Sunteți pe pagina 1din 195

Diabetul zaharat

Definiie

Sindrom heterogen caracterizat printr-o tulburare


complex n reglarea metabolismului energetic al
organismului, care afecteaz deopotriv utilizarea
glucidelor, lipidelor i proteinelor, precum i celelalte
metabolisme; aceste alterri sunt datorate insuficienei
absolute sau relative de insulin. Modificrile biochimice pe
care aceste tulburri le antreneaz conduc la modificri
celulare funcionale urmate de leziuni anatomice ireversibile
n numeroase esuturi i organe.
Definiie

Nu este o boal n sensul tradiional al termenului

Sindrom
- alctuit dintr-un grup heterogen de tulburri cu
etiologie i patogenie diferite
- componentele sindromului au ca element comun
hiperglicemia
Etimologie

Diabeiu (greaca veche) = a se scurge ca printr-un sifon


(aluzie la poliuria marcat a acestor pacieni)

Thomas Willis (medic, anatomist i profesor la Oxford)


- a adugat cuvntul mellitus (ca mierea)

Diabetes mellitus
(Diabet zaharat)
Epidemiologie

Aretaeus din Cappadocia (81-138) boala este rar


Date epidemiologice propriu-zise: nceputul sec. XX
Numr estimat de persoane cu diabet zaharat
n 2015 i n 2040

IDF Diabetes Atlas, Seventh Edition, 2015


Prevalena diabetului zaharat
Prevalena DZ i a pre-diabetului n Romnia 2014
n Romnia: 11,6% persoane cu diabet zaharat

Diabet
Prediabet nediagnosticat
18,4% 2,4%

Diabet
Diabet zaharat
11,6% diagnosticat
Glicemie normal 9,2%
69,2%

Mota M et al. Studiul PREDATORR. Prezentare la Congresul SRDNBM, Mai 2014


Pancreasul endocrin - noiuni de anatomie i
fiziologie

Insulele Langerhans

800.000 1.500.000
1 2 % din masa
pancreatic total
Celule: A, B, C, D
Hormonii secretai n celulele insulelor
Langerhans

Tipul Hormonul Efect pe metabolismul glucidic


celular produs
A Glucagon Hiperglicemiant prin glicogenoliz

B Insulin Hipoglicemiant prin mec. multiple


Peptidul C Efecte metab. incomplet cunoscute
Amilin Hiperglicemiant
C(PP) Polipeptid Influen pe motilitatea gastric i
pancreatic absorbia principiilor nutritive
D Somatostatin Hiperglicemiant, inhib secreia
insulinei
Insulina structur, sintez, secreie
Secreia insulinei
Secreia insulinei
bazal insulinemia plasmatic = 10-12 U/ml
stimulat insulinemia plasmatic 50-75 U/ml
Controlul hormonal al glicemiei
Insulina Hormoni de contrareglare
Efect net: scderea glicemiei Efect net: creterea glicemiei

nlturrii glucozei din snge nlturrii glucozei din snge


- intrrii glucozei n celule - intrrii glucozei n celule
- glicogenezei - glicogenezei
eliberrii glucozei din eliberrii glucozei din
depozite depozite
- glicogenolizei - glicogenolizei
- gluconeogenezei - gluconeogenezei
- lipolizei i cetogenezei - lipolizei i cetogenezei
- catabolismului proteic - catabolismului proteic
Clasificarea DZ (OMS,1998)
DZ tip 1 - autoimun
- idiopatic

DZ tip 2

Alte tipuri specifice - defecte genetice ale celulelor


- defecte genetice ale aciunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente i substane chimice
- infecii
- forme rare de diabet imun
- sindroame genetice rare

Diabetul gestaional
Diabetul zaharat tip 1

Poate apare la orice vrst, dar mai frecvent sub 30 ani


Dei exist o predispoziie genetic, majoritatea
pacienilor nu au antecedente familiale de DZ
Debut relativ abrupt, cu simptome evidente i tendin la
cetoacidoz
De obicei, pacienii sunt slabi
Rezult n urma distrugerii celulelor -pancreatice
Insulina plasmatic este foarte redus sau absent
Anticorpi circulani: antiinsulin, anticelule , anti-GAD
Pacienii sunt dependeni de insulin
Etiopatogenia DZ 1 autoimun

Predispoziie genetic
Factor de mediu (viral, toxic, alimentar)
Activare autoimun insulit
Scderea capacitii -secretoare; afectarea fazei secretorii
iniiale, dar insulinemia plasmatic este normal
Diabet clinic manifest; insulinemie plasmatic sczut,
hiperglicemie, apar simptomele
Apariia complicaiilor
Diabetul zaharat tip 2

Apare, de obicei, dup vrsta de 40 ani


80% din cazuri: obezi
Perioad prediagnostic lung
Simptomatologie de debut tears sau absent, fr
tendin la cetoacidoz
Asocierea a dou defecte celulare: rezistena la insulin
i deficiena funciei -celulare
Cel puin iniial, capacitatea secretorie -pancreatic
este relativ pstrat, rspunznd bine la diet i ADO;
ulterior, unii vor necesita insulinoterapie
Etiopatogenia DZ 2

Factori genetici transmitere poligenic

Rezisten crescut la aciunea insulinei

Hiperinsulinism funcional

Deficien n secreia insulinic hiperglicemie persistent

Scderea absolut a secreiei insulinice

DZ 2 insulinonecesitant
Clasificarea DZ (OMS,1998)
DZ tip 1 autoimun (1A)
- idiopatic (1B)

DZ tip 2

Alte tipuri specifice - defecte genetice ale celulelor


- defecte genetice ale aciunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente i substane chimice
- infecii
- forme rare de diabet imun
- sindroame genetice rare

Diabetul gestaional
Diagnosticul clinic al DZ

Poliurie
Polidipsie
Polifagie
Scdere ponderal
Astenie
Caracteristicile generale ale DZ 1 i 2
Particularitate Tipul 1 Tipul 2
Ereditate Concordan 30-50% Concordan 90%

Baza genetic Defect n programarea IR i/sau insulino-


imunitii deficien
Semne de Prezente Absente
autoimunitate
Debut Sub 40 de ani Peste 40 de ani
IMC Sczut Crescut (80%)
Insulinemia Sczut Crescut
plasmatic
Tendina la Marcat Absent
cetoz
Tratament oral Ineficient Eficient
Criterii de diagnosticare a DZ
(diagnosticul paraclinic)

Cel puin dou glicemii a jeun 126 mg/dl (7 mmol/l)


sau
Prezena simptomelor i o glicemie ntmpltoare (n
orice moment al zilei) 200 mg/dl (11,1 mmol/l)
sau
O glicemie 200 mg/dl (11,1 mmol/l) la 2 ore dup
administrarea a 75 g glucoz (TTGO)

N.B. - glicozuria NU este un criteriu de dg.


- NU se recomand ca dg. de DZ s se bazeze pe
glicemii efectuate pe glucometre
- HbA1c NU se folosete pentru diagnosticul DZ
Glucoza plasmatic versus glucoza din
sngele total

Glucoza din plasm Glucoza din sngele total

126 mg/dl (7 mmol/l) 110 mg/dl (6,1 mmol/l)

200 mg/dl (11,1 mmol/l) 171 mg/dl (9,5 mmol/l)


Criterii de interpretare a glicemiei bazale

70-110 mg/dl normal

110-125 mg/dl glicemie bazal modificat

126 mg/dl diabet zaharat probabil;


confirmarea se face dup a doua dozare
Criterii de interpretare a TTGO
Glicemie n plasma venoas
Diabet zaharat
- bazal 126 mg/dl (7 mmol/l)
- la 2 h dup glucoz 200 mg/dl (11,1 mmol/l)

Scderea toleranei la
glucoz
< 126 mg/dl (7 mmol/l)
- bazal
140 mg/dl (7,8 mmol/l) i
- la 2 h dup glucoz
< 200 mg/dl (11,1 mmol/l)
Normal
- bazal < 110 mg/dl (7 mmol/l)
- la 2 h dup glucoz < 140 mg/dl (7,8 mmol/l)
Modaliti de debut i de diagnostic ale DZ

Pacient simptomatic
- simptomele clasice de diabet
- simptome ale complicaiilor - acute
- cronice

Pacient asimptomatic
- bilan al strii de sntate
- depistare activ la subieci cu risc
Indicaiile screening-ului pentru DZ 2 la subiecii
asimptomatici cu ajutorul glicemiei bazale (1)

Toi subiecii cu vrsta 45 ani

Glicemia jeun se va repeta la intervale de minimum 3 ani

Testarea se va face la vrste sub 45 ani i se va repeta la


intervale mai scurte la toi subiecii cu IMC 25 kg/m2 (IMC
23 kg/m2 la asiatici) care mai prezint i ali factori de risc
Indicaiile screening-ului pentru DZ 2 la subiecii
asimptomatici cu ajutorul glicemiei bazale (2)
Subieci cu factori de risc:
- sedentarii
- persoanele cu rude de gradul I cu DZ
- grupurile etnice cu risc crescut
- hipertensivii ( 140/90 mmHg sau sub trat. antihipertensiv)
- dislipidemicii (HDL 35 mg/dl i/sau TG 250 mg/dl)
- femeile care au nscut copii cu greutatea peste 4,5 kg
- femeile care au avut diabet gestaional
- femeile cu ovar polichistic
- persoanele cu HbA1c 5,7%, GBM sau STG la testri ant.
- alte condiii clinice asociate cu insulinorezisten (obezitate
sever, acanthosis nigricans)
- antecedente de BCV
Complicaiile DZ

Acute
- infeciile
- comele - hiperglicemice - cetoacidozic
- hiperosmolar
- lactacidemic
- hipoglicemic
Cronice
- microangiopatice
- macroangiopatice
- neuropatice
Infeciile

Frecvente la diabeticul dezechilibrat

Predispoziia ctre infecii explicat prin modificri legate


de hiperglicemie:
- mobilizrii i chemotactismului leucocitar
- capacitii fagocitare a polimorfonuclearelor
- capacitii bactericide a polimorfonuclearelor
- funciilor monocitare
Infecii puternic asociate diabetului (quasi-specifice),
severe, dar foarte rare:
- mucormicozele
- otita extern malign
- pielonefrita emfizematoas
- colecistita emfizematoas
Infecii postterapeutice:
- abcese insulinice, infecii asociate transplantului renal,
dializei peritoneale, hemodializei
Infecii nespecifice asociate DZ:
- infecii urinare: cistite, pielonefrite, abcese renale/perirenale
- infecii respiratorii
- infecii cutanate, mucoase, ale esutului celular s.c.
- altele: fasceita necrozant, gangrena Fournier a organelor
genitale
Hipoglicemiile

Definiie scderea valorilor glicemiei sub 70 mg/dl n


plasma venoas (sub 60 mg/dl n sngele venos total)

Triada Whipple:
- simptome sugestive pentru hipoglicemie dup post
prelungit sau exerciiu fizic
- documentarea unei valori glicemice sczute
- corecia simptomelor dup corecia valorilor glicemice

Cauze - exces de insulin sau de ADO secretagoge


- scderea aportului glucidic
- efort fizic excesiv
- consumul de alcool
Hipoglicemiile - fiziopatologie

Mecanismele de aprare mpotriva hipoglicemiei


- scderea secreiei de insulin
- creterea secreiei pancreatice de glucagon
- stimulare simpatic secreiei de catecolamine
- creterea secreiei de cortizol i h. de cretere

La pacientul diabetic
- scderea secreiei de insulin nu e un mecanism activ
- afectarea secreiei de glucagon la DZ 1 cu o perioad
lung de evoluie
- diminuarea secreiei de catecolamine prin neuropatie
vegetativ
Hipoglicemiile manifestri clinice

Semne periferice (de alarm adrenergic)


- tremurturi ale extremitilor, transpiraii, paloare,
tahicardie, palpitaii, anxietate, foame, parestezii distale
Semne centrale (de neuroglicopenie)
- tulburri de atenie, concentrare, memorie, coordonare,
comportament; oboseal, somnolen; tulburri de vorbire;
tulburri de vedere; parestezii peribucale; cefalee; contracturi
musculare localizate/generalizate; com profund, agitat
Atenie:
- idiosincrazia manifestrilor hipoglicemice
- alterarea contrareglrii adrenergice prin neuropatie
vegetativ
Hipoglicemiile

Clasificare
uoare: recunoscute i corectate de ctre pacient, nu
afecteaz capacitatea de munc i inseria n mediu
medii (moderate): afecteaz capacitatea de munc i
inseria n mediu
severe: totalitatea hipoglicemiilor care necesit intervenia
n urgen a unei alte persoane (tratament injectabil); includ,
dar nu se limiteaz la comele hipoglicemice

Cazuri particulare
- hipoglicemiile necontientizate
- hipoglicemiile nocturne
Complicaiile hipoglicemiilor

Accident vascular cerebral

Infarct de miocard

Tulburri funcionale cerebrale minore

Encefalopatia posthipoglicemic

Hemoragii retiniene masive

Decerebrare
Tratamentul hipoglicemiilor

Tratament preventiv educaia pacientului diabetic

Tratament curativ
- hipoglicemiile uoare i medii
- glucide rapid + lent absorbabile

- hipoglicemiile severe
- glucoz i.v.
- glucagon
- glucide rapid + lent absorbabile
Cetoacidoza diabetic - date generale

Definiie triada - hiperglicemie


- cetoz
- acidoz

F>B
Vrsta medie 43 ani
20 % episoade multiple
20 % apar la diabetici nou diagnosticai
Fiziopatologia cetoacidozei diabetice
Insuficien absolut sau relativ
Lipoliz de insulin

Hiperproducie de Proteoliz
corpi cetonici Accelerarea glicogenolizei i
neoglucogenezei
Eliberarea de alanin
i ali aminoacizi
Acidoz metabolic
Hiperglicemie i
glicozurie
Pierdere de ap, K+ PO-4, Creterea ureei
baze tampon
Poliurie osmotic Hiperosmolaritate

Deshidratare Sete

Colaps Aritmie Polidipsie

COM
Cauzele cetoacidozei diabetice

Insulinodeficiena absolut
- ntreruperea insulinoterapiei
- cetoacidoz inaugural (20%)

Insulinodeficiena relativ
- afeciuni intercurente
- endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia
- iatrogen (corticoizi, simpatomimetice)
- sarcin
- stress
Tablou clinic

Facies vultuos
Temp. cutanat
Semne neuromusculare hipotonie moderat, diminuarea ROT
Semne de deshidratare cutaneo-mucoas
Semne cardiovasculare tahicardie; TA e de obicei normal
Semne respiratorii halen acetonemic, dispnee Kssmaul
Semne digestive greuri, vrsturi, dureri abdominale
Starea de contien de obicei pstrat
Diagnostic paraclinic

Hiperglicemie: 350 1200 mg%

Hipercetonurie: > 30 mEq/l


Tratamentul cetozei incipiente

Creterea dozelor de insulin


Hidratare corespunztoare
Buturi reci ndulcite cu zahr sau glucoz,
n cantiti mici i la intervale scurte
Sucuri de fructe, supe de legume, ceai cu zahr, compot
Scderea grsimilor din alimentaie
Tratamentul cetoacidozei avansate i severe

Combaterea tulburrilor hidroelectrolitice


Combaterea tulburrilor metabolice (hiperglicemia)
Combaterea tulburrilor acido-bazice
Combaterea tulburrilor hemodinamice
Combaterea factorului infecios
Msuri nespecifice
- oxigenoterapie
- sondaj vezical
- sond de aspiraie gastric
- heparin 5000 u/8h
- tratament etiologic
Mortalitatea n CAD sever

< 0,5% n comele simple

5 15% n comele complicate

45% cnd este abolit starea de contien


Coma hiperosmolar

Definiie
Absena cetoacidozei la un diabetic care are o
osmolaritate plasmatic hiperglicemic sau mixt
(hiperglicemic i hipernatremic) > 350 mOsm/l

Osmolaritatea = (Na+ + 10) x 2 + glicemia /18 + ureea /6


(mosm/l)

Frecven
- 10% din comele diabetice hiperglicemice
Criterii de diagnostic

Osmolaritate plasmatic > 350 mOsm/l


Glicemie > 600 mg/dl
pH > 7,25
HCO3 > 15 mEq/l
Semne de deshidratare masiv
Complicaiile cronice ale DZ
Complicaiile cronice ale DZ

Microangiopatice
Macroangiopatice
Neuropatice
Gangrena diabetic
Alte complicaii - hepatopatia dismetabolic
- cardiomiopatia diabetic
- parodontopatia
- complicaii osteo-tendino-articulare
- osteoartropatia diabetic (piciorul Charcot)
- afectarea cutanat
n momentul diagnosticului DZ 2 un procent mare
din persoane au deja complicaii cronice sau
asocieri morbide
80

70

60

50

40

30

20

10

0
Obezit. HTA DZP BCV Retinop.diab Nefrop.diab.
Neurop.diab.

N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first
three years. Diabetologia 2003; 46(Suppl.2): A282.
Clasificarea neuropatiei diabetice

Neuropatia subclinic

Neuropatia clinic

Periferic
Vegetativ (autonom)
Neuropatia subclinic

Teste de electrodiagnostic anormale


- vitez de conducere nervoas sczut

Testare cantitativ senzorial anormal


- vibratorie, tactil, termic
Neuropatia periferic

Polineuropatia distal simetric


Neuropatia diabetic acut
Neuropatia diabetic hiposenzitiv
Neuropatia motorie proximal a membrelor inferioare
Mononeuropatiile
Neuropatiile truncale
Polineuropatia distal simetric

Cea mai frecvent


Tulburri de sensibilitate (hiperestezie sau hiposensibilitate)
Membrele inferioare
Evoluie centripet
Disestezie
Anestezie dureroas
Agravare nocturn
Semne de disfuncie vegetativ
Piele uscat / aspect pseudo-inflamator
Sensibilitatea vibratorie / proprioceptiv
Atrofie i hipotonie muscular
Neuropatia diabetic acut

Rar, dar caracteristic DZ


Instalare acut
Dureri intense n membrele inferioare
Caexie neuropat
Insomnie
Depresie
Impoten
Neuropatia diabetic hiposenzitiv

Lipsesc acuzele subiective


Scdere / dispariie a sensibilitii dureroas, termic,
vibratorie
Alterare variabil a funciilor vegetative
VCN
Risc de leziuni cutanate
Evaluare cantitativ: determinarea pragului de electropercepie
Neuropatia motorie proximal a membrelor
inferioare

Rar

Amiotrofii

Poliradiculopatia diabetic

Instalare acut / subacut

Topirea muchilor
Mononeuropatiile

Cel mai frecvent:

nervii cranieni

Cubital

Sciatic popliteu extern


Neuropatiile truncale

Rare

Instalare acut sau progresiv

Durere abdominal sau truncal unilateral

T3 - T12
Tratamentul neuropatiei periferice

Echilibrare metabolic riguroas


AINS, analgezice opioide cu aciune central
Tranchilizante minore
Carbamazepina, Gabapentin
Antidepresive triciclice
TENS, electroacupunctura
Capsaicina
Vitaminoterapia, benfotiamina, acidul alfa-lipoic
Ionizri ale membrelor inferioare cu Xilin 1% i vit. B1
Balneofizioterapia (mofete, bi carbogazoase, ionizri)
Neuropatia vegetativ

Neuropatia cardio-vascular
Neuropatia digestiv
Neuropatia vezical
Tulburrile sexuale
Neuropatia pupilar
Tulburrile cutanate
Hipoglicemiile necontientizate
Neuropatia cardio-vascular
Manifestrile cardiovasculare ale neuropatiei

Cardiace Vasculare
Tahicardie cu ritm stabil Hipotensiune ortostatic
Infarct miocardic nedureros Tulburri circulatorii cerebrale

intervalului QTc (>400 ms) Tulburri circulatorii ale


extremitilor
Tulburri de ritm Edeme ale membrelor
inferioare
Moarte subit Fenomenul non-dipping
Accidente anestezice
Tratamentul hipotensiunii ortostatice

Stoparea medicaiei care exacerbeaz hipotensiunea


Trecere treptat din clino n ortostatism
Ciorapi elastici
Creterea moderat a aportului de sare
Simpatomimetice (etilefrin - Effortil)
Mineralocorticoizi (9--fluorohidrocortizon 400 g/zi)
Antiinflamatorii nesteroidiene
Derivaii de ergotamin (DH-ergotoxin 7 pic. de 3 X / zi)
Agoniti ai receptorilor 1 - Midodrin 2,5-10 mg/zi
Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o
Neuropatia digestiv

Disfuncia esofagian (tulburri de motilitate)

Disfuncia gastric: control glicemic dificil, plenitudine post-


prandial, saietate precoce, anorexie, intoleran digestiv
total n formele severe (gastropareza diabetic)

Disfuncia intestinal: constipaie neuropat, diaree neuropat


(accentuat nocturn, episoade de remisie/agravare, scaune
apoase, fr fenomene de malabsorbie), rar incontinen fecal

Disfuncia veziculei biliare (hipomotilitate, litiaz biliar)


Tratamentul neuropatiei autonome digestive

Gastropareza: control glicemic riguros (inclusiv pe termen


scurt), prokinetice

Diareea neuropat: loperamid, eritromicin, clonidin

Constipaia neuropat: aport de fibre, prokinetice, lactuloz

Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

Atenie: este necesar investigarea altor etiologii ale


manifestrilor digestive (diagnostic de excludere)
Neuropatia digestiv

Disfuncia esofagian

Disfuncia gastric

Disfuncia intestinal

Disfuncia veziculei biliare


Neuropatia vezical
Hipotonie ureteral
Pareza vezical
vezica neurogen

Tulburrile sexuale
B impoten - tulburri de erecie
- ejaculare retrograd
F tulburri menstruale
Neuropatia pupilar
Asimptomatic
Msurarea reflexului pupilar la lumin

Tulburrile cutanate
Anhidroz distal
Hipersudoraie compensatorie n superioar a corpului

Hipoglicemiile necontientizate
Absena semnelor de avertizare a hipoglicemiilor
Macroangiopatia diabetic

Ateroscleroza date generale

Arterioscleroza
Ateroscleroza
Athero (terci) + sclerosis (induraie)
Istoric
Localizare
Fiziopatologia aterosclerozei

Ipoteza rspunsului la injurie (R. Ross)


Leziunile aterosclerotice

Striurile lipidice

Placa de aterom fibroas

Placa de aterom complicat


Diagnosticul clinic al aterosclerozei

Faza preclinic, asimptomatic


- diagnostic de suspiciune
- modificri metabolice (hipercolesterolemia)
- factori de risc (fumat, HTA, DZ etc.)

Faza clinic
- obstrucie > 60-70% din lumenul arterial
- ischemie n diverse teritorii - coronarian
- cerebral
- membrele inferioare
- renal
- mezenteric
- particularitile ATS la diabetici
Diagnosticul paraclinic al aterosclerozei

Ecg
Ecg de efort
Scintigrafia cu taliu
Ecocardiografia
Angiografia
Ecografia intravascular
Microangiopatia diabetic

Nefropatia diabetic

Retinopatia diabetic
Nefropatia diabetic date epidemiologice

50 % dintre pacienii aflai n programele de supleere


renal au drept cauz a insuficienei renale diabetul

Dup 20 de ani 30 % dintre pacienii cu DZ 2 dezvolt


nefropatie

20% dintre cei cu nefropatie ajung la insuficien renal


terminal
Eliminarea urinar de proteine

Prin consens:

Normoalbuminurie < 30 mg/24 ore

Microalbuminurie 30-300 mg/24 ore

Macroalbuminurie > 300 mg/24 ore


Stadializarea nefropatiei diabetice

Stadiul I Hiperfuncie i hipertrofie renal

Stadiul II Silenios, normoalbuminuric

Stadiul III Nefropatia diabetic incipient

Stadiul IV Nefropatia diabetic patent (clinic manifest)

Stadiul V Insuficiena renal cronic terminal


Evoluia n timp a filtratului glomerular i a
eliminrii urinare de albumin
Diagnostic clinic

Semne de HTA
Semne de sindrom nefrotic, IRC
Prezena altor complicaii ale diabetului: retinopatie,
macroangiopatie, neuropatie
numrului de hipoglicemii nejustificate i
necesarului de insulin
Caracteristicile clinice ale diabeticilor
hipertensivi

presiunii pulsului arterial

Hipotensiunea ortostatic

Hipertensiunea nocturn
Diagnostic paraclinic

Rata filtrrii glomerulare

Eliminarea urinar de proteine

Biopsia renal
Screening pentru nefropatia diabetic

Microalbuminuria se evalueaz la
diagnosticarea DZ i apoi anual

Creatinina seric trebuie dozat anual


Eliminarea urinar de proteine

normoalbuminurie microalbuminurie macroalbuminurie

Rata de excreie
a albuminei < 30 30-300 300
(mg/24 ore)

Raportul
albumin/creati-
nin (mg/g)
Brbai < 20 20-200 200

Femei < 30 30-300 300


Factori de risc pentru progresia
nefropatiei diabetice

HTA

Albuminuria

Controlul glicemic insuficient

Fumatul

Consumul crescut de proteine

Dislipidemia
Metode terapeutice

Meninerea unui control glicemic optim pe termen lung


Tratamentul precoce al hipertensiunii arteriale
Tratamentul dietetic
Reducerea lipidelor serice
Prevenirea i tratamentul comorbiditilor existente
Tratamentul anemiei renale
Profilaxia i tratamentul bolii osoase renale
Retinopatia diabetic date generale

RD unul din primele semne de afectare vascular

Prima cauz de cecitate 20-74 ani

Prevalena corelat cu durata de evoluie a DZ

> 20 ani de DZ toi pac.cu DZ 1


> 60% pac. cu DZ 2
Fiziopatologia retinopatiei diabetice

Alterarea compoziiei membranei bazale



- extravazare - plasm edem
- hematii hemoragii
- lipoproteine exsudate dure

Pericitelor
- proliferarea cel. endoteliale
- tonicitii peretelui capilar ectazii capilare
microanevrisme
Proliferarea cel. endoteliale + microanevrismele

ncetinire curent sanguin

adezivitatea plachetar

Ocluzie capilar

Hipoxie retinian

Stimularea angiogenezei

Vase de neoformaie
Leziunile din RD (1)

Dilataia capilarelor
Microanevrismele
Hemoragiile intraretiniene
Exsudatele dure
Exsudatele moi
Anomalii intravasculare intraretiniene
Anomalii venoase
Neovascularizaia retinian
Leziunile din RD (2)

Hemoragiile preretiniene

Hemoragiile vitreene

Dezlipirea de retin

Rubeoza irian. Glaucomul neovascular

Maculopatia diabetic
Clasificarea retinopatiei diabetice

Retinopatie diabetic neproliferativ


- uoar

- sever (preproliferativ)

Retinopatie diabetic proliferativ


Diagnosticul retinopatiei diabetice

Examenul FO
- oftalmoscopia direct
- biomicroscopia FO
- oftalmoscopia indirect
Angiografia cu fluorescein
Fluorometria vitrean
Ecografia ocular
Electroretinograma
Teste de discriminare cromatic
Adaptometria
Screening-ul retinopatiei diabetice

Acuitatea vizual poate fi normal chiar n prezena unor


leziuni avansate ale retinei necesar screening
periodic pentru toate persoanele cu diabet

Examenul oftalmologic se va face la depistarea


diabetului i apoi anual

Pacienii cu retinopatie diabetic vor fi evaluai mai des


n funcie de indicaiile medicului oftalmolog
Frecvena examinrilor n funcie de stadiul RD

Anomalii retiniene Urmrire la

Normal + rare microanevrisme Anual


RDNP uoar 9 luni
RDNP moderat 6 luni
RDNP sever 4 luni
EMCS 2-4 luni
RDP 2-3 luni
Tratamentul medicamentos al RD

Echilibrarea metabolic a DZ
Evitarea hipoglicemiilor
Vitamine A, E
Extractul de ginkgo biloba
Dobesilat de calciu
Aspirina
Tratamentul HTA
IECA, Sartani, Sandostatin
Tratamentul chirurgical al RD

Tratamentul laser
- panfotocoagularea laser
- tratamentul laser focal

Vitrectomia posterioar

Crioterapia
Alte afectri oculare n diabetul zaharat

Cataract
Glaucom
Infecii
Neuropatii de nervi oculomotori
adaptrii la ntuneric
discriminrii cromatice
Piciorul diabetic - date epidemiologice

25% dintre bolnavii cu DZ internai sunt spitalizai pentru


complicaii la nivelul piciorului

50-70% dintre amputaiile netraumatice sunt la pacienii


cu DZ

Neuropatia diabetic este a doua cauz, pe plan


mondial, de durere neuropat, dup lumbago
Fiziopatologia piciorului diabetic

Principalele modificri sunt


determinate de:
neuropatie
arteriopatie
Diagnostic diferenial - simptome

Arteriopatia diabetic
Claudicaie intermitent
Durere de repaus
Durere spontan, brusc instalat

Neuropatia diabetic
Dureri de repaus, nocturne
Arsuri
Parestezii
Diagnostic diferenial semne clinice

Arteriopatia diabetic Absena pulsului, picior rece


Paloare la ridicarea membrului inf.
Roea la trecerea n ortostatism
Cianoz
Modificri trofice

Neuropatia diabetic Piele atrofic


Calus
Unghii distrofice
Deformri osoase
Picior cald
Reducerea/absena sensibilitii
Absena reflexelor
Arteriopatia diabetic
Evaluare Echo-Doppler
Angiografie

Management Medicaie
Exerciii fizice
Trimitere la specialist

Neuropatia diabetic
Evaluare Monofilament
Sensibilitate vibratorie
Reflexe osteo-tendinoase

Management Controlul durerii


Trimitere la specialist
Examinare picior

Examen vascular periferic Examen neurologic

palpare puls arterial ROT


examinare circulaie venoas testare sensibilitate
culoare tegumente - tactil
T tegumente - termic
- dureroas
- vibratorie
Prevenia piciorului diabetic

Educaia pacientului pentru ngrijirea piciorului


Examinarea piciorului zilnic
ngrijirea pielii i unghiilor
nclminte adecvat

Renunarea la fumat

Identificarea deformrilor osoase

Evaluarea / ameliorarea controlului:


Glicemiei
TA
Factorilor de risc cardiovascular
Important de reinut n managementul piciorului
diabetic

Claudicaia intermitent din angiopatie poate lipsi sau


poate fi estompat datorit neuropatiei

Paradoxal, la nceputul tratamentului hipoglicemiant


durerile se pot intensifica
Piciorul diabetic - concluzii

Inspecia piciorului se va efectua la fiecare vizit iar examinarea


complet anual

Testarea sensibilitii periferice la bolnavul cu diabet se face


anual

Se recomand un control agresiv al glicemiei pentru a reduce


riscul apariiei piciorului diabetic

Pacientul trebuie nvat s-i examineze piciorul si s-l


ngrijeasc

Se va trimite pacientul la chirurg, ortoped, dermatolog la


apariia unei rni, infecii, onicomicoze
Complicaiile cutanate ale diabetului zaharat

Dermatoze datorate diabetului zaharat i complicaiilor sale


- manifestri cutanate ale neuropatiei diabetice
- manifestri cutanate ale angiopatiei diabetice
- infeciile cutanate

Dermatoze datorate tratamentului specific diabetului zaharat

Dermatoze asociate cu diabetul zaharat


Manifestri cutanate ale neuropatiei diabetice

Tegumentul uscat
Pierderea prului la nivelul gambelor
Hiperhidroza
Durilloamele i hiperkeratoza plantar
Hematoamele subungheale
Venectaziile
Edemul neuropat
Ulcerele neuropate
Manifestri cutanate ale angiopatiei diabetice

Dermopatia diabetic

Necrobioza lipoidic

Rubeoza facial

Ulcerele arteriopate
Infeciile cutanate

Tinea pedis
Onicomicoza
Onicodistrofia
Alte infecii micotice cutanate
Foliculite
Furunculoze
Fasceita necrozant
Dermatoze datorate tratamentului specific
diabetului zaharat

Lipodistrofia insulinic
Alergia la insulin
Reaciile la ADO - eritem polimorf
- necroliz epidermic toxic
Reaciile lichenoide
Infecii cutanate la locurile de injectare (S. aureus)
Dermatoze asociate cu diabetul zaharat

Buloza diabetic
Scleredemul
Acanthosis nigricans
Xantoamele eruptive
Vitiligo
Granulomul inelar
Carotenodermia
Evaluarea iniial

Obiective
evaluarea statusului bolii i a factorilor de risc pentru
complicaiile diabetului
informarea pacientului despre natura i severitatea bolii
educaia pacientului n legtura cu dieta adecvat,
exerciiul fizic, medicaie, automonitorizarea glicemiei
stabilirea unui plan terapeutic
stabilirea unui plan de monitorizare

Metode
- anamnez
- examen clinic complet
- investigaii paraclinice
Examen clinic

Greutate si nlime, IMC (Kg/m), circumferina abdominal


TA
Frecvena cardiac
Palparea tiroidei
Examinarea cordului
Examinarea piciorului
Examinarea pielii
Examinarea neurologic (reflexe, sensibilitatea vibratorie,
tactil, termic, dureroas)
Investigaii paraclinice

Glicemia bazal i la 2 ore postprandial


Colesterol total, LDL-colesterol, HDL-colesterol
Trigliceride
Acid uric
Uree, creatinin seric, clearence-ul de creatinin
Examenul de urin
Microalbuminuria
EKG
Examen FO
Radiografia toracic
Ecografie abdominal
Oscilometrie
Monitorizare
Evaluarea iniial
Prima vizit Educaia pacientului: informaii asupra bolii
i stilului de via

Urmrirea rezultatelor automonitorizrii


La fiecare glicemiei (dac aceasta s-a fcut)
Msurarea TA
consultaie Msurarea greutii / IMC i a CA
Inspecia piciorului
Determinarea HbA1c pentru evaluarea
La 3 luni controlului glicemic

Examen FO
Anual Depistarea microalbuminuriei
Profil lipidic
Evaluarea riscului pentru picior diabetic,
testarea sensibilitii
Tratamentul diabetului zaharat

DZ este o boal cronic

Obiectivul principal: meninerea parametrilor clinici i


biochimici specifici ct mai aproape de normal

Tratamentul trebuie privit n perspectiva speranei de


via
Criteriile unui bun control metabolic

Glicemia preprandial: 80-110 (130) mg/dl


Glicemia postprandial: 100-145 (180) mg/dl
HbA1c: < 7% (selectiv 6,5 %, chiar 8% la pacienii cu risc)
Colesterol total: < 200 (180) mg/dl
LDL-colesterol: < 100 (70) mg/dl
HDL-colesterol > 40 mg/dl (B), 50 mg/dl (F)
Trigliceride a jeun: < 150 mg/dl
TA < 140/90 mmHg (selectiv 130/80 mmHg)
IMC < 25 kg/m2 (B), < 24 kg/m2 (F)
Importana controlului glicemic

Obiectivul principal al terapiei n DZ 2 este de

a obine valori ale glicemiei ct mai aproape

de valorile normale, n scopul de a preveni i

ncetini apariia complicaiilor macro i

microvasculare
Hemoglobina glicozilat

Standardul de aur pentru monitorizarea glicemiei

Reflect o medie a valorilor glicemiei pe o perioad


anterioar de 2-3 luni

Se exprim ca procent din totalul Hb (normal 4-6%)

Se coreleaz bine cu valorile glicemiei

Obiectiv realistic - Valoarea cea mai sczut a HbA1c


obinut fr reacii adverse inacceptabile
Corelaii ntre valorile Hb A1c i glicemie

A1c (%) Media glicemiilor

6 135 mg/dl (7,5 mmol/l)


7 170 mg/dl (9,5 mmol/l)
8 205 mg/dl (11,5 mmol/l)
9 240 mg/dl (13,5 mmol/l)
10 275 mg/dl (15,5 mmol/l)
11 310 mg/dl (17,5 mmol/l)
12 345 mg/dl ( 19,5 mmol/l)
Avantajele HbA1c

Evaluare obiectiv a controlului glicemic

Se coreleaz cu riscul de apariie a complicaiilor

Nu poate fi manipulat de pacient

Neinfluenat de modificrile recente ale glicemiei ca


urmare a ingestiei de alimente
Automonitorizarea glicemiei

Crete compliana la tratament i are efect favorabil


asupra schimbrii stilului de via
Frecvena se stabilete n funcie de pacient, stadiul bolii,
riscul evenimentelor hipoglicemice
Ajut la individualizarea tratamentului i adaptarea
msurilor nefarmacologice
Dezavantaje
cost crescut
disconfort fizic
Metode de tratament

Tratamentul dietetic

Exerciiul fizic

Tratamentul medicamentos (insulin i/sau ADO)

Educaia specific
Tratamentul dietetic

Locul dietoterapiei n tratamentul DZ

Obiectivele tratamentului nutriional:


- meninerea glicemiei la un nivel ct mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea i tratarea complicaiilor acute i cronice
- creterea calitii vieii printr-o alimentaie adecvat
Recomandrile nutriionale generale pentru
pacientul diabetic

Calorii
Glucide: 55-60 % din aportul caloric
Fibre alimentare: 30-40 g/zi
Lipide: sub 30 % din calorii
Colesterol: < 300 mg/zi
Proteine: 12-15 % din aportul caloric
Sodiu: < 6 g NaCl / zi; la hipertensivi < 3
g NaCl / zi
Alcoolul
Edulcorantele
Vitamine i minerale
Etapele alctuirii unei diete

Precizarea caracteristicilor generale ale dietei


Calculul aportului caloric
Distribuia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
Distribuirea glucidelor pe numrul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
Alegerea alimentelor
Pregtirea corect a alimentelor (reguli de gastrotehnie)
Factori care influeneaz indexul glicemic

Concentraia n glucide a alimentelor


Coninutul de proteine i lipide al alimentelor
Coninutul n fibre alimentare
Prezena de amidon greu digerabil
Mrimea particulelor de amidon
Forma fizic a hranei
Coninutul hidric al alimentelor
Temperatura alimentelor
Prezena inhibitorilor enzimatici naturali, a fitailor i taninelor
Gradul de prelucrare mecanic prin masticaie
Exemple de index glicemic
138% Glucoz
126% Miere
100% Glucoz 100% Pine alb
90-99% Pine integral, piure de
cartofi, biscuii
80-89% Piure de cartofi, morcovi 80-89% Cartofi, banane
70-79% Pine integral, orez, cartofi 70-79% Chips-uri
60-69% Pine alb, banane 60-69% Macaroane, spaghete fierte
15 minute
50-59% Spaghete fierte 5 minute, 50-59% Mere, portocale, mazre
chips-uri
40-49% Mazre, portocale 40-49% Spaghete fierte 5 minute,
lapte
30-39% Lapte, mere 30-39% Fructoz
20-29% Fasole psti, fructoz
10-19% Arahide, soia 10-19% Arahide, soia
Efortul fizic terapeutic - beneficii

Scade glicemia i HbA1c


Amelioreaz profilul lipidic
- TG
- LDL-colesterolul
- HDL-colesterolul
Amelioreaz HTA uoar i moderat
Adjuvant al dietei pentru scderea ponderal
Amelioreaz factorii de risc cardio-vascular
Crete tonusul psihic i calitatea vieii
Efortul fizic terapeutic - riscuri

Hipoglicemie
Hiperglicemie i cetoz la pacienii insulino-deficieni
Precipitarea i exacerbarea bolilor cardio-vasculare (angin
pectoral, infarct de miocard, aritmii, moarte subit)
Agravarea complicaiilor cronice ale DZ
- retinopatie proliferativ: hemoragii vitreene, deslipiri de retin
- nefropatie: proteinuria
- neuropatie periferic: leziuni ale articulaiilor i ale es. moi
- neuropatie vegetativ: scade rspunsul cardio-vascular la
efort, hipotensiune ortostatic
Tratamentul insulinic

Istoric

Nicolae Paulescu
1869 - 1931
Clasificarea insulinelor

Dup provenien - animale


- de tip uman

Dup durata de aciune


- cu aciune ultrarapid (analogi)
- cu durat scurt de aciune
- cu aciune intermediar
- cu durat lung de aciune
- insuline premixate
Insulinemia plasmatic la persoane cu diabet
zaharat tip 1 i subieci sntoi

N=8 Subieci sntoi N=24 DZ1


480 Insulin uman regular
Analog rapid de insulin
400

320
pmol/L
240

160

80

0
07:00 12:00 18:00 24:00 06:00 h
Momentul zilei
Insulina LISPRO Humalog

S S
A-chain 21

1
S
S

S S
1
B28 B29 30
LYS PRO
B-chain
Analogii rapizi de insulin

Glulisine
Analogii de insulin cu aciune lung

Insulina glargine
(lantus)

Insulina detemir
(levemir)
Preparate de insulin
Cu aciune ultrarapid (analogi de insulin):
- NovoRapid
- Humalog
- Apidra
Cu aciune scurt:
- Actrapid HM
- Humulin R
- Insuman Rapid
Cu aciune intermediar:
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal
Cu aciune lung:
- Monotard HM
- Humulin L
Analogi de insulin cu aciune lung:
- Lantus
- Levemir
Insuline premixate:
- Mixtard 10 50 HM (Mixtard 30 HM)
- Humulin M1 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50
Analogi premixai:
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Scheme de insulinoterapie

Convenional

Intensificat
Insulinoterapia intensificat

Insuline prandiale
Insuline bazale
Administrarea insulinei

Cile de administrare

Dispozitivele de administrare

Autocontrolul i ajustarea dozelor

Pompa de insulin

Indicaiile insulinoterapiei
Efectele secundare ale insulinoterapiei

Hipoglicemia
Lipodistrofia
Abcesele la locul injeciei
Alergia la insulin
Producia de anticorpi la preparatele insulinice
Creterea n greutate
Edemul insulinic
Neuropatia dureroas
Scderea acuitii vizuale
Hiperglicemiile matinale

Subinsulinizarea

Fenomenul Somogyi

Fenomenul de zori (Dawn phenomenon)


Tratamentul cu preparate non-insulinice

Medicamente care cresc secreia pancreatic de insulin


- sulfonilureice
- reglatori prandiali ai glicemiei
Medicamente care scad rezistena la insulin
- biguanide
- tiazolidindione
Medicamente care scad absorbia intestinal de glucoz
- inhibitori de alfa-glucozidaz
Incretinele
Inhibitorii de SGLT2
Medicamente care cresc secreia pancreatic
de insulin (secretagoge)
Canalul KATP cu cele dou componente: receptorul
sulfonilureic (SUR 1) i canalul rectificator de K (Kir 6.2)

Ansamblul
canalului

Componenta SUR Componenta Kir 6.2


nchiderea canalului KATP prin
legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1
Preparatele sulfonilureice

Agentul sulfonilureic Preparate comerciale Doza maxim


Generaia I
- tolbutamid Tolbutamid; 500 mg 3000 mg
- clorpropamid Diabinese; 250 mg 500 mg
Generaia a II-a
- glibenclamid Glibenclamid; 5 mg 15 mg
Maninil; 1,75; 3,5 mg 10,5 mg

- glipizid Glucotrol; 5 i 10 mg 10 mg
- gliclazid Diaprel MR; 30 mg 90 mg
- gliquidona Glurenorm; 30 mg 90 mg
Generaia a III-a
- glimepiride Amaryl; 1, 2, 3 i 4 mg 6 mg
Sulfonilureicele
Efecte secundare:
- Hipoglicemia
- Creterea n greutate
- Reacii alergice
- mpiedic precondiionarea ischemic creterea riscului de
IMA?
Alte contraindicaii:
- DZ tip 1 sau alte forme de DZ cu cetoacidoz
- Sarcina i alptarea
- Dezechilibrul glicemic marcat
- Insuficien hepatic, renal (RFG < 30 ml/min)
- Intervenii chirurgicale majore
Reglatorii prandiali ai glicemiei

Acelai mecanism de aciune ca al sulfonilureicelor

Durat scurt de aciune

Risc hipoglicemic redus

O mas o doz, nici o mas nici o doz

Preparate: - Repaglinida (NovoNorm; 0,5 1 2 mg)

- Nateglinida (Starlix)
Medicamente care scad rezistena la insulin
Biguanidele
Mecanism de aciune
- Reduc insulinorezistena (mai ales prin reducerea PHG)
- Amelioreaz captarea periferic a glucozei
- Favorizeaz activitatea GLUT 4 i glicoliza anaerob, inhib
statusul proinflamator i protrombotic, reduc lipoliza etc.
- Posibil ameliorare a RCV i a riscului neoplazic

Preparate:
- fenformin
- metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp
= 500 mg, 850 mg, 1000 mg; doza max. = 3000 mg)
- buformin: Silubin Retard (1 cp = 100 mg; doza max. = 300 mg)
Biguanidele

Efecte secundare:
- Efecte digestive (greuri, vrsturi, dureri abdominale, tulburri
de tranzit, balonri, anorexie)
- Acidoza lactic (doar cnd nu sunt respectate contraindicaiile)
Contraindicaii:
- Insuficien hepatic
- Insuficien renal (RFG < 45/30 ml/min)
- Insuficien cardiac (FE < 45%)
- Insuficien respiratorie
- Investigaii cu substane de contrast iodate (temporar)
- Anestezia general (temporar)
- Altele: deficitul de Vitamina B12, hipersensibilitatea, hipoxia etc.
Tiazolidindionele (glitazonele)

Mecanism de aciune: PPAR (peroxisome proliferator


activated receptors)
Reduc IR (mai ales cea periferic)
Determin redistribuia adipozitii centrale, cu adipogenez
periferic (adipocite mici, insulinosensibile)

Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia)
Tiazolidindionele
Efecte secundare:
- Cretere ponderal
- Retenie hidro-salin
- Agravarea ICC
- Hepatotoxicitate (efect discutabil la TZD noi)
- Creterea riscului de fractur de old
Contraindicaii:
- DZ tip 1
- Sarcin i lactaie
- Afeciuni hepatice active (transaminaze peste 2-3 x v.n.)
- APP de ICC, SCA
- RCV peste 15% la calculul prin soft-ul UKPDS
Medicamente care scad absorbia intestinal
de glucoz

Inhibitorii de alfa-glucozidaz

Mecanism de aciune: inhibarea -glucozidazei intestinale


(dizaharidaz) reducerea i ntrzierea absorbiei intestinale
a glucozei ameliorarea hiperglicemiei postprandiale

Preparate
- acarboza (Glucobay, 1 cp = 50; 100 mg; doza maxim = 300
mg)
- miglitolul
Inhibitorii de -glucozidaz

Efecte secundare:
- Diaree
- Dureri abdominale
- Flatulen

Contraindicaii:
- Sarcin i lactaie
- Afeciuni gastrointestinale (boala Crohn, RCUH)
- BCR avansat
Locurile de aciune ale agenilor
antihiperglicemiani
Sulfonilureice i Tiazolidindione
repaglinida
Stimuleaz secreia de
insulin. Scad rezistena la
Repaglinida insulin
Se administreaz n n esutul adipos i
special la pacienii cu muchi. Scad GNG
glicemii postprandiale
la nivelul ficatului.
crescute.
Inhibitori de glucozidaz Biguanide (metformin)
(acarboza)
Scad rezistena la insulin
ntrzie absorbia intestinal n esutul muscular.
a carbohidrailor. Scad GNG la niv. ficatului.
Incretinele
Secreia de insulin dup administrarea de glucoz
oral / intravenos

oral 200
intravenos
90

D INSULIN (mU/L)
D GLUCOZ (mg/dl)

150
70

50
100

30


10 50



-10

-30 0

0 15 30 45 60 75 90 0 15 30 45 60 75 90
TIME (min) TIME (min)

McIntyre et al, 1964


Efectul incretinic

Ingestia de glucoz determin un rspuns insulinic mai


pronunat dect glucoza administrat intravenos, indicnd
prezena unor substane secretate de tractul
gastrointestinal care stimuleaz eliberarea de insulin
printr-un mecanism glucodependent.

Creutzfeldt. Diabetologia 1985; 28: 565


Definiia incretinelor

Gut-derived factors that increase


glucose-stimulated insulin secretion

In cret in

Intestine Secretion Insulin

Creutzfeldt. Diabetologia 1985; 28: 565


Efectul incretinic la persoanele sntoase
i la pacienii cu diabet zaharat tip 2
Persoane sntoase Pacieni cu DZ tip 2

Oral
IV Oral
Insulin (mU/l)

Insulin (mU/l)
IV

Timp (min) Timp (min)


Incretinele
GLP-1: Glucagon-Like Peptide 1
H A E G T F T S D V S S Y L E G Q A
A
R K L A I F K
G G V W E

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide
A
Y E G T F I S D Y S I A M D K I H
Q
D N K K G K A L L W N V F D Q
W Q
K T Q
H N I

Drucker D. Diabetes Care 2003; 26: 2929


GIP
Gastric inhibitory polypeptide
Glucose-mediated insulinotropic polypeptide

GM: 4984

Eliberare: duoden, jejun, ileonul proximal

Aciuni:
- inhibarea secreiei gastrice acide
- stimularea secreiei de insulin
- aciuni insulin-like asupra metabolismului lipidic
GLP-1
Glucagon-like peptide-1

GM: aprox. 4000

Eliberare: intestinul subire distal, colon

Aciuni:
- stimularea secreiei de insulin
- inhibarea golirii gastrice
- aciuni insulin-like extrapancreatice
- inhibarea apetitului
GLP-1
Glucoza
Celula L

Enterocit
Hipotalamus:
Apetitul

GLP-1

Pancreas:
Stomac:
Insulina
Motilitatea
Glucagonul
GLP-1

Alimente stimuleaz secreia insulinic


indus de glucoz

inhib secreia de glucagon

inhib golirea gastric

Celulele L GLP-1 inhib apetitul

amelioreaz insulinosensibilitatea

n studii experimentale

crete masa -celular

Drucker DJ. Mol Endocrinol 2003; 17:161-171


Metabolism glucidic normal

Glucide alimentare
digestie
absorbie

GIP + + GLP-1

Celula

secreia de insulin euglicemie


Diabet zaharat tip 2

Glucide alimentare

GIP GLP-1

Celula

Secreie de insulin hiperglicemie


Efectul administrrii de GLP-1
n diabetul zaharat tip 2

Glucoz (mg/dl)
300 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 16

Glucose (mmol/l)
250
200 12
Glucoz 150 * 8
100 GLP-1 * *
* * 4
50 Placebo *
p<0.0001 *
0 0
0 60 120 180 240
40 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 250
Insulin (mU/l)

Insulin (pmol/l)
30 200
150
Insulin 20
* * * 100
10 * * * * * 50
p<0.0001
0 0
0 60 120 180 240
20 GLP-1 i.v. (1.2 pmol.kg-1.min-1)
Glucagon (pmol/l)

15

Glucagon 10

5 * * * * p=0.0009
0
0 60 120 180 240
Timp (min)
Nauck M et al. Diabetologia 1993; 36: 741744
GLP-1

Mas
Meal

Eliberare
Intestinalde
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

GLP-1
inactiv
inactive

.
Rothenberg P et al. Diabetes 2000; 49 (suppl.1): A39
Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

Inhibitori de DPP-4

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
Exenatida (Byetta)

Gila monster (Heloderma


suspectum)
Aprobat de FDA (2005) i de
EMEA (2006) pt. trat. DZ 2
Capt C-terminal bogat n
reziduuri de prolin
Aciune de 10 ori mai intens
dect a GLP-1 nativ
T1/2 mai lung
GLP-1 i Exenatida

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402


Exenatida (Byetta)

Indicat n tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice
metformin + TZD

Doza iniial: 5 g x 2/zi

Adm. sc cu 60 min. naintea meselor principale

Dup o lun, doza se poate crete la 10 g x 2/zi


Liraglutida

Derivat acil al GLP-1

Adugarea unei grupri


de acizi grai activeaz
legarea de albuminele
plasmatice ntrzie
eliminarea renal

T1/2 ~ 12 ore

Administrare injectabil o
singur dat pe zi

Knudsen L et al. J Med Chem 2000; 43: 1664-1669


Soluii farmacologice

GLP-1 uman recombinant infuzie s.c. continu

Agoniti de receptor GLP-1

- Exenatida (Byetta, Bydureon)


- Liraglutida

Inhibitori de DPP-IV

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
GLP-1

Mas
Meal
Eliberare
Intestinalde
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

Inhibitor de
DPP-4 GLP-1
inactiv
inactive

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39


Inhibitori de DPP-4

Sitagliptina (Januvia)
- inhibitor competitiv, reversibil i nalt selectiv al DPP-4
- aprobat de FDA (2006) i de ANM (2007) pt. trat. DZ 2

Saxagliptina (Onglyza)
Sitagliptina (Januvia)

Indicat n tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice

Doza recomandat: 100 mg/zi (doz unic), indiferent de


orarul meselor
Efecte adverse ale incretinelor

Agonitii de receptor de GLP-1


- greuri i vrsturi (50% dintre pacieni)
- dependente de doz
- se amelioreaz pe parcursul tratamentului
- diaree
- hipoglicemii uoare i moderate (cnd se asociaz cu SU)

Inhibitorii de DPP-4
- cefalee
- susceptibilitate pentru infecii de ci aeriene superioare
Inhibitorii SGLT-2
Filtrarea glomerular

Arteriola aferent

H2O
Glucoza

Na+, Cl-, K+, HCO3-

Amino
acizi
Creatinina
Uree

Capsula Bowman

Arteriola eferent
Reabsorbia la nivelul tubului contort proximal

Arteriola aferent Glucoza


Na+ Cl-,
K+,
H2O Amino
HCO3-
acizi

Tub contort proximal


Capsula Bowman
Arteriola eferent
Reabsorbia la nivelul tubului contort proximal

Majoritatea glucozei
este reabsorbit de
ctre SGLT2 (90%)

Tub contort proximal

Glucoza
Glucoz restant este Excreie a
reabsorbit de glucozei
ctre SGLT1 minim pn
(10%) la absent
Filtrarea glucozei
Inhibitorii SGLT2: O abordare inovativ, insulin-independent,
de eliminare a excesului de glucoz
Reabsorbie
Reduced glucose SGLT2
sczut a glucozei
reabsorption

Inhibitor SGLT2

Proximal tubule
Tub contort
proximal

Inhibitor
Excreie urinar
Increased urinary
SGLT2 crescut of
excretion a glucozei
excess
SGLT2 n exces ( 70 g/zi,
glucose (~70 g/day,
corespunztorto280
corresponding
Filtrarea kcal/zi*)
Glucose 280 kcal/day*)
glucozei

Inhibitorii SGLT2 inhib n mod selectiv SGLT2


la nivelul tubului contort proximal

70g/zi
glucoza
Inhibitorii SGLT2: O abordare inovativ, insulin-
independent, de eliminare a excesului de glucoz

Scderi semnificative ale HbA1c

ELIMINARE
70g/zi
Pierderea a 280 kcal/zi Scdere ponderal
glucoza

Creterea volumului
urinar cu 375ml/zi Scderea tensiunii arteriale
Dapagliflozina

Beneficii
- scderea HbA1c
- scdere ponderal
- scderea TA

Efecte adverse
- risc crescut pentru infecii urinare i genitale?
- risc de deshidratare i hipovolemie?
- risc de agravare a BCR / inducere a IRA prin deshidratare
Algoritmul de tratament n DZ 2

Dieta i exerciiul fizic

Antidiabetice orale

Asocieri de antidiabetice orale

Insulin antidiabetice orale


Preparate combinate de ADO
Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg
5 mg/500 mg

Preparate combinate TZD + metformin


Competact 15 mg/850 mg

Preparate combinate inhibitori DPP-4 + metformin


Janumet 50 mg/850 mg
50 mg/1000 mg
Komboglyze 2,5 mg/1000 mg
Individualizarea terapiei n DZ tip 2

Approach to the management


of hyperglycemia
Tinte mai ambitioase more
Tinte mai putin ambitioase HbA1c less
stringent 7% stringent
PATIENT / DISEASE FEATURES Atitudine pacienti
Risks potentially associated
Pacienti motivati Pacienti mai putin
low motivati high
with hypoglycemia and
other drug adverse effects

Scazut Disease duration Crescut


newly diagnosed long-standing
Durata bolii
Scurta Lunga Usually not
modifiable
Life expectancy
long
Speranta de viata short
Lunga Scurta
Comorbiditati
Absente Important comorbidities
absent Severe few / mild severe

Complicatii CV
Absente Established vascular Severe
complications absent
Resursefew / mild severe

Disponibile Absente

Patient attitude and


expected
Adaptat dupa: Ismail-Beigi, et al. Ann Intern treatment
Med 2011;154:5549; efforts
Inzucchi highly
SE, et al. Diabetes Caremotivated, adherent,
2012;35:136479. less motivated, non-adherent, Potentially
excellent self-care capacities poor self-care capacities modifiable

Resources and support


Readily available limited
system
Healthy eating, weight control, increased physical activity & diabetes education
Mono-
therapy Metformin
Efficacy* high
Hypo risk low risk
Weight neutral/loss
Side effects GI / lactic acidosis
Costs low
If HbA1c target not achieved after ~3 months of monotherapy, proceed to 2-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):
Metformin Metformin Metformin Metformin Metformin Metformin
+ + + + + +
Dual Sulfonylurea Thiazolidine- DPP-4 SGLT2 GLP-1 receptor Insulin (basal)
therapy dione inhibitor inhibitor agonist
Efficacy* high high intermediate intermediate high highest
Hypo risk moderate risk low risk low risk low risk low risk high risk
Weight gain gain neutral loss loss gain
Side effects hypoglycemia edema, HF, fxs rare GU, dehydration GI hypoglycemia
Costs low low high high high variable

If HbA1c target not achieved after ~3 months of dual therapy, proceed to 3-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):
Metformin Metformin Metformin Metformin Metformin Metformin
+ + + + + +
Triple Sulfonylurea Thiazolidine-
dione
DPP-4
Inhibitor
SGLT-2
Inhibitor
GLP-1 receptor
agonist
Insulin (basal)
therapy + + + + + +
TZD SU SU SU SU TZD

or DPP-4-i or DPP-4-i or TZD or TZD or TZD or DPP-4-i

or SGLT2-i or SGLT2-i or SGLT2-i or DPP-4-i or Insulin or SGLT2-i

or GLP-1-RA or GLP-1-RA or Insulin or Insulin or GLP-1-RA


or Insulin or Insulin

If HbA1c target not achieved after ~3 months of triple therapy and patient (1) on oral combination, move to injectables, (2) on GLP-1 RA, add
basal insulin, or (3) on optimally titrated basal insulin, add GLP-1-RA or mealtime insulin. In refractory patients consider adding TZD or SGL T2-i:
Metformin
+
Combination
injectable Basal Insulin + Mealtime Insulin or GLP-1-RA
therapy
Healthy eating, weight control, increased physical activity & diabetes education
Mono-
therapy Metformin
Efficacy* high
Hypo risk low risk
Weight neutral/loss
Side effects GI / lactic acidosis
Metformin Costs low

intolerance or If HbA1c target not achieved after ~3 months of monotherapy, proceed to 2-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):
contraindication Metformin Metformin Metformin Metformin Metformin Metformin
+ + + + + +
Dual Sulfonylurea Thiazolidine- DPP-4 SGLT2 GLP-1 receptor Insulin (basal)
therapy dione inhibitor inhibitor agonist
Efficacy* high high intermediate intermediate high highest
Hypo risk moderate risk low risk low risk low risk low risk high risk
HbA1c Weight gain gain neutral loss loss gain
9% Side effects hypoglycemia edema, HF, fxs rare GU, dehydration GI hypoglycemia
Costs low low high high high variable

If HbA1c target not achieved after ~3 months of dual therapy, proceed to 3-drug combination (order not meant to denote
any specific preference - choice dependent on a variety of patient- & disease-specific factors):
Metformin Metformin Metformin Metformin Metformin Metformin
+ + + + + +
Triple Sulfonylurea Thiazolidine-
dione
DPP-4
Inhibitor
SGLT-2
Inhibitor
GLP-1 receptor
agonist
Insulin (basal)
therapy + + + + + +
TZD SU SU SU SU TZD

or DPP-4-i or DPP-4-i or TZD or TZD or TZD or DPP-4-i

or SGLT2-i or SGLT2-i or SGLT2-i or DPP-4-i or Insulin or SGLT2-i


Uncontrolled or GLP-1-RA or GLP-1-RA or Insulin or Insulin or GLP-1-RA
hyperglycemia
(catabolic or Insulin or Insulin
features,
BG 300-350 mg/dl, If HbA1c target not achieved after ~3 months of triple therapy and patient (1) on oral combination, move to injectables, (2) on GLP-1 RA, add
basal insulin, or (3) on optimally titrated basal insulin, add GLP-1-RA or mealtime insulin. In refractory patients consider adding TZD or SGL T2-i:
HbA1c 10-12%) Metformin
+
Combination
injectable Basal Insulin + Mealtime Insulin or GLP-1-RA
therapy