasma venoas
Diabet zaharat
- bazal
- la 2 h dup glucoz

126 mg/dl (7 mmol/l)


200 mg/dl (11,1 mmol/l)

Scderea toleranei la
glucoz
- bazal
- la 2 h dup glucoz

< 126 mg/dl (7 mmol/l)


140 mg/dl (7,8 mmol/l) i
< 200 mg/dl (11,1 mmol/l)

Normal
- bazal
- la 2 h dup glucoz

< 110 mg/dl (7 mmol/l)


< 140 mg/dl (7,8 mmol/l)

Modaliti de debut i de diagnostic ale DZ


Pacient simptomatic
- simptomele clasice de diabet
- simptome ale complicaiilor - acute
- cronice
Pacient asimptomatic
- bilan al strii de sntate
- depistare activ la subieci cu risc

Indicaiile screening-ului pentru DZ 2 la subiecii


asimptomatici cu ajutorul glicemiei bazale (1)
Toi subiecii cu vrsta 45 ani
Glicemia jeun se va repeta la intervale de minimum 3 ani
Testarea se va face la vrste sub 45 ani i se va repeta la intervale

mai scurte la toi subiecii cu IMC 25 kg/m 2 (IMC 23 kg/m2 la


asiatici) care mai prezint i al i factori de risc

Indicaiile screening-ului pentru DZ 2 la subiecii


asimptomatici cu ajutorul glicemiei bazale (2)
Subieci cu factori de risc:
- sedentarii
- persoanele cu rude de gradul I cu DZ
- grupurile etnice cu risc crescut
- hipertensivii ( 140/90 mmHg sau sub trat. antihipertensiv)
- dislipidemicii (HDL 35 mg/dl i/sau TG 250 mg/dl)
- femeile care au nscut copii cu greutatea peste 4,5 kg
- femeile care au avut diabet gestaional
- femeile cu ovar polichistic
- persoanele cu HbA1c 5,7%, GBM sau STG la testri ant.
- alte condiii clinice asociate cu insulinorezisten (obezitate sever,
acanthosis nigricans)
- antecedente de BCV

Complicaiile DZ
Acute
- infeciile
- comele - hiperglicemice - cetoacidozic
- hiperosmolar
- lactacidemic
- hipoglicemic
Cronice
- microangiopatice
- macroangiopatice
- neuropatice

Infeciile
Frecvente la diabeticul dezechilibrat
Predispoziia ctre infecii explicat prin modificri legate
de hiperglicemie:
- mobilizrii i chemotactismului leucocitar
- capacitii fagocitare a polimorfonuclearelor
- capacitii bactericide a polimorfonuclearelor
- funciilor monocitare

Infecii puternic asociate diabetului (quasi-specifice),


severe, dar foarte rare:
- mucormicozele
- otita extern malign
- pielonefrita emfizematoas
- colecistita emfizematoas
Infecii postterapeutice:
- abcese insulinice, infecii asociate transplantului renal,
dializei peritoneale, hemodializei
Infecii nespecifice asociate DZ:
- infecii urinare: cistite, pielonefrite, abcese renale/perirenale
- infecii respiratorii
- infecii cutanate, mucoase, ale esutului celular s.c.
- altele: fasceita necrozant, gangrena Fournier a organelor
genitale

Hipoglicemiile
Definiie scderea valorilor glicemiei sub 70 mg/dl n plasma venoas (sub 60
mg/dl n sngele venos total)
Triada Whipple:
- simptome sugestive pentru hipoglicemie dup post prelungit sau exerci iu fizic
- documentarea unei valori glicemice sczute
- corecia simptomelor dup corec ia valorilor glicemice
Cauze - exces de insulin sau de ADO secretagoge
- scderea aportului glucidic
- efort fizic excesiv
- consumul de alcool

Hipoglicemiile - fiziopatologie
Mecanismele de aprare mpotriva hipoglicemiei
- scderea secreiei de insulin
- creterea secreiei pancreatice de glucagon
- stimulare simpatic secreiei de catecolamine
- creterea secreiei de cortizol i h. de cretere
La pacientul diabetic
- scderea secreiei de insulin nu e un mecanism activ
- afectarea secreiei de glucagon la DZ 1 cu o perioad lung de
evoluie
- diminuarea secreiei de catecolamine prin neuropatie vegetativ

Hipoglicemiile manifestri clinice


Semne periferice (de alarm adrenergic)
- tremurturi ale extremitilor, transpiraii, paloare,
tahicardie, palpitaii, anxietate, foame, parestezii distale
Semne centrale (de neuroglicopenie)
- tulburri de atenie, concentrare, memorie, coordonare,
comportament; oboseal, somnolen; tulburri de vorbire;
tulburri de vedere; parestezii peribucale; cefalee; contracturi
musculare localizate/generalizate; com profund, agitat
Atenie:
- idiosincrazia manifestrilor hipoglicemice
- alterarea contrareglrii adrenergice prin neuropatie
vegetativ

Hipoglicemiile
Clasificare
uoare: recunoscute i corectate de ctre pacient, nu
afecteaz capacitatea de munc i inseria n mediu
medii (moderate): afecteaz capacitatea de munc i inser ia
n mediu
severe: totalitatea hipoglicemiilor care necesit interven ia n
urgen a unei alte persoane (tratament injectabil); includ, dar nu
se limiteaz la comele hipoglicemice
Cazuri particulare
- hipoglicemiile necontientizate
- hipoglicemiile nocturne

Complicaiile hipoglicemiilor
Accident vascular cerebral
Infarct de miocard
Tulburri funcionale cerebrale minore
Encefalopatia posthipoglicemic
Hemoragii retiniene masive
Decerebrare

Tratamentul hipoglicemiilor
Tratament preventiv educaia pacientului diabetic
Tratament curativ
- hipoglicemiile uoare i medii
- glucide rapid + lent absorbabile
- hipoglicemiile severe
- glucoz i.v.
- glucagon
- glucide rapid + lent absorbabile

Cetoacidoza diabetic - date generale

Definiie triada - hiperglicemie


- cetoz
- acidoz
F>B
Vrsta medie 43 ani
20 % episoade multiple
20 % apar la diabetici nou diagnosticai

Fiziopatologia cetoacidozei diabetice


Insuficien absolut sau relativ
de insulin

Lipoliz

Proteoliz

Hiperproducie de
corpi cetonici

Accelerarea glicogenolizei i
neoglucogenezei
Eliberarea de alanin
i ali aminoacizi

Acidoz metabolic

Hiperglicemie i
glicozurie
Pierdere de ap, K+ PO-4,
baze tampon

Creterea ureei
Poliurie osmotic

Deshidratare

Colaps

COM

Aritmie

Hiperosmolaritate

Sete

Polidipsie

Cauzele cetoacidozei diabetice


Insulinodeficiena absolut
- ntreruperea insulinoterapiei
- cetoacidoz inaugural (20%)
Insulinodeficiena relativ
- afeciuni intercurente
- endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia
- iatrogen (corticoizi, simpatomimetice)
- sarcin
- stress

Tablou clinic
Facies vultuos
Temp. cutanat
Semne neuromusculare hipotonie moderat, diminuarea ROT
Semne de deshidratare cutaneo-mucoas
Semne cardiovasculare tahicardie; TA e de obicei normal
Semne respiratorii halen acetonemic, dispnee Kssmaul
Semne digestive greuri, vrsturi, dureri abdominale
Starea de contien de obicei pstrat

Diagnostic paraclinic
Hiperglicemie: 350 1200 mg%

Hipercetonurie: > 30 mEq/l

Tratamentul cetozei incipiente

Creterea dozelor de insulin


Hidratare corespunztoare
Buturi reci ndulcite cu zahr sau glucoz,
n cantiti mici i la intervale scurte
Sucuri de fructe, supe de legume, ceai cu zahr, compot
Scderea grsimilor din alimentaie

Tratamentul cetoacidozei avansate i severe

Combaterea tulburrilor hidroelectrolitice


Combaterea tulburrilor metabolice (hiperglicemia)
Combaterea tulburrilor acido-bazice
Combaterea tulburrilor hemodinamice
Combaterea factorului infecios
Msuri nespecifice
- oxigenoterapie
- sondaj vezical
- sond de aspiraie gastric
- heparin 5000 u/8h
- tratament etiologic

Mortalitatea n CAD sever

< 0,5% n comele simple


5 15% n comele complicate
45% cnd este abolit starea de contien

Coma hiperosmolar

Definiie
Absena cetoacidozei la un diabetic care are o
osmolaritate plasmatic hiperglicemic sau mixt
(hiperglicemic i hipernatremic) > 350 mOsm/l
Osmolaritatea = (Na+ + 10) x 2 + glicemia /18 + ureea /6
(mosm/l)
Frecven
- 10% din comele diabetice hiperglicemice

Criterii de diagnostic
Osmolaritate plasmatic > 350 mOsm/l
Glicemie > 600 mg/dl
pH > 7,25
HCO3 > 15 mEq/l
Semne de deshidratare masiv


Complicaiile cronice
ale DZ

Complicaiile cronice ale DZ

Microangiopatice
Macroangiopatice
Neuropatice
Gangrena diabetic
Alte complicaii - hepatopatia dismetabolic
- cardiomiopatia diabetic
- parodontopatia
- complicaii osteo-tendino-articulare
- osteoartropatia diabetic (piciorul Charcot)
- afectarea cutanat

n momentul diagnosticului DZ 2 un procent mare


din persoane au deja complicaii cronice sau
asocieri morbide

N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first
three years. Diabetologia 2003; 46(Suppl.2): A282.

Clasificarea neuropatiei diabetice


Neuropatia subclinic
Neuropatia clinic

Periferic
Vegetativ (autonom)

Neuropatia subclinic

Teste de electrodiagnostic anormale


- vitez de conducere nervoas sczut

Testare cantitativ senzorial anormal


- vibratorie, tactil, termic

Neuropatia periferic
Polineuropatia distal simetric
Neuropatia diabetic acut
Neuropatia diabetic hiposenzitiv
Neuropatia motorie proximal a membrelor inferioare
Mononeuropatiile
Neuropatiile truncale

Polineuropatia distal simetric

Cea mai frecvent


Tulburri de sensibilitate (hiperestezie sau hiposensibilitate)
Membrele inferioare
Evoluie centripet
Disestezie
Anestezie dureroas
Agravare nocturn
Semne de disfuncie vegetativ
Piele uscat / aspect pseudo-inflamator
Sensibilitatea vibratorie / proprioceptiv
Atrofie i hipotonie muscular

Neuropatia diabetic acut


Rar, dar caracteristic DZ
Instalare acut
Dureri intense n membrele inferioare
Caexie neuropat
Insomnie
Depresie
Impoten

Neuropatia diabetic hiposenzitiv

Lipsesc acuzele subiective


Scdere / dispariie a sensibilitii dureroas, termic,
vibratorie
Alterare variabil a funciilor vegetative
VCN
Risc de leziuni cutanate
Evaluare cantitativ: determinarea pragului de electropercepie

Neuropatia motorie proximal a membrelor


inferioare
Rar
Amiotrofii
Poliradiculopatia diabetic
Instalare acut / subacut
Topirea muchilor

Mononeuropatiile

Cel mai frecvent:


nervii cranieni
Cubital
Sciatic popliteu extern

Neuropatiile truncale

Rare
Instalare acut sau progresiv
Durere abdominal sau truncal unilateral
T3 - T12

Tratamentul neuropatiei periferice

Echilibrare metabolic riguroas


AINS, analgezice opioide cu aciune central
Tranchilizante minore
Carbamazepina, Gabapentin
Antidepresive triciclice
TENS, electroacupunctura
Capsaicina
Vitaminoterapia, benfotiamina, acidul alfa-lipoic
Ionizri ale membrelor inferioare cu Xilin 1% i vit. B1
Balneofizioterapia (mofete, bi carbogazoase, ionizri)

Neuropatia vegetativ
Neuropatia cardio-vascular
Neuropatia digestiv
Neuropatia vezical
Tulburrile sexuale
Neuropatia pupilar
Tulburrile cutanate
Hipoglicemiile necontientizate

Neuropatia cardio-vascular
Manifestrile cardiovasculare ale neuropatiei
Cardiace

Vasculare

Tahicardie cu ritm stabil

Hipotensiune ortostatic

Infarct miocardic nedureros

Tulburri circulatorii cerebrale

intervalului QTc (>400 ms)

Tulburri circulatorii ale


extremitilor

Tulburri de ritm

Edeme ale membrelor


inferioare

Moarte subit

Fenomenul non-dipping

Accidente anestezice

Tratamentul hipotensiunii ortostatice

Stoparea medicaiei care exacerbeaz hipotensiunea


Trecere treptat din clino n ortostatism
Ciorapi elastici
Creterea moderat a aportului de sare
Simpatomimetice (etilefrin - Effortil)
Mineralocorticoizi (9--fluorohidrocortizon 400 g/zi)
Antiinflamatorii nesteroidiene
Derivaii de ergotamin (DH-ergotoxin 7 pic. de 3 X / zi)
Agoniti ai receptorilor 1 - Midodrin 2,5-10 mg/zi
Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

Neuropatia digestiv

Disfuncia esofagian (tulburri de motilitate)

Disfuncia gastric: control glicemic dificil, plenitudine postprandial, saietate precoce, anorexie, intoleran digestiv total n
formele severe (gastropareza diabetic)

Disfuncia intestinal: constipaie neuropat, diaree neuropat


(accentuat nocturn, episoade de remisie/agravare, scaune apoase,
fr fenomene de malabsorbie), rar incontinen fecal

Disfuncia veziculei biliare (hipomotilitate, litiaz biliar)

Tratamentul neuropatiei autonome digestive


Gastropareza: control glicemic riguros (inclusiv pe termen scurt), prokinetice
Diareea neuropat: loperamid, eritromicin, clonidin
Constipaia neuropat: aport de fibre, prokinetice, lactuloz
Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o
Atenie: este necesar investigarea altor etiologii ale manifestrilor digestive
(diagnostic de excludere)

Neuropatia digestiv
Disfuncia esofagian
Disfuncia gastric
Disfuncia intestinal
Disfuncia veziculei biliare

Neuropatia vezical
Hipotonie ureteral
Pareza vezical
vezica neurogen

Tulburrile sexuale
B impoten - tulburri de erecie
- ejaculare retrograd
F tulburri menstruale

Neuropatia pupilar
Asimptomatic
Msurarea reflexului pupilar la lumin

Tulburrile cutanate
Anhidroz distal
Hipersudoraie compensatorie n superioar a corpului

Hipoglicemiile necontientizate
Absena semnelor de avertizare a hipoglicemiilor

Macroangiopatia diabetic
Ateroscleroza date generale
Arterioscleroza
Ateroscleroza
Athero (terci) + sclerosis (induraie)
Istoric
Localizare

Fiziopatologia aterosclerozei
Ipoteza rspunsului la injurie (R. Ross)

Leziunile aterosclerotice
Striurile lipidice
Placa de aterom fibroas
Placa de aterom complicat

Diagnosticul clinic al aterosclerozei


Faza preclinic, asimptomatic
- diagnostic de suspiciune
- modificri metabolice (hipercolesterolemia)
- factori de risc (fumat, HTA, DZ etc.)
Faza clinic
- obstrucie > 60-70% din lumenul arterial
- ischemie n diverse teritorii - coronarian
- cerebral
- membrele inferioare
- renal
- mezenteric
- particularitile ATS la diabetici

Diagnosticul paraclinic al aterosclerozei

Ecg
Ecg de efort
Scintigrafia cu taliu
Ecocardiografia
Angiografia
Ecografia intravascular

Microangiopatia diabetic

Nefropatia diabetic

Retinopatia diabetic

Nefropatia diabetic date epidemiologice

50 % dintre pacienii aflai n programele de supleere


renal au drept cauz a insuficienei renale diabetul
Dup 20 de ani 30 % dintre pacienii cu DZ 2 dezvolt
nefropatie
20% dintre cei cu nefropatie ajung la insuficien renal
terminal

Eliminarea urinar de proteine


Prin consens:
Normoalbuminurie < 30 mg/24 ore
Microalbuminurie 30-300 mg/24 ore
Macroalbuminurie > 300 mg/24 ore

Stadializarea nefropatiei diabetice


Stadiul I Hiperfuncie i hipertrofie renal
Stadiul II Silenios, normoalbuminuric
Stadiul III Nefropatia diabetic incipient
Stadiul IV Nefropatia diabetic patent (clinic manifest)
Stadiul V Insuficiena renal cronic terminal

Evoluia n timp a filtratului glomerular i a


eliminrii urinare de albumin

Diagnostic clinic
Semne de HTA
Semne de sindrom nefrotic, IRC
Prezena altor complicaii ale diabetului: retinopatie,
macroangiopatie, neuropatie
numrului de hipoglicemii nejustificate i
necesarului de insulin

Caracteristicile clinice ale diabeticilor


hipertensivi

presiunii pulsului arterial


Hipotensiunea ortostatic
Hipertensiunea nocturn

Diagnostic paraclinic

Rata filtrrii glomerulare

Eliminarea urinar de proteine

Biopsia renal

Screening pentru nefropatia diabetic

Microalbuminuria se evalueaz la
diagnosticarea DZ i apoi anual

Creatinina seric trebuie dozat anual

Eliminarea urinar de proteine


normoalbuminurie microalbuminurie macroalbuminurie

Rata de excreie
a albuminei
(mg/24 ore)

< 30

30-300

300

Raportul
albumin/creatinin (mg/g)
Brbai

< 20

20-200

200

Femei

< 30

30-300

300

Factori de risc pentru progresia


nefropatiei diabetice
HTA
Albuminuria
Controlul glicemic insuficient
Fumatul
Consumul crescut de proteine
Dislipidemia

Metode terapeutice

Meninerea unui control glicemic optim pe termen lung

Tratamentul precoce al hipertensiunii arteriale

Tratamentul dietetic

Reducerea lipidelor serice

Prevenirea i tratamentul comorbiditilor existente

Tratamentul anemiei renale

Profilaxia i tratamentul bolii osoase renale

Retinopatia diabetic date generale

RD unul din primele semne de afectare vascular


Prima cauz de cecitate 20-74 ani
Prevalena corelat cu durata de evoluie a DZ
> 20 ani de DZ toi pac.cu DZ 1
> 60% pac. cu DZ 2

Fiziopatologia retinopatiei diabetice


Alterarea compoziiei membranei bazale

- extravazare - plasm edem


- hematii hemoragii
- lipoproteine exsudate dure
Pericitelor
- proliferarea cel. endoteliale
- tonicitii peretelui capilar ectazii capilare

microanevrisme

Proliferarea cel. endoteliale + microanevrismele

ncetinire curent sanguin

adezivitatea plachetar

Ocluzie capilar

Hipoxie retinian

Stimularea angiogenezei

Vase de neoformaie

Leziunile din RD (1)


Dilataia capilarelor
Microanevrismele
Hemoragiile intraretiniene
Exsudatele dure
Exsudatele moi
Anomalii intravasculare intraretiniene
Anomalii venoase
Neovascularizaia retinian

Leziunile din RD (2)


Hemoragiile preretiniene
Hemoragiile vitreene
Dezlipirea de retin
Rubeoza irian. Glaucomul neovascular
Maculopatia diabetic

Clasificarea retinopatiei diabetice

Retinopatie diabetic neproliferativ


- uoar
- sever (preproliferativ)

Retinopatie diabetic proliferativ

Diagnosticul retinopatiei diabetice


Examenul FO
- oftalmoscopia direct
- biomicroscopia FO
- oftalmoscopia indirect
Angiografia cu fluorescein
Fluorometria vitrean
Ecografia ocular
Electroretinograma
Teste de discriminare cromatic
Adaptometria

Screening-ul retinopatiei diabetice

Acuitatea vizual poate fi normal chiar n prezena unor


leziuni avansate ale retinei necesar screening
periodic pentru toate persoanele cu diabet

Examenul oftalmologic se va face la depistarea


diabetului i apoi anual

Pacienii cu retinopatie diabetic vor fi evaluai mai des


n funcie de indicaiile medicului oftalmolog

Frecvena examinrilor n funcie de stadiul RD

Anomalii retiniene

Urmrire la

Normal + rare microanevrisme

Anual

RDNP uoar

9 luni

RDNP moderat

6 luni

RDNP sever

4 luni

EMCS

2-4 luni

RDP

2-3 luni

Tratamentul medicamentos al RD
Echilibrarea metabolic a DZ
Evitarea hipoglicemiilor
Vitamine A, E
Extractul de ginkgo biloba
Dobesilat de calciu
Aspirina
Tratamentul HTA
IECA, Sartani, Sandostatin

Tratamentul chirurgical al RD

Tratamentul laser
- panfotocoagularea laser
- tratamentul laser focal
Vitrectomia posterioar
Crioterapia

Alte afectri oculare n diabetul zaharat

Cataract
Glaucom
Infecii
Neuropatii de nervi oculomotori
adaptrii la ntuneric
discriminrii cromatice

Piciorul diabetic - date epidemiologice

25% dintre bolnavii cu DZ internai sunt spitalizai pentru


complicaii la nivelul piciorului
50-70% dintre amputaiile netraumatice sunt la pacienii
cu DZ
Neuropatia diabetic este a doua cauz, pe plan
mondial, de durere neuropat, dup lumbago

Fiziopatologia piciorului diabetic

Principalele modificri sunt


determinate de:
neuropatie
arteriopatie

Diagnostic diferenial - simptome

Arteriopatia diabetic
Claudicaie intermitent
Durere de repaus
Durere spontan, brusc instalat

Neuropatia diabetic
Dureri de repaus, nocturne
Arsuri
Parestezii

Diagnostic diferenial semne clinice


Arteriopatia diabetic

Absena pulsului, picior rece


Paloare la ridicarea membrului inf.

Roea la trecerea n ortostatism


Cianoz
Modificri trofice
Neuropatia diabetic

Piele atrofic
Calus
Unghii distrofice
Deformri osoase
Picior cald
Reducerea/absena sensibilitii
Absena reflexelor

Arteriopatia diabetic
Evaluare
Echo-Doppler
Angiografie
Management

Medicaie
Exerciii fizice
Trimitere la specialist

Neuropatia diabetic
Evaluare
Monofilament
Sensibilitate vibratorie
Reflexe osteo-tendinoase
Management Controlul durerii
Trimitere la specialist

Examinare picior
Examen vascular periferic

Examen neurologic

palpare puls arterial


examinare circulaie venoas

ROT
testare sensibilitate

culoare tegumente
T tegumente

- tactil
- termic
- dureroas
- vibratorie

Prevenia piciorului diabetic


Educaia pacientului pentru ngrijirea piciorului
Examinarea piciorului zilnic
ngrijirea pielii i unghiilor
nclminte adecvat
Renunarea la fumat
Identificarea deformrilor osoase
Evaluarea / ameliorarea controlului:
Glicemiei
TA
Factorilor de risc cardiovascular

Important de reinut n managementul piciorului


diabetic

Claudicaia intermitent din angiopatie poate lipsi sau


poate fi estompat datorit neuropatiei

Paradoxal, la nceputul tratamentului hipoglicemiant


durerile se pot intensifica

Piciorul diabetic - concluzii


Inspecia piciorului se va efectua la fiecare vizit iar examinarea
complet anual
Testarea sensibilitii periferice la bolnavul cu diabet se face
anual
Se recomand un control agresiv al glicemiei pentru a reduce
riscul apariiei piciorului diabetic
Pacientul trebuie nvat s-i examineze piciorul si s-l
ngrijeasc
Se va trimite pacientul la chirurg, ortoped, dermatolog la
apariia unei rni, infecii, onicomicoze

Complicaiile cutanate ale diabetului zaharat

Dermatoze datorate diabetului zaharat i complicaiilor sale


- manifestri cutanate ale neuropatiei diabetice
- manifestri cutanate ale angiopatiei diabetice
- infeciile cutanate
Dermatoze datorate tratamentului specific diabetului zaharat
Dermatoze asociate cu diabetul zaharat

Manifestri cutanate ale neuropatiei diabetice


Tegumentul uscat
Pierderea prului la nivelul gambelor
Hiperhidroza
Durilloamele i hiperkeratoza plantar
Hematoamele subungheale
Venectaziile
Edemul neuropat
Ulcerele neuropate

Manifestri cutanate ale angiopatiei diabetice

Dermopatia diabetic
Necrobioza lipoidic
Rubeoza facial
Ulcerele arteriopate

Infeciile cutanate

Tinea pedis
Onicomicoza
Onicodistrofia
Alte infecii micotice cutanate
Foliculite
Furunculoze
Fasceita necrozant

Dermatoze datorate tratamentului specific


diabetului zaharat
Lipodistrofia insulinic
Alergia la insulin
Reaciile la ADO - eritem polimorf
- necroliz epidermic toxic
Reaciile lichenoide
Infecii cutanate la locurile de injectare (S. aureus)

Dermatoze asociate cu diabetul zaharat


Buloza diabetic
Scleredemul
Acanthosis nigricans
Xantoamele eruptive
Vitiligo
Granulomul inelar
Carotenodermia

Evaluarea iniial
Obiective
evaluarea statusului bolii i a factorilor de risc pentru
complicaiile diabetului
informarea pacientului despre natura i severitatea bolii
educaia pacientului n legtura cu dieta adecvat,
exerciiul fizic, medicaie, automonitorizarea glicemiei
stabilirea unui plan terapeutic
stabilirea unui plan de monitorizare
Metode
- anamnez
- examen clinic complet
- investigaii paraclinice

Examen clinic
Greutate si nlime, IMC (Kg/m), circumferina abdominal
TA
Frecvena cardiac
Palparea tiroidei
Examinarea cordului
Examinarea piciorului
Examinarea pielii
Examinarea neurologic (reflexe, sensibilitatea vibratorie,
tactil, termic, dureroas)

Investigaii paraclinice

Glicemia bazal i la 2 ore postprandial


Colesterol total, LDL-colesterol, HDL-colesterol
Trigliceride
Acid uric
Uree, creatinin seric, clearence-ul de creatinin
Examenul de urin
Microalbuminuria
EKG
Examen FO
Radiografia toracic
Ecografie abdominal
Oscilometrie

Monitorizare
Prima vizit

Evaluarea iniial
Educaia pacientului: informaii asupra bolii
i stilului de via

La fiecare
consultaie

Urmrirea rezultatelor automonitorizrii


glicemiei (dac aceasta s-a fcut)
Msurarea TA
Msurarea greutii / IMC i a CA
Inspecia piciorului

La 3 luni
Anual

Determinarea HbA1c pentru evaluarea


controlului glicemic
Examen FO
Depistarea microalbuminuriei
Profil lipidic
Evaluarea riscului pentru picior diabetic,
testarea sensibilitii

Tratamentul diabetului zaharat


DZ este o boal cronic

Obiectivul principal: meninerea parametrilor clinici i


biochimici specifici ct mai aproape de normal

Tratamentul trebuie privit n perspectiva speranei de


via

Criteriile unui bun control metabolic


Glicemia preprandial: 80-110 (130) mg/dl
Glicemia postprandial: 100-145 (180) mg/dl
HbA1c: < 7% (selectiv 6,5 %, chiar 8% la pacienii cu risc)
Colesterol total: < 200 (180) mg/dl
LDL-colesterol: < 100 (70) mg/dl
HDL-colesterol > 40 mg/dl (B), 50 mg/dl (F)
Trigliceride a jeun: < 150 mg/dl
TA < 140/90 mmHg (selectiv 130/80 mmHg)
IMC < 25 kg/m2 (B), < 24 kg/m2 (F)

Importana controlului glicemic


Obiectivul principal al terapiei n DZ 2 este de a
obine valori ale glicemiei ct mai aproape de
valorile normale, n scopul de a preveni i ncetini
apariia complicaiilor macro i microvasculare

Hemoglobina glicozilat

Standardul de aur pentru monitorizarea glicemiei


Reflect o medie a valorilor glicemiei pe o perioad
anterioar de 2-3 luni
Se exprim ca procent din totalul Hb (normal 4-6%)
Se coreleaz bine cu valorile glicemiei
Obiectiv realistic - Valoarea cea mai sczut a HbA1c
obinut fr reacii adverse inacceptabile

Corelaii ntre valorile Hb A1c i glicemie


A1c (%)
6

Media glicemiilor
135 mg/dl (7,5 mmol/l)

170 mg/dl (9,5 mmol/l)

205 mg/dl (11,5 mmol/l)

240 mg/dl (13,5 mmol/l)

10

275 mg/dl (15,5 mmol/l)

11

310 mg/dl (17,5 mmol/l)

12

345 mg/dl ( 19,5 mmol/l)

Avantajele HbA1c
Evaluare obiectiv a controlului glicemic
Se coreleaz cu riscul de apariie a complicaiilor
Nu poate fi manipulat de pacient
Neinfluenat de modificrile recente ale glicemiei ca
urmare a ingestiei de alimente

Automonitorizarea glicemiei
Crete compliana la tratament i are efect favorabil
asupra schimbrii stilului de via
Frecvena se stabilete n funcie de pacient, stadiul bolii,
riscul evenimentelor hipoglicemice
Ajut la individualizarea tratamentului i adaptarea
msurilor nefarmacologice
Dezavantaje
cost crescut
disconfort fizic

Metode de tratament
Tratamentul dietetic

Exerciiul fizic

Tratamentul medicamentos (insulin i/sau ADO)

Educaia specific

Tratamentul dietetic
Locul dietoterapiei n tratamentul DZ
Obiectivele tratamentului nutriional:
- meninerea glicemiei la un nivel ct mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea i tratarea complicaiilor acute i cronice
- creterea calitii vieii printr-o alimentaie adecvat

Recomandrile nutriionale generale pentru


pacientul diabetic

Calorii
Glucide: 55-60 % din aportul caloric
Fibre alimentare: 30-40 g/zi
Lipide: sub 30 % din calorii
Colesterol: < 300 mg/zi
Proteine: 12-15 % din aportul caloric
Sodiu: < 6 g NaCl / zi; la hipertensivi < 3 g
NaCl / zi
Alcoolul
Edulcorantele
Vitamine i minerale

Etapele alctuirii unei diete


Precizarea caracteristicilor generale ale dietei
Calculul aportului caloric
Distribuia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
Distribuirea glucidelor pe numrul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
Alegerea alimentelor
Pregtirea corect a alimentelor (reguli de gastrotehnie)

Factori care influeneaz indexul glicemic

Concentraia n glucide a alimentelor


Coninutul de proteine i lipide al alimentelor
Coninutul n fibre alimentare
Prezena de amidon greu digerabil
Mrimea particulelor de amidon
Forma fizic a hranei
Coninutul hidric al alimentelor
Temperatura alimentelor
Prezena inhibitorilor enzimatici naturali, a fitailor i taninelor
Gradul de prelucrare mecanic prin masticaie

Exemple de index glicemic


138% Glucoz
126% Miere
100% Glucoz

100% Pine alb


90-99% Pine integral, piure de
cartofi, biscuii

80-89% Piure de cartofi, morcovi

80-89% Cartofi, banane

70-79% Pine integral, orez, cartofi 70-79% Chips-uri


60-69% Pine alb, banane

60-69% Macaroane, spaghete fierte


15 minute

50-59% Spaghete fierte 5 minute,


chips-uri

50-59% Mere, portocale, mazre

40-49% Mazre, portocale

40-49% Spaghete fierte 5 minute,


lapte

30-39% Lapte, mere

30-39% Fructoz

20-29% Fasole psti, fructoz


10-19% Arahide, soia

10-19% Arahide, soia

Efortul fizic terapeutic - beneficii


Scade glicemia i HbA1c
Amelioreaz profilul lipidic
- TG
- LDL-colesterolul
- HDL-colesterolul
Amelioreaz HTA uoar i moderat
Adjuvant al dietei pentru scderea ponderal
Amelioreaz factorii de risc cardio-vascular
Crete tonusul psihic i calitatea vieii

Efortul fizic terapeutic - riscuri


Hipoglicemie
Hiperglicemie i cetoz la pacienii insulino-deficieni
Precipitarea i exacerbarea bolilor cardio-vasculare (angin
pectoral, infarct de miocard, aritmii, moarte subit)
Agravarea complicaiilor cronice ale DZ
- retinopatie proliferativ: hemoragii vitreene, deslipiri de retin
- nefropatie: proteinuria
- neuropatie periferic: leziuni ale articulaiilor i ale es. moi
- neuropatie vegetativ: scade rspunsul cardio-vascular la
efort, hipotensiune ortostatic

Tratamentul insulinic
Istoric

Nicolae Paulescu
1869 - 1931

Clasificarea insulinelor
Dup provenien - animale
- de tip uman

Dup durata de aciune


- cu aciune ultrarapid (analogi)
- cu durat scurt de aciune
- cu aciune intermediar
- cu durat lung de aciune
- insuline premixate

Insulinemia plasmatic la persoane cu diabet


zaharat tip 1 i subieci sntoi
N=8 Subieci sntoi

N=24 DZ1

480

Insulin uman regular


Analog rapid de insulin

400
320

pmol/L

240
160
80
0
07:00

12:00

18:00

Momentul zilei

24:00

06:00 h

Insulina LISPRO Humalog

A-chain

21

S
S
1

S
S

B28
LYS
B-chain

B29
PRO

30

Analogii rapizi de insulin

Glulisine

Analogii de insulin cu aciune lung

Insulina glargine
(lantus)

Insulina detemir
(levemir)

Preparate de insulin
Cu aciune ultrarapid (analogi de insulin):
- NovoRapid
- Humalog
- Apidra
Cu aciune scurt:
- Actrapid HM
- Humulin R
- Insuman Rapid
Cu aciune intermediar:
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal

Cu aciune lung:
- Monotard HM
- Humulin L
Analogi de insulin cu aciune lung:
- Lantus
- Levemir
Insuline premixate:
- Mixtard 10 50 HM (Mixtard 30 HM)
- Humulin M1 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50
Analogi premixai:
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50

Scheme de insulinoterapie
Convenional

Intensificat

Insulinoterapia intensificat

Insuline prandiale
Insuline bazale

Administrarea insulinei
Cile de administrare
Dispozitivele de administrare
Autocontrolul i ajustarea dozelor
Pompa de insulin
Indicaiile insulinoterapiei

Efectele secundare ale insulinoterapiei

Hipoglicemia
Lipodistrofia
Abcesele la locul injeciei
Alergia la insulin
Producia de anticorpi la preparatele insulinice
Creterea n greutate
Edemul insulinic
Neuropatia dureroas
Scderea acuitii vizuale

Hiperglicemiile matinale
Subinsulinizarea

Fenomenul Somogyi

Fenomenul de zori (Dawn phenomenon)

Tratamentul cu preparate non-insulinice


Medicamente care cresc secreia pancreatic de insulin
- sulfonilureice
- reglatori prandiali ai glicemiei
Medicamente care scad rezistena la insulin
- biguanide
- tiazolidindione
Medicamente care scad absorbia intestinal de glucoz
- inhibitori de alfa-glucozidaz
Incretinele
Inhibitorii de SGLT2

Medicamente care cresc secreia pancreatic


de insulin (secretagoge)
Canalul KATP cu cele dou componente: receptorul
sulfonilureic (SUR 1) i canalul rectificator de K (Kir 6.2)
Ansamblul
canalului

Componenta SUR

Componenta Kir 6.2

nchiderea canalului KATP prin


legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1

Preparatele sulfonilureice
Agentul sulfonilureic
Generaia I
- tolbutamid
- clorpropamid
Generaia a II-a
- glibenclamid

- glipizid
- gliclazid
- gliquidona
Generaia a III-a
- glimepiride

Preparate comerciale

Doza maxim

Tolbutamid; 500 mg
Diabinese; 250 mg

3000 mg
500 mg

Glibenclamid; 5 mg
Maninil; 1,75; 3,5 mg

15 mg
10,5 mg

Glucotrol; 5 i 10 mg
Diaprel MR; 30 mg
Glurenorm; 30 mg

10 mg
90 mg
90 mg

Amaryl; 1, 2, 3 i 4 mg

6 mg

Sulfonilureicele

Efecte secundare:
Hipoglicemia
Creterea n greutate
Reacii alergice
mpiedic precondiionarea ischemic creterea riscului de
IMA?
Alte contraindicaii:
DZ tip 1 sau alte forme de DZ cu cetoacidoz
Sarcina i alptarea
Dezechilibrul glicemic marcat
Insuficien hepatic, renal (RFG < 30 ml/min)
Intervenii chirurgicale majore

Reglatorii prandiali ai glicemiei


Acelai mecanism de aciune ca al sulfonilureicelor
Durat scurt de aciune
Risc hipoglicemic redus
O mas o doz, nici o mas nici o doz
Preparate: - Repaglinida (NovoNorm; 0,5 1 2 mg)
- Nateglinida (Starlix)

Medicamente care scad rezistena la insulin


Biguanidele

Mecanism de aciune
Reduc insulinorezistena (mai ales prin reducerea PHG)
Amelioreaz captarea periferic a glucozei
Favorizeaz activitatea GLUT 4 i glicoliza anaerob, inhib
statusul proinflamator i protrombotic, reduc lipoliza etc.
- Posibil ameliorare a RCV i a riscului neoplazic
Preparate:
- fenformin
- metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp
= 500 mg, 850 mg, 1000 mg; doza max. = 3000 mg)
- buformin: Silubin Retard (1 cp = 100 mg; doza max. = 300 mg)

Biguanidele
Efecte secundare:
- Efecte digestive (greuri, vrsturi, dureri abdominale, tulburri
de tranzit, balonri, anorexie)
- Acidoza lactic (doar cnd nu sunt respectate contraindicaiile)
Contraindicaii:
- Insuficien hepatic
- Insuficien renal (RFG < 45/30 ml/min)
- Insuficien cardiac (FE < 45%)
- Insuficien respiratorie
- Investigaii cu substane de contrast iodate (temporar)
- Anestezia general (temporar)
- Altele: deficitul de Vitamina B12, hipersensibilitatea, hipoxia etc.

Tiazolidindionele (glitazonele)
Mecanism de aciune: PPAR (peroxisome proliferator
activated receptors)
Reduc IR (mai ales cea periferic)
Determin redistribuia adipozitii centrale, cu adipogenez
periferic (adipocite mici, insulinosensibile)
Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia)

Tiazolidindionele

Efecte secundare:
Cretere ponderal
Retenie hidro-salin
Agravarea ICC
Hepatotoxicitate (efect discutabil la TZD noi)
Creterea riscului de fractur de old
Contraindicaii:
DZ tip 1
Sarcin i lactaie
Afeciuni hepatice active (transaminaze peste 2-3 x v.n.)
APP de ICC, SCA
RCV peste 15% la calculul prin soft-ul UKPDS

Medicamente care scad absorbia intestinal


de glucoz
Inhibitorii de alfa-glucozidaz
Mecanism de aciune: inhibarea -glucozidazei intestinale
(dizaharidaz) reducerea i ntrzierea absorbiei intestinale
a glucozei ameliorarea hiperglicemiei postprandiale
Preparate
- acarboza (Glucobay, 1 cp = 50; 100 mg; doza maxim = 300
mg)
- miglitolul

Inhibitorii de -glucozidaz

Efecte secundare:
Diaree
Dureri abdominale
Flatulen

Contraindicaii:
Sarcin i lactaie
Afeciuni gastrointestinale (boala Crohn, RCUH)
BCR avansat

Locurile de aciune ale agenilor


antihiperglicemiani
Sulfonilureice i
repaglinida
Stimuleaz secreia de
insulin.
Repaglinida
Se administreaz n
special la pacienii cu
glicemii postprandiale
crescute.
Inhibitori de glucozidaz
(acarboza)
ntrzie absorbia intestinal
a carbohidrailor.

Tiazolidindione
Scad rezistena la
insulin
n esutul adipos i
muchi. Scad GNG
la nivelul ficatului.
Biguanide (metformin)
Scad rezistena la insulin
n esutul muscular.
Scad GNG la niv. ficatului.

Incretinele

oral
intravenos

90
70

50

30

10

-10

-30
0

15

200

30 45 60
TIME (min)

75

90

INSULIN (mU/L)

GLUCOZ (mg/dl)

Secreia de insulin dup administrarea de glucoz


oral / intravenos

150

100

50

15

30

45 60
TIME (min)

75

McIntyre et al, 1964

90

Efectul incretinic
Ingestia de glucoz determin un rspuns insulinic mai
pronunat dect glucoza administrat intravenos, indicnd
prezena

unor

gastrointestinal

substane

secretate

de

tractul

care stimuleaz eliberarea de insulin

printr-un mecanism glucodependent.

Creutzfeldt. Diabetologia 1985; 28: 565

Definiia incretinelor

Gut-derived factors that increase


glucose-stimulated insulin secretion

In cret in

Intestine

Secretion

Insulin

Creutzfeldt. Diabetologia 1985; 28: 565

Efectul incretinic la persoanele sntoase


i la pacienii cu diabet zaharat tip 2
Pacieni cu DZ tip 2

Oral
IV

Timp (min)

Insulin (mU/l)

Insulin (mU/l)

Persoane sntoase

Oral
IV

Timp (min)

Incretinele
GLP-1: Glucagon-Like Peptide 1
H A E G T F T S D V S S Y L E G Q A
A
K
A
K
F
L
R
I
V
E
W
G
G

GIP: Gastric Inhibitory Polypeptide

Glucose-Dependent Insulinotropic Polypeptide


A

E G T F I S D Y S I A M D K I H
Q
K K G K
A L L W N V F D Q
D
N
W
Q
K
T Q
I
N
H
Y

Drucker D. Diabetes Care 2003; 26: 2929

GIP
Gastric inhibitory polypeptide
Glucose-mediated insulinotropic polypeptide
GM: 4984
Eliberare: duoden, jejun, ileonul proximal
Aciuni:
- inhibarea secreiei gastrice acide
- stimularea secreiei de insulin
- aciuni insulin-like asupra metabolismului lipidic

GLP-1
Glucagon-like peptide-1

GM: aprox. 4000


Eliberare: intestinul subire distal, colon
Aciuni:
- stimularea secreiei de insulin
- inhibarea golirii gastrice
- aciuni insulin-like extrapancreatice
- inhibarea apetitului

GLP-1
Glucoza
Celula L
Enterocit
Hipotalamus:
Apetitul
GLP1

Pancreas:
Insulina
Glucagonul

Stomac:
Motilitatea

GLP-1
Alimente

stimuleaz secreia insulinic


indus de glucoz
inhib secreia de glucagon
inhib golirea gastric

Celulele L GLP-1

inhib apetitul
amelioreaz insulinosensibilitatea
n studii experimentale
crete masa -celular

Drucker DJ. Mol Endocrinol 2003; 17:161-171

Metabolism glucidic normal


Glucide alimentare

GIP

digestie
absorbie

GLP-1

Celula

secreia de insulin euglicemie

Diabet zaharat tip 2


Glucide alimentare

GLP-1

GIP

Celula

Secreie de insulin hiperglicemie

300
250
200
150
100
50
0

GLP-1 i.v. (1.2 pmol.kg-1.min-1)

12

*
GLP-1 *
Placebo

40

*
p<0.0001

60

120

180

250
200

30

150

20

10

100

p<0.0001

0
Glucagon (pmol/l)

240

GLP-1 i.v. (1.2 pmol.kg-1.min-1)

Glucagon

20

60

120

180

50
0

Insulin (pmol/l)

Insulin (mU/l)

Insulin

16

Glucose (mmol/l)

Glucoz

Glucoz (mg/dl)

Efectul administrrii de GLP-1


n diabetul zaharat tip 2

240

GLP-1 i.v. (1.2 pmol kg min )


.

-1.

-1

15
10

p=0.0009

60

120

180

240

Timp (min)
Nauck M et al. Diabetologia 1993; 36: 741744

GLP-1
Mas
Meal

Intestinal
Eliberare
de
GLP-1
GLP-1
release
intestinal
Active
GLP-1
activ
GLP-1

DPP-4
GLP-1
inactiv
inactive
.
Rothenberg
P et al. Diabetes 2000; 49 (suppl.1): A39

Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

Inhibitori de DPP-4
Drucker. Diabetes Care 2003; 26: 2929
Dungan. Clin Diabetes 2005; 23: 56

Exenatida (Byetta)
Gila monster (Heloderma
suspectum)
Aprobat de FDA (2005) i de
EMEA (2006) pt. trat. DZ 2
Capt C-terminal bogat n
reziduuri de prolin
Aciune de 10 ori mai intens
dect a GLP-1 nativ
T1/2 mai lung

GLP-1 i Exenatida
GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402

Exenatida (Byetta)
Indicat n tratamentul DZ tip 2 necontrolat prin:
- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice
metformin + TZD
Doza iniial: 5 g x 2/zi
Adm. sc cu 60 min. naintea meselor principale
Dup o lun, doza se poate crete la 10 g x 2/zi

Liraglutida
Derivat acil al GLP-1
Adugarea unei grupri
de acizi grai activeaz
legarea de albuminele
plasmatice ntrzie
eliminarea renal
T1/2 ~ 12 ore
Administrare injectabil o
singur dat pe zi
Knudsen L et al. J Med Chem 2000; 43: 1664-1669

Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta, Bydureon)


- Liraglutida

Inhibitori de DPP-IV
Drucker. Diabetes Care 2003; 26: 2929
Dungan. Clin Diabetes 2005; 23: 56

GLP-1
Mas
Meal
Eliberare
de
Intestinal
GLP-1
GLP-1
intestinal
release

Active
GLP-1
activ
GLP-1

DPP-4
Inhibitor de
DPP-4

GLP-1
inactiv
inactive

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39

Inhibitori de DPP-4

Sitagliptina (Januvia)
- inhibitor competitiv, reversibil i nalt selectiv al DPP-4
- aprobat de FDA (2006) i de ANM (2007) pt. trat. DZ 2

Saxagliptina (Onglyza)

Sitagliptina (Januvia)

Indicat n tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice

Doza recomandat: 100 mg/zi (doz unic), indiferent de


orarul meselor

Efecte adverse ale incretinelor


Agonitii de receptor de GLP-1
- greuri i vrsturi (50% dintre pacieni)
- dependente de doz
- se amelioreaz pe parcursul tratamentului
- diaree
- hipoglicemii uoare i moderate (cnd se asociaz cu SU)
Inhibitorii de DPP-4
- cefalee
- susceptibilitate pentru infecii de ci aeriene superioare

Inhibitorii SGLT-2

Filtrarea glomerular
Arteriola aferent

H2O
Glucoza
Na+, Cl-, K+, HCO3Amino
acizi
Creatinina
Uree
Capsula Bowman
Arteriola eferent

Reabsorbia la nivelul tubului contort proximal


Glucoza
Na+

Arteriola aferent

H2O

Cl-,
K+,
HCO3-

Amino
acizi

Tub contort proximal


Capsula Bowman
Arteriola eferent

Reabsorbia la nivelul tubului contort proximal


Majoritatea
glucozei este
reabsorbit de
ctre SGLT2
(90%)

Tub contort proximal

Glucoz

Filtrarea glucozei

Glucoza
restant este
reabsorbit de
ctre SGLT1
(10%)

Excreie a
glucozei
minim
pn la
absent

Inhibitorii SGLT2: O abordare inovativ, insulin-independent,


de eliminare a excesului de glucoz
Reduced
Reabsorb
ie
glucose
sczut a glucozei
reabsorption
Inhibitor SGLT2

SGLT2

Proximal
Tub contorttubule
proximal
Inhibitor
SGLT2

SGLT2
Glucose

Filtrarea
glucozei

Excreie urinar
Increased
urinary
crescut a of
glucozei
excretion
excess
n
exces
(

70
glucose (~70g/zi,
g/day,
corespunztor 280
corresponding
to
kcal/zi*)
280 kcal/day*)

Inhibitorii SGLT2 inhib n mod selectiv SGLT2


la nivelul tubului contort proximal
70g/zi
glucoza

Inhibitorii SGLT2: O abordare inovativ, insulinindependent, de eliminare a excesului de glucoz


Scderi semnificative ale HbA1c
ELIMINARE
70g/zi
glucoza

Pierderea a 280 kcal/zi

Scdere ponderal

Creterea volumului
urinar cu 375ml/zi

Scderea tensiunii arteriale

Dapagliflozina
Beneficii
- scderea HbA1c
- scdere ponderal
- scderea TA
Efecte adverse
- risc crescut pentru infecii urinare i genitale?
- risc de deshidratare i hipovolemie?
- risc de agravare a BCR / inducere a IRA prin deshidratare

Algoritmul de tratament n DZ 2
Dieta i exerciiul fizic
Antidiabetice orale
Asocieri de antidiabetice orale
Insulin antidiabetice orale

Preparate combinate de ADO


Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg
Glucovance 2,5 mg/500 mg
5 mg/500 mg
Preparate combinate TZD + metformin
Competact 15 mg/850 mg
Preparate combinate inhibitori DPP-4 + metformin
Janumet 50 mg/850 mg
50 mg/1000 mg
Komboglyze 2,5 mg/1000 mg

Individualizarea terapiei n DZ tip 2


Approach to the management
of hyperglycemia
HbA1c
more
Tinte mai ambitioase Tinte mai
putin ambitioase
7%
PATIENT / DISEASE FEATURES

stringent

Risks potentially associated


low
mai putin
Pacienti motivati
with hypoglycemia Pacienti
and
motivati
other drug adverse effects

Scazut
Scurta

Disease duration

Life expectancy

Absente

Lunga
long

Atitudine pacienti

high

Durata bolii

long-standing

Speranta de viata short

Usually not
modifable

Scurta

Lunga
Absente

Crescut

newly diagnosed

less
stringent

Important comorbidities

Comorbiditati
absent

Severe

Established vascular
complications

Disponibile

few / mild

Complicatii CV

Severe

absent

severe

few / mild

Resurse

severe

Absente

Patient attitude and

highly
motivated,
less 2012;35:136479.
motivated, non-adherent,
Adaptat dupa: Ismail-Beigi, et expected
al. Ann Intern
Med 2011;154:5549;
Inzucchi
SE, et adherent,
al. Diabetes Care
treatment
efforts
excellent self-care capacities

Resources and support


system

Readily available

poor self-care capacities

limited

Potentially
modifable

Healthy eating, weight control, increased physical activity & diabetes education

Monotherapy

Metformin

Efcacy*
Hypo risk
Weight
Side effects
Costs

high
low risk
neutral/loss
GI / lactic acidosis
low
If HbA1c target not achieved after ~3 months of monotherapy, proceed to 2-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):

Dual
therapy
Efcacy*
Hypo risk
Weight
Side effects
Costs

Metformin

Metformin

Sulfonylurea

Thiazolidinedione

DPP-4
inhibitor

high
moderate risk
gain
hypoglycemia
low

high
low risk
gain
edema, HF, fxs
low

intermediate
low risk
neutral
rare
high

Metformin

Metformin

Metformin

Metformin

SGLT2
inhibitor

GLP-1 receptor
agonist

Insulin (basal)

intermediate
low risk
loss
GU, dehydration
high

high
low risk
loss
GI
high

highest
high risk
gain
hypoglycemia
variable

If HbA1c target not achieved after ~3 months of dual therapy, proceed to 3-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):

Metformin

Triple
therapy

Sulfonylurea

+
TZD

Metformin

Thiazolidinedione

SU

Metformin

Metformin

DPP-4
Inhibitor

SGLT-2
Inhibitor

SU

SU

Metformin

GLP-1 receptor
agonist

Metformin

Insulin (basal)

+
TZD

SU

or

DPP-4-i

or

DPP-4-i

or

TZD

or

TZD

or

TZD

or

DPP-4-i

or

SGLT2-i

or

SGLT2-i

or

SGLT2-i

or

DPP-4-i

or

Insulin

or

SGLT2-i

or

Insulin

or

Insulin

or GLP-1-RA

or GLP-1-RA

or

or

Insulin

or GLP-1-RA

Insulin

If HbA1c target not achieved after ~3 months of triple therapy and patient (1) on oral combination, move to injectables, (2) on GLP-1 RA, add
basal insulin, or (3) on optimally titrated basal insulin, add GLP-1-RA or mealtime insulin. In refractory patients consider adding TZD or SGL T2-i:

Metformin

Combination
injectable
therapy

Basal Insulin +

Mealtime Insulin or

GLP-1-RA

Healthy eating, weight control, increased physical activity & diabetes education

Monotherapy

Metformin

Efcacy*
Hypo risk
Weight
Side effects
Costs

Metformin
intolerance or
contraindicati
on Dual
therapy

HbA
1c
9%

Efcacy*
Hypo risk
Weight
Side effects
Costs

high
low risk
neutral/loss
GI / lactic acidosis
low
If HbA1c target not achieved after ~3 months of monotherapy, proceed to 2-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):

Metformin

Metformin

Sulfonylurea

Thiazolidinedione

DPP-4
inhibitor

high
moderate risk
gain
hypoglycemia
low

high
low risk
gain
edema, HF, fxs
low

intermediate
low risk
neutral
rare
high

Metformin

Metformin

Metformin

Metformin

SGLT2
inhibitor

GLP-1 receptor
agonist

Insulin (basal)

intermediate
low risk
loss
GU, dehydration
high

high
low risk
loss
GI
high

highest
high risk
gain
hypoglycemia
variable

If HbA1c target not achieved after ~3 months of dual therapy, proceed to 3-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):

Metformin

Triple
therapy

Sulfonylurea

+
TZD

Uncontrolled
hyperglycemi
a (catabolic

features,
BG 300-350
mg/dl, HbA1c
10-12%)
Combination
injectable
therapy

Metformin

Thiazolidinedione

SU

Metformin

Metformin

DPP-4
Inhibitor

SGLT-2
Inhibitor

SU

SU

Metformin

GLP-1 receptor
agonist

Metformin

Insulin (basal)

+
TZD

SU

or

DPP-4-i

or

DPP-4-i

or

TZD

or

TZD

or

TZD

or

DPP-4-i

or

SGLT2-i

or

SGLT2-i

or

SGLT2-i

or

DPP-4-i

or

Insulin

or

SGLT2-i

or

Insulin

or

Insulin

or GLP-1-RA

or GLP-1-RA

or

or

Insulin

or GLP-1-RA

Insulin

If HbA1c target not achieved after ~3 months of triple therapy and patient (1) on oral combination, move to injectables, (2) on GLP-1 RA, add
basal insulin, or (3) on optimally titrated basal insulin, add GLP-1-RA or mealtime insulin. In refractory patients consider adding TZD or SGL T2-i:

Metformin

Basal Insulin +

Mealtime Insulin or

GLP-1-RA

Dislipidemiile

Definirea termenilor
Dislipidemii
Hiperlipidemii
Valorile normale
- colesterol seric total < 190 mg/dl (< 5 mmol/l)
- trigliceride serice < 180 mg/dl (< 2 mmol/l)
- colesterol - HDL > 40 mg/dl (> 1 mmol/l)
- colesterol - LDL < 115 mg/dl (< 3 mmol/l)
Obiectivele terapeutice

Importana dislipidemiilor

Impactul epidemiologic
- boli populaionale
- n Romnia: 55% din populaia ntre 20 i 60 ani
Impactul biologic: risc cardio-vascular
risc de pancreatit acut
Impactul economic

Lipoproteinele
Asocieri moleculare dintre diferite componente lipidice
sanguine (TG, colesterol, fosfolipide, AG) i proteinele
circulante
Constituite din:
- partea transportat: AG esterificai sub form de TG i
esteri de colesterol
- transportorul: apoproteine
Rolul apoproteinelor:
- structural
- funcional: legarea de receptori
activarea sau inhibarea unor enzime
(LPL, LCAT)

Clase majore lipoproteice


Chilomicronii 90% TG
VLDL 60% TG, 12% colesterol
IDL forme tranzitorii; 30% colesterol, 40% TG
LDL 60% colesterol
- fenotip A
- fenotip B
- fenotip intermediar
HDL

Clasificarea dislipidemiilor (Frederickson)

Tipul I chilomicronemie bazal


Tipul IIa hiper - LDL
Tipul IIb hiper - LDL i hiper - VLDL
Tipul III cu IDL n condiii bazale
Tipul IV hiper VLDL
Tipul V chilomicronemie bazal + hiper - VLDL

Tipul VI hiper - HDL

Clasificarea dislipidemiilor
(Asociaia European de ateroscleroz)
Forma de dislipidemie

Colesterol

Trigliceride

Hipercolesterolemie
- de grani
- moderat
- sever

190-249
250-300
> 300

< 180
< 180
< 180

Hipertrigliceridemie
- moderat
- sever

< 190
< 190

180-400
> 400

Hiperlipidemie mixt
- moderat
- sever

190-300
> 300

180-400
> 400

Etiopatogenia dislipidemiilor
Factori genetici
- defect cromozomial monogenic (ex. HLP tip IIa)
- defect cromozomial poligenic
Factori ctigai
- excesele alimentare
- abuzul de alcool
- fumatul
- sedentarismul
- stress-ul
- obezitatea
- diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic
- unele medicamente: corticoizii, contraceptivele orale

Tablou clinic
Xantoame de tip eruptiv, tendinos, tuberos, palmar
Xantelasma
Arc cornean
Lipemia retinalis
Dureri abdominale, manifestri de pancreatit
Manifestri ale ATS cerebrale, coronariene i periferice
Simptome osteo-articulare (rar)

Investigaii paraclinice
Aprecierea aspectului plasmei sau serului dup 24 de
ore de la recoltare i pstrare la frigider (+ 40C)
Dozarea colesterolului total i a TG
Dozarea HDL-colesterolului
Calculul LDL-colesterolului (formula lui Friedwald):
LDL-col = colesterol total HDL-col TG/5 (mg/dl)
LDL-col = colesterol total HDL-col TG/2,2 (mmol/l)
Condiie: TG < 400 mg/dl
Alte metode (electroforeza, ultracentrifugarea, dozarea
apoproteinelor)

Depistarea dislipidemiilor

Ideal: screening sistematic la ntreaga populaie cu


vrsta > 20 ani

Practic: la grupele cu risc crescut

Grupele cu risc crescut la care se recomand


depistarea dislipidemiilor

1.

Bolnavi cu boli cardio-vasculare aterosclerotice

2.

Persoane cu factori de risc cardiovascular

3.

Persoane cu arc cornean sau xantomatoz

4.

Rudele de gradul I ale persoanelor de la punctele 1 i 2

Depistarea complet
- determinarea CT, TG, HDL-col
- recoltare dimineaa, dup 8-12 ore de post
- recomandat la persoane cu boli cardio - vasculare ATS
DZ
xantomatoz
Depistarea parial
- determinarea doar a colesterolului total
- recoltare n orice moment al zilei
- recomandat la persoanele care au i ali factori de risc
rudele de gradul I ale celor cu BCV ATS
alte persoane care se prezint la consultaie

Dislipidemiile aterogene
Hipercolesterolemie de grani (190-249 mg/dl)
Hipertrigliceridemie > 180 mg/dl
Scderea colesterolului HDL < 40 mg/dl la brbai
< 50 mg/dl la femei
Modificarea LDL care devin mici i dense

Dislipidemiile secundare
Hipercolesterolemii hipotiroidie, colestaz, sindrom
nefrotic, sarcin, medicaie cu tiazide i progesteron
Hipertrigliceridemie DZ necontrolat, sindrom nefrotic,
insuficien renal cronic, paraproteinemie
Hiperlipidemie mixt DZ necontrolat, sindrom nefrotic,
medicaie cu tiazide, corticosteroizi, progestageni

Complicaii i asocieri morbide


Patologia cardio-vascular aterosclerotic
Pancreatita acut
Diabetul zaharat
Obezitatea
Hipertensiunea arterial
Sindromul X metabolic

Management-ul dislipidemiilor
Stabilirea obiectivelor
Optimizarea stilului de via
- dieta hipolipidic
- exerciiul fizic
Tratamentul medicamentos

Principiile dietei hipolipidice


Adaptarea aportului caloric n funcie de necesiti i
greutatea corporal
Reducerea aportului caloric provenit din lipide < 30%
Scderea lipidelor saturate la 1/3 din totalul lipidelor
Lipidele mononesaturate i cele polinesaturate (forma cis)
vor reprezenta baza aportului lipidic (cte 1/3)
Scderea aportului de colesterol < 300 mg/zi
Creterea aportului de glucide complexe (50-55%)
Fibrele alimentare 20-30 g/zi
Glucidele simple 10% din necesarul caloric
Alcoolul va fi suspendat sau mult limitat
Evitarea fumatului

Dieta trebuie negociat cu pacientul


Control la 3 luni
Scade colesterolul cu 10-20%

Exerciiul fizic
Scade trigliceridele
Crete HDL-colesterolul

Tratamentul medicamentos
Fibraii
Mecanism de aciune
- PPAR exprimarea genei LPL
exprimarea genei Apo A I i Apo A II
diminuarea genei Apo C
activeaz LPL
stimuleaz catabolismul LDL i VLDL
inhib lipoliza TG din adipocite
concentraia LDL mici i dense
HDL de volum crescut
hiperlipemia postprandial
fibrinogenul efect antitrombogen

Efecte secundare - disconfort abdominal, greuri, erupii,


mialgii (miopatie), efectul anticoagulantelor
Contraindicaii - insuficien hepatic, renal, sindrom
nefrotic, sarcin, alptare

Monitorizare - teste funcionale hepatice, creatin-kinaza

Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil

Tratamentul medicamentos
Statinele
Mecanism de aciune
- inhib HMG-CoA reductaza, deci sinteza colesterolului
- sinteza receptorilor LDL, deci catabolizarea acestuia
- procentul de LDL mici i dense
- oxidabilitatea LDL
- fibrinogenul, Lp(a), PAI-1 efecte favorabile pe
sistemul de coagulare-fibrinoliz
Efecte secundare flatulen, enzimelor hepatice i
musculare, erupii

Contraindicaii boli hepatice active, sarcin, alptare

Monitorizare - teste funcionale hepatice, creatin-kinaza

Preparate - rosuvastatin, atorvastatin, simvastatin,


pravastatin, lovastatin, fluvastatin

Indicaii de utilizare a claselor de


hipolipemiante
Tipul de hiperlipidemie Prima alegere

Alternativ

Hipercolesterolemie

Statine

Rezine, acid
nicotinic, fibrai

Hipertrigliceridemie

Fibrai

Acid nicotinic, ulei


de pete

Hiperlipidemie mixt

Fibrai, statine Acid nicotinic

Asocieri medicamentoase recomandate


Colestiramin + statine
Fibrai + statine

Obezitatea

Definiie - obezitatea este o boal caracterizat prin


creterea greutii corporale pe seama esutului adipos

Etimologie - obedo-obedere (lat) = a mnca n


exces, a mnca mult i lacom

Prevalen - n lume > 250 milioane obezi


- n 2025 > 300 milioane obezi

Prevalena supraponderii i a obezitii n rile


europene

Obezitatea
problem major de sntate public
Prevalen crescut la nivel populaional

Costuri directe i indirecte ridicate implicate de


ngrijirea obezitii

Complicaii multiple

Formule de calcul a greutii ideale


Formula lui Broca: GI = I 100
Formula lui Lorentz: GI = (I 100) (I 150)/4 (B)
GI = (I - 100) (I 150)/2 (F)
Formula Societii Asigurrilor Metropolitane din New York:
GI = 50 + 0,75(I 150) + (V 20)/4 (B)
F: GI (B) X
0,9

Indici de apreciere a obezitii


Indicele de mas corporal:
IMC = G/I2 (n = 18,5 24,9 kg/m2)
Indicele abdomino-fesier:
IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95)
Indicele abdominal:
IA = CA / I (n < 0,5)
Grosimea paniculului adipos n regiunea tricipital:
n < 20 mm (B); n < 30 mm (F)
CA:
n < 94 cm (B);
n < 80 cm (F)

Clasificarea greutii n funcie de valorile IMC


(Kg/m2)
Subponderal
Normal

< 18,5
18,5 - 24,9

Supraponderal

25 29,9

Obezitate gradul I

30 34,9

Obezitate gradul II

35 39,9

Obezitate gradul III

40

Clasificarea obezitii n funcie de distribuia


esutului adipos
Tipul obezitii

Talia (cm) B

Talia (cm) F

Abdominal
Gluteo-femural

94
< 94

80
< 80

Riscul cardiovascular n funcie de talie i sex


Risc sczut

Risc probabil

Risc cert

Brbai

< 94

94 101

102

Femei

< 80

80 87

88

Clasificarea obezitii
Criteriul etiopatogenic
- obezitate primar
- obezitate secundar
Criteriul histologic
- obezitate hiperplazic
- obezitate hipertrofic
- obezitate mixt
Criteriul evolutiv
- obezitate dinamic (faza de acumulare)
- obezitate static (de regul cnd a atins maximul ponderal)

Organismul normoponderal adult


EA = EC (MB + TM + TR + ADS)
Organismul obez
EA = EC + ED
EA = energie de aport
EC = energie de consum
MB = energie consumat pentru nevoile bazale
TM = travaliu muscular
TR = energie de termoreglare
ADS = aciunea dinamic specific a alimentelor

Principalii factori de risc obezogen (1)


Factori genetici istoric familial de obezitate
Subnutriia mamei gestante, greutate mic la natere a
ftului
Stil de via nesntos alimentaie hipercaloric, alcool,
sedentarism, stress
Factori psihologici, sociali i culturali
- depresia, anxietatea tulburri de comportament alimentar
- urbanizarea
- obiceiuri alimentare nesntoase
- lipsa aciunilor de educaie i prevenire la nivel populaional
- mentaliti greite

Principalii factori de risc obezogen (2)


Tulburri de comportament alimentar gustri
interprandiale de alimente bogate caloric, bulimie, binge
eating, night eating, carbohydrate-craving
Factori fiziologici sarcin, lactaie, menopauz
Factori endocrini i hipotalamici
Medicamente
Ali factori ntreruperea fumatului n absena unei diete
corespunztoare

Mortalitatea
Riscul cel mai mic: IMC = 20 25 27 Kg/m2
excesiv la IMC > 30 Kg/m2
IMC sczut neoplasme
IMC crescut boli cardio-vasculare
Durata medie de supravieuire cu 10 ani mai mic
Efectul fluctuaiilor greutii

Complicaiile cardio-vasculare ale obezitii


Boala coronarian
Insuficiena cardiac
Aritmiile i moartea subit
Hipertensiunea arterial
Varicele membrelor inferioare

Complicaiile respiratorii ale obezitii


Hipoventilaie hipoxie i hipercapnie tulburri nervoase
centrale (somnolen, convulsii)
Hipoxemia poliglobulie secundar volumul sanguin
HTP CPC IVD ICCG
1956, Burnwell Sdr. Pickwick obezitate marcat,
hipoventilaie, somnolen, uneori convulsii, cianoz, respiraie
periodic, policitemie secundar, HVD, CPC decompensat
Pneumopatii acute i bronite
Dispnee, chiar n lipsa insuficienei cardiace
Sindromul apneei n timpul somnului

Complicaiile digestive ale obezitii

Litiaza biliar
Angiocolecistite
Herniile hiatal, inghinal, ombilical
Steatoza hepatic
Hemoroizi

Tulburri endocrine

Distrofie ovarian (ovare polichistice)


Tulburri ale ciclului menstrual
Hiperestrogenism i hiperandrogenism la femei
Hipogonadism la brbai

Cancerele
La B: prostat, colorectal
La F: endometru, sn, ci biliare, col uterin, ovar

Complicaiile metabolice ale obezitii


Diabetul zaharat
Hiperlipidemia
Hiperuricemia

Complicaiile la nivelul aparatului locomotor


Reumatism cronic degenerativ
Osteoartrite de old i de genunchi
Boli periarticulare tendinite

Complicaiile neurologice i psihice


Cefalee, vertij, astenie fizic
Tulburri psihice

Complicaiile chirurgicale ale obezitii


Risc chirurgical i anestezic mai mare
Risc de insuficien respiratorie, infecii ale plgilor,
dehiscena plgilor, tromboflebite postoperatorii

Complicaiile obstetricale ale obezitii


Eclampsie, varice, tromboflebite, infecii urinare, diabet
gestaional, mortalitate fetal crescut
Distocii
Retracie uterin ntrziat hemoragii, oc; endometrite,
accidente mamare, pielonefrite

Complicaiile cutanate
Infecii microbiene i fungice (intertrigo inghinal, axilar)
Eczeme

Tratamentul obezitii n funcie de IMC

Principiile tratamentului dietetic n obezitate


Glucide: 55-58%

5 mese pe zi

Proteine: 15-17%

Mic dejun: 20%

Lipide: 27-28%

Gustare: 15%

NaCl: < 6 g

Prnz: 30%

Fibre alimentare: 20-30 g

Gustare: 15%

Colesterol: < 300 mg

Cina: 20%

Lichide: > 2 litri

Tipuri de diete utilizate n obezitate


Dieta cu deficit de 500 kcal/zi
Dieta cu deficit de 1000 kcal/zi
Dieta hipocaloric standard de 1200-1300 kcal/zi
Reducerea la jumtate din aportul caloric anterior
Dietele foarte hipocalorice sau restrictive sub 800 kcal/zi

Rolul efortului fizic n tratamentul obezitii


Crete sensibilitatea esuturilor la insulin
Determin scdere n greutate i menine
greutatea dorit
Scade riscul cardiovascular
Scade necesarul de ageni farmacologici
Crete capacitatea de efort
Crete calitatea vieii

Tratamentul medicamentos al obezitii


Orlistat (Xenical)
Inhib selectiv lipaza gastrointestinal absorbia
grsimilor cu 30% (TG i colesterol)

Aciuni i efecte
- reducerea greutii pe seama masei grase
- reducerea taliei i a IMC
- reducerea RCV prin reducerea celorlali FR ( col total,
LDL, TG, ameliorarea toleranei la glucoz, a TA)
Reacii adverse
- digestive (n condiiile unui aport lipidic crescut)
- nivelului plasmatic al vitaminelor liposolubile
Contraindicaii sindrom de malabsorbie
Posologie 3 x 120 mg / zi la mesele principale

Tratamentul chirurgical al obezitii


Indicaii
IMC 40 kg/m2
IMC 35 kg/m2 cu comorbiditi
Vrsta ntre 18 i 60 ani
Eecul tratamentului conservator aplicat cel puin un an
Pacient care va coopera pe termen lung dup operaie

Tratamentul chirurgical al obezitii


Contraindicaii
IMC < 35 kg/m2
Vrsta sub 18 ani sau peste 60 de ani
Obezitate de cauz endocrin
Dependena de droguri sau alcool
Risc operator inacceptabil
Boli asociate grave: hepatopatie, cardiopatie, patologie
digestiv

Tehnici chirurgicale
Tehnici restrictive
- gastroplastia orizontal
- gastroplastia vertical
- bandingul gastric

Tehnici de malabsorbie
- by-pass-ul jejunoileal
- by-pass-ul bilio-intestinal
- by-pass-ul bilio-pancreatic

Hiperuricemiile

Definirea termenilor
Hiperuricemia
Artrita acut uric
Artrita gutoas cronic i tofii gutoi
(guta cronic tofacee)
Nefropatia uric
Litiaza renal uric

Epidemiologie
Prevalena hiperuricemiilor - 2 18%
- n Romnia 4,2% la aduli
Prevalena gutei - 0,13 0,37%
- 2 5% din totalul artropatiilor
Sexotropism masculin
Vrf de inciden - decada a 5-a de vrst

Clasificarea hiperuricemiilor
Primare
- Idiopatic (> 99%)
- Defecte metabolice specifice motenite (<1%)
Secundare
- Deficitul de glucozo-6-fosfataz (boala von Gierke)
- Hemolize cronice: anemii hemolitice, leucemii, limfoame
- Mecanisme renale
- insuficien renal familial progresiv
- insuficien renal cronic dobndit
- medicamente (diuretice, citostatice)
- produi metabolici endogeni (lactat, corpi cetonici)

Tratamentul dietetic n hiperuricemii

Diet srac n purine


Tratamentul obezitii
Reducerea consumului de alcool
Diet lacto-fructo-zaharat

Tratamentul atacului acut de gut


Colchicina
AINS
Glucocorticoizii (po sau intraarticular)
NU hipouricemiante
Profilaxia recurenelor

Prevenirea formrii depozitelor tisulare de urai


i diminuarea sau dispariia celor constituite
Inhibitorii biosintezei acidului uric
- allopurinol, oxipurinol, tiopurinol

Medicaia uricoeliminatoare
- probenecidul
- benziodarona
- sulfinpirazona

Sindromul metabolic

Definiia sindromului metabolic (IDF, 2005)


Obezitate abdominal (CA 94 cm la B / 80 cm la F)

+
Oricare 2 din urmtoarele 4 elemente:

TG 150 mg/dl
HDL < 40 mg/dl la B i < 50 mg/dl la F
TAs 130 mm Hg sau TAd 85 mm Hg
Glicemie a jeun 100 mg/dl