Sunteți pe pagina 1din 125

Tratamentul diabetului zaharat

• DZ este o boală cronică

• Obiectivul principal: menţinerea parametrilor clinici şi


biochimici specifici cât mai aproape de normal

• Tratamentul trebuie privit în perspectiva speranţei de


viaţă
Prevenţia primară a DZ tip 1
• Promovarea alimentării copilului la sân
• Evitarea bolilor infecţioase cu potenţial diabetogen
• Evitarea substanţelor toxice pancreatotrope
• Măsuri farmacologice

Prevenţia primară a DZ tip 2


• Controlul greutăţii
• Promovarea activităţii fizice
• Diete bogate în fibre şi sărace în grăsimi
• Măsuri farmacologice
Prevenţia secundară – prevenirea apariţiei
complicaţiilor
• Diagnostic precoce
• Controlul glicemiei (HbA1c)
• Tratamentul factorilor de risc vascular (obezitate,
dislipidemie, hipertensiune)
• Evitarea fumatului
• Detectarea complicaţiilor cronice în stadiul subclinic

Prevenţia terţiară
• Tratamentul activ al complicaţiilor cronice
• Evitarea complicării complicaţiilor
Criteriile unui bun control metabolic

• Glicemia preprandială: 80-110 mg/dl


• Glicemia postprandială: 100-145 mg/dl
• HbA1c: < 6,5 %
• Colesterol total: < 200 mg/dl
• Trigliceride a jeun: < 150 mg/dl
• TA < 130 / 80 mm Hg (120 / 70 mm Hg)
• IMC < 25 kg/m2 (B);
< 24 kg/m2 (F)
Metode de tratament

• Tratamentul dietetic

• Exerciţiul fizic

• Tratamentul medicamentos (insulină şi/sau ADO)

• Educaţia specifică
Tratamentul dietetic

• Locul dietoterapiei în tratamentul DZ

• Obiectivele tratamentului nutriţional:


- menţinerea glicemiei la un nivel cât mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea şi tratarea complicaţiilor acute şi cronice
- creşterea calităţii vieţii printr-o alimentaţie adecvată
Recomandările nutriţionale generale pentru
pacientul diabetic

• Calorii
• Glucide: 55-60 % din aportul caloric
• Fibre alimentare: 30-40 g/zi
• Lipide: sub 30 % din calorii
• Colesterol: < 300 mg/zi
• Proteine: 12-15 % din aportul caloric
• Sodiu: < 6 g NaCl / zi; la hipertensivi < 3 g NaCl / zi
• Alcoolul
• Edulcorantele
• Vitamine şi minerale
Etapele alcătuirii unei diete

• Precizarea caracteristicilor generale ale dietei


• Calculul aportului caloric
• Distribuţia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
• Distribuirea glucidelor pe numărul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
• Alegerea alimentelor
• Pregătirea corectă a alimentelor (reguli de gastrotehnie)
Efortul fizic terapeutic - beneficii

• Scade glicemia şi HbA1c


• Ameliorează profilul lipidic
-  TG
-  LDL-colesterolul
-  HDL-colesterolul
• Ameliorează HTA uşoară şi moderată
• Adjuvant al dietei pentru scăderea ponderală
• Ameliorează factorii de risc cardio-vascular
• Creşte tonusul psihic şi calitatea vieţii
Efortul fizic terapeutic - riscuri

• Hipoglicemie
• Hiperglicemie după eforturi fizice foarte intense
• Hiperglicemie şi cetoză la pacienţii insulino-deficienţi
• Precipitarea şi exacerbarea bolilor cardio-vasculare (angină
pectorală, infarct de miocard, aritmii, moarte subită)
• Agravarea complicaţiilor cronice ale DZ
- retinopatie proliferativă: hemoragii vitreene, deslipiri de retină
- nefropatie:  proteinuria
- neuropatie periferică: leziuni ale articulaţiilor şi ale ţes. moi
- neuropatie vegetativă: scade răspunsul cardio-vascular la
efort, hipotensiune ortostatică
Tratamentul insulinic
Principalele etape în dezvoltarea
insulinoterapiei

• Descoperirea insulinei (1921)


• Insuline "clasice" (convenţionale) (1922)
• Insuline cu acţiune prelungită (1936)
• Insuline NPH (1950)
• Insuline înalt purificate (monocomponent) (1978)
• Insuline umane (1982)
• Analogi de insulină (1996)
Clasificarea insulinelor

• După provenienţă - animale


- de tip uman

• După durata de acţiune


- cu durată scurtă de acţiune
- cu acţiune intermediară
- cu durată lungă de acţiune
- insuline premixate
Insulina LISPRO Humalog®

S S
A-chain 21

1
S
S

S S
1
B28 B29 30
LYS PRO
B-chain
Analogii rapizi de insulină

Glulisine
Analogii de insulină cu acţiune lungă

Insulina glargine
(lantus)

Insulina detemir
(levemir)
Preparate de insulină

• Cu acţiune scurtă
- Actrapid HM
- Humulin R
- Insuman Rapid
• Cu acţiune intermediară
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal
• Cu acţiune lungă
- Monotard HM
- Humulin L
Analogi de insulină

• Analogi de insulină cu acţiune (ultra)rapidă


- NovoRapid
- Humalog
- Apidra

• Analogi de insulină cu acţiune lungă


- Lantus
- Levemir
• Insuline premixate
- Mixtard 10 – 50 HM (Mixtard 30 HM)
- Humulin M1 – 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50

• Analogi premixaţi
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Scheme de insulinoterapie

• Convenţională

• Intensificată
Administrarea insulinei

• Căile de administrare

• Dispozitivele de administrare

• Autocontrolul şi ajustarea dozelor

• Pompa de insulină

• Indicaţiile insulinoterapiei
Indicaţiile insulinoterapiei
în diabetul zaharat tip 2

• Menţinerea dezechilibrului glicemic în ciuda dozelor


maxime de agenţi orali combinaţi
• Hiperglicemie cu cetonemie şi cetonurie
• Decompensarea generată de evenimente intercurente
• Managementul perioperator
• Sarcina şi lactaţia
• Hepatopatii şi/sau nefropatii
• Alergia sau alte reacţii adverse serioase la ADO
• Hiperglicemii importante în momentul prezentării
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Hipovolemia indusă de insulină
• Creşterea în greutate
• Reacţii induse de anticorpii antiinsulină
• Lipodistrofia
• Abcesele la locul injecţiei
• Edemul insulinic
• Neuropatia indusă de insulină
• “Înceţoşarea vederii”
• Agravarea retinopatiei diabetice
• Efecte adverse ale insulinei inhalatorii
Hiperglicemiile matinale

• Subinsulinizarea

• Fenomenul Somogyi

• Fenomenul de zori (Dawn phenomenon)


Tratamentul cu preparate non-insulinice

• Medicamente care cresc secreţia pancreatică de insulină


- sulfonilureice
- reglatori prandiali ai glicemiei

• Medicamente care scad rezistenţa la insulină


- biguanide
- tiazolidindione

• Medicamente care scad absorbţia intestinală de glucoză


- inhibitori de alfa-glucozidază

• Incretinele
Medicamente care cresc secreţia pancreatică
de insulină (secretagoge)
Canalul KATP cu cele două componente: receptorul
sulfonilureic (SUR 1) şi canalul rectificator de K (Kir 6.2)

Ansamblul
canalului

Componenta SUR Componenta Kir 6.2


Închiderea canalului KATP prin
legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1
Preparatele sulfonilureice

Agentul sulfonilureic Preparate comerciale Doza maximă


Generaţia I
- tolbutamid Tolbutamid; 500 mg 3000 mg
- clorpropamid Diabinese; 250 mg 500 mg
Generaţia a II-a
- glibenclamid Glibenclamid; 5 mg 15 mg
Maninil; 1,75; 3,5 mg 10,5 mg

- glipizid Glucotrol; 5 şi 10 mg 10 mg
- gliclazid Diaprel MR; 30 mg 120 mg
- gliquidona Glurenorm; 30 mg 90 mg
Generaţia a III-a
- glimepiride Amaryl; 1, 2, 3 şi 4 mg 6 mg
Reglatorii prandiali ai glicemiei

• Acelaşi mecanism de acţiune ca al sulfonilureicelor

• Durată scurtă de acţiune

• Risc hipoglicemic redus

• “O masă o doză, nici o masă nici o doză”

• Preparate: - Repaglinida (NovoNorm; 0,5 – 1 – 2 mg)

- Nateglinida (Starlix)
Medicamente care scad rezistenţa la insulină
Biguanidele
• Mecanism de acţiune
• Efecte adverse
• Contraindicaţii
• Preparate:
- fenformin
- metformin: Meguan, Siofor, Metfogamma, Metformin,
Glucophage (1 cp = 500 mg, 850 mg, 1000 mg; doza
maximă = 3000 mg)
- buformin: Silubin Retard
(1 cp = 100 mg; doza maximă = 300 mg)
Tiazolidindionele (glitazonele)

• Mecanism de acţiune: PPAR  (peroxisome proliferator


activated receptors)

• Efecte adverse

• Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia) – nu se mai foloseşte)
Medicamente care scad absorbţia intestinală
de glucoză

Inhibitorii de alfa-glucozidază

• Mecanism de acţiune

• Efecte adverse

• Preparate
- acarboza (Glucobay, 1 cp = 50; 100 mg; doza maximă =
300 mg)
- miglitolul
Incretinele
Secreţia de insulină după administrarea de glucoză
oral / intravenos

oral 200
intravenos 
90

D INSULINĂ (mU/L)
D GLUCOZĂ (mg/dl)

  150 
70 
  
50 
   100
 
30
 
    
10  50 

  

-10 
 
-30 0
 
0 15 30 45 60 75 90 0 15 30 45 60 75 90
TIME (min) TIME (min)

McIntyre N. Lancet 1964; 2: 20-21


Efectul incretinic

“Ingestia de glucoză determină un răspuns insulinic mai


pronunţat decât glucoza administrată intravenos, indicând
prezenţa unor substanţe secretate de tractul
gastrointestinal care stimulează eliberarea de insulină
printr-un mecanism glucodependent.”

Creutzfeldt. Diabetologia 1985; 28: 565


Definiţia incretinelor

“Gut-derived factors that increase


glucose-stimulated insulin secretion”

In cret in
● ●

Intestine Secretion Insulin


Efectul incretinic la persoanele sănătoase
şi la pacienţii cu diabet zaharat tip 2
Persoane sănătoase Pacienţi cu DZ tip 2

Oral
IV Oral
Insulină (mU/l)

Insulină (mU/l)
IV

Timp (min) Timp (min)


Incretinele
GLP-1: Glucagon-Like Peptide 1
H A E G T F T S D V S S Y L E G Q A
A
R K L A I F K
G G V W E

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide
A
Y E G T F I S D Y S I A M D K I H
Q
D N K K G K A L L W N V F D Q
W Q
K T Q
H N I
GIP
“Gastric inhibitory polypeptide”
“Glucose-mediated insulinotropic polypeptide”

GM: 4984

Eliberare: duoden, jejun, ileonul proximal

Acţiuni:
- inhibarea secreţiei gastrice acide
- stimularea secreţiei de insulină
- acţiuni insulin-like asupra metabolismului lipidic
GLP-1
“Glucagon-like peptide-1”

GM: aprox. 4000

Eliberare: intestinul subţire distal, colon

Acţiuni:
- stimularea secreţiei de insulină
- inhibarea golirii gastrice
- acţiuni insulin-like extrapancreatice
- inhibarea apetitului
GLP-1
Glucoza
Celula L

Enterocit
Hipotalamus:
 Apetitul

GLP-1

Pancreas:
Stomac:
 Insulina
 Motilitatea
 Glucagonul
GIP vs. GLP-1

GIP GLP-1
42 aa 30-31 aa
Celulele K → duoden Celulele L → ileon +
colon
↑ Secreţia de insulină ↑ Secreţia de insulină
Efect minim asupra golirii gastrice ↓ Golirea gastrică
Efect nesemnificativ asupra ↓ Secreţia de glucagon
secreţiei de glucagon
Efect nesemnificativ asupra ↓ Apetitul şi greutatea
saţietăţii şi greutăţii corporale corporală
↑ Masa -celulară ↑ Masa -celulară
Efectul administrării de GLP-1
în diabetul zaharat tip 2

Glucoză (mg/dl)
300 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 16

Glucose (mmol/l)
250
200 12
Glucoză 150 * 8
100 GLP-1 * *
* * 4
50 Placebo *
p<0.0001 *
0 0
0 60 120 180 240
40 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 250
Insulină (mU/l)

Insulin (pmol/l)
30 200
150
Insulină 20
* * * 100
10 * * * * * 50
p<0.0001
0 0
0 60 120 180 240
20 GLP-1 i.v. (1.2 pmol.kg-1.min-1)
Glucagon (pmol/l)

15

Glucagon 10

5 * * * * p=0.0009
0
0 60 120 180 240
Timp (min)
GLP-1

Masă
Meal

Eliberare
Intestinalde
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

GLP-1
inactiv
inactive

.
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

• Inhibitori de DPP-4
Exenatida (Byetta)

• Gila monster (Heloderma suspectum)

• Aprobat de FDA (2005) şi de EMEA (2006) pt. trat. DZ 2

• Capăt C-terminal bogat în reziduuri de prolină

• Acţiune de 10 ori mai intensă decât a GLP-1 nativ

• T1/2 mai lung


GLP-1 şi Exenatida

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida
Exenatida (Byetta)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice
metformin + TZD

• Doza iniţială: 5 g x 2/zi

• Adm. sc cu (până la) 60 min. înaintea meselor principale

• După o lună, doza se poate creşte la 10 g x 2/zi


Liraglutida

• Derivat acil al GLP-1

• Adăugarea unei grupări


de acizi graşi  activează
legarea de albuminele
plasmatice  întârzie
eliminarea renală

• T1/2 ~ 12 ore

• Administrare injectabilă o
singură dată pe zi
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1

- Exenatida (Byetta)
- Liraglutida

• Inhibitori de DPP-IV
GLP-1

Masă
Meal
Eliberare
Intestinalde
GLP-1
GLP-1
intestinal
release

Active
GLP-1 activ
GLP-1

DPP-4

Inhibitor de
DPP-4 GLP-1
inactiv
inactive
Inhibitori de DPP-4

• Sitagliptina (Januvia)
- inhibitor competitiv, reversibil şi înalt selectiv al DPP-4
- aprobată de FDA (2006) şi de ANM (2007) pt. trat. DZ 2

• Vildagliptina (Glavus)
- se leagă de DPP-4  complex inactiv
Sitagliptina (Januvia)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice

• Doza recomandată: 100 mg/zi (doză unică), indiferent de


orarul meselor
Efecte non-glicemice ale incretinelor

• Analogii de GLP-1
- scădere în greutate progresivă şi dependentă de doză
- uşoară reducere a LDL-colesterolului
- ameliorare a funcţiei ventriculare la pacienţii post-IM

• Inhibitorii de DPP-4
- efecte neutre asupra greutăţii
- uşoară reducere a TG şi o creştere a HDL-colesterolului
Efecte adverse ale incretinelor

• Analogii de GLP-1
- greţuri şi vărsături (50% dintre pacienţi)
- dependente de doză
- se ameliorează pe parcursul tratamentului
- diaree
- hipoglicemii uşoare şi moderate (când se asociază cu SU)

• Inhibitorii de DPP-4
- cefalee
- susceptibilitate  pentru infecţii de căi aeriene superioare
Algoritmul de tratament în DZ 2

• Dieta şi exerciţiul fizic

• Antidiabetice orale

• Asocieri de antidiabetice orale

• Insulină ± antidiabetice orale


ADA/EASD Ghid (2006)
Lifestyle + metformin

If HbA1c  7%

Add Add basal Add


sulphonylurea insulin glitazone

If HbA1c  7%

Add Add basal Intensify Add basal Add


glitazone insulin insulin insulin sulphonylurea

If HbA1c  7%

Further intensify insulin or add basal


insulin + metformin ± insulin sensitiser
Bailey C et al. Br J Diabetes Vas Dis 2006; 6: 147–148.
Preparate combinate de ADO

• Preparate combinate glibenclamid + metformin


Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg
5 mg/500 mg
• Preparate combinate TZD + metformin
Competact 15 mg/850 mg

• Preparate combinate inhibitori DPP-4 + metformin


Janumet 50 mg/850 mg
50 mg/1000 mg
Dislipidemiile
Definirea termenilor

• Dislipidemii

• Hiperlipidemii

• Valorile normale
- colesterol seric total < 190 mg/dl (< 5 mmol/l)
- trigliceride serice < 180 mg/dl (< 2 mmol/l)
- colesterol - HDL > 40 mg/dl (> 1 mmol/l)
- colesterol - LDL < 115 mg/dl (< 3 mmol/l)

• Obiectivele terapeutice
Importanţa dislipidemiilor

• Impactul epidemiologic
- boli populaţionale
- în România: 55% din populaţia între 20 şi 60 ani

• Impactul biologic: risc cardio-vascular


risc de pancreatită acută

• Impactul economic
Lipoproteinele

• Asocieri moleculare dintre diferite componente lipidice


sanguine (TG, colesterol, fosfolipide, AG) şi proteinele
circulante
• Constituite din:
- partea transportată: AG esterificaţi sub formă de TG şi
esteri de colesterol
- transportorul: apoproteine
• Rolul apoproteinelor:
- structural
- funcţional: legarea de receptori
activarea sau inhibarea unor enzime
(LPL, LCAT)
Clase majore lipoproteice

• Chilomicronii – 90% TG

• VLDL – 60% TG, 12% colesterol

• IDL – forme tranzitorii; 30% colesterol, 40% TG

• LDL – 60% colesterol


- fenotip A
- fenotip B
- fenotip intermediar

• HDL
Clasificarea dislipidemiilor (Frederickson)

• Tipul I – chilomicronemie bazală


• Tipul IIa – hiper - LDL
• Tipul IIb – hiper - LDL şi hiper - VLDL
• Tipul III – cu IDL în condiţii bazale
• Tipul IV – hiper VLDL
• Tipul V – chilomicronemie bazală + hiper - VLDL

• Tipul VI – hiper - HDL


Clasificarea dislipidemiilor
(Asociaţia Europeană de ateroscleroză)

Forma de dislipidemie Colesterol Trigliceride


Hipercolesterolemie
- de graniţă 190-249 < 180
- moderată 250-300 < 180
- severă > 300 < 180
Hipertrigliceridemie
- moderată < 190 180-400
- severă < 190 > 400
Hiperlipidemie mixtă
- moderată 190-300 180-400
- severă > 300 > 400
Etiopatogenia dislipidemiilor

• Factori genetici
- defect cromozomial monogenic (ex. HLP tip IIa)
- defect cromozomial poligenic

• Factori câştigaţi
- excesele alimentare
- abuzul de alcool
- fumatul
- sedentarismul
- stress-ul
- obezitatea
- diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic
- unele medicamente: corticoizii, contraceptivele orale
Mecanisme patogenetice

• Creşterea sintezei sau producţiei lipoproteice


- dietă hipercalorică, hiperlipidică, hipercolesterolică,
bogată în glucide simple   fluxul de AGL spre ficat 
  VLDL   IDL şi LDL

• Diminuarea catabolismului lipoproteic


-  activităţii LPL  hiperchilomicronemie şi/sau  VLDL
- absenţa receptorilor LDL sau  activităţii lor   LDL
- anomalii ale Apo E  IDL nu mai sunt recunoscute de
receptorii LDL  hiperlipidemia mixtă severă

• Combinarea mai multor factori şi mecanisme de


producere
Tablou clinic

• Xantoame – de tip eruptiv, tendinos, tuberos, palmar


• Xantelasma
• Arc cornean
• Lipemia retinalis
• Dureri abdominale, manifestări de pancreatită
• Manifestări ale ATS cerebrale, coronariene şi periferice
• Simptome osteo-articulare (rar)
Investigaţii paraclinice

• Aprecierea aspectului plasmei sau serului după 24 de


ore de la recoltare şi păstrare la frigider (+ 40C)
• Dozarea colesterolului total şi a TG
• Dozarea HDL-colesterolului
• Calculul LDL-colesterolului (formula lui Friedwald):
LDL-col = colesterol total – HDL-col – TG/5 (mg/dl)
LDL-col = colesterol total – HDL-col – TG/2,2 (mmol/l)
Condiţie: TG < 400 mg/dl
• Alte metode (electroforeza, ultracentrifugarea, dozarea
apoproteinelor)
Depistarea dislipidemiilor

• Ideal: screening sistematic la întreaga populaţie cu


vârsta > 20 ani

• Practic: la grupele cu risc crescut


Grupele cu risc crescut la care se recomandă
depistarea dislipidemiilor

1. Bolnavi cu boli cardio-vasculare aterosclerotice

2. Persoane cu factori de risc cardiovascular

3. Persoane cu arc cornean sau xantomatoză

4. Rudele de gradul I ale persoanelor de la punctele 1 şi 2


• Depistarea completă
- determinarea CT, TG, HDL-col
- recoltare dimineaţa, după 8-12 ore de post
- recomandată la persoane cu boli cardio - vasculare ATS
DZ
xantomatoză

• Depistarea parţială
- determinarea doar a colesterolului total
- recoltare în orice moment al zilei
- recomandată la persoanele care au şi alţi factori de risc
rudele de gradul I ale celor cu BCV ATS
alte persoane care se prezintă la consultaţie
Dislipidemiile aterogene

• Hipercolesterolemie de graniţă (190-249 mg/dl)

• Hipertrigliceridemie > 180 mg/dl

• Scăderea colesterolului HDL < 40 mg/dl la bărbaţi

< 50 mg/dl la femei

• Modificarea LDL care devin mici şi dense


Dislipidemiile secundare

• Hipercolesterolemii – hipotiroidie, colestază, sindrom


nefrotic, sarcină, medicaţie cu tiazide şi progesteron

• Hipertrigliceridemie – DZ necontrolat, sindrom nefrotic,


insuficienţă renală cronică, paraproteinemie

• Hiperlipidemie mixtă – DZ necontrolat, sindrom nefrotic,


medicaţie cu tiazide, corticosteroizi, progestageni
Complicaţii şi asocieri morbide

• Patologia cardio-vasculară aterosclerotică

• Pancreatita acută

• Diabetul zaharat

• Obezitatea

• Hipertensiunea arterială

• Sindromul X metabolic
Management-ul dislipidemiilor

• Stabilirea obiectivelor

• Optimizarea stilului de viaţă

- dieta hipolipidică

- exerciţiul fizic

• Tratamentul medicamentos
Principiile dietei hipolipidice

• Adaptarea aportului caloric în funcţie de necesităţi şi


greutatea corporală
• Reducerea aportului caloric provenit din lipide < 30%
• Scăderea lipidelor saturate la 1/3 din totalul lipidelor
• Lipidele mononesaturate şi cele polinesaturate (forma “cis”)
vor reprezenta baza aportului lipidic (câte 1/3)
• Scăderea aportului de colesterol < 300 mg/zi
• Creşterea aportului de glucide complexe (50-55%)
• Fibrele alimentare – 20-30 g/zi
• Glucidele simple – 10% din necesarul caloric
• Alcoolul va fi suspendat sau mult limitat
• Evitarea fumatului
• Dieta trebuie “negociată” cu pacientul
• Control la 3 luni
• Scade colesterolul cu 10-20%

Exerciţiul fizic

• Scade trigliceridele
• Creşte HDL-colesterolul
Tratamentul medicamentos

Rezinele (Colestiramina)

• Mecanism de acţiune
- blochează circuitul enterohepatic al acizilor biliari
- activează transformarea colesterolului în acizi biliari
- stimulează captarea LDL pe calea receptorilor LDL
• Efecte secundare - disconfort abdominal, constipaţie,
diaree, creşterea TG,  absorbţiei altor medicamente
• Contraindicaţii - obstrucţie biliară completă, ulcer peptic,
sarcină
• Monitorizare - leucocite
Acidul nicotinic şi derivaţii (Acipimox)
• Mecanism de acţiune
- inhibă eliberarea AG din depozite
-  sinteza şi secreţia de VLDL
• Efecte secundare - prurit, greţuri, congestia feţei, vărsături
• Contraindicaţii - insuficienţă hepatică, infarct miocardic
recent, cardiopatie congestivă, gută, sarcină, ulcer gastric
• Monitorizare - glicemie, teste funcţionale hepatice, acid uric

Uleiul de peşte
• Conţine AG polinesaturaţi omega 3
• Inhibă sinteza şi secreţia de VLDL
Fibraţii

• Mecanism de acţiune
- PPAR  exprimarea genei LPL
exprimarea genei Apo A I şi Apo A II
diminuarea genei Apo C
 activează LPL
stimulează catabolismul LDL şi VLDL
inhibă lipoliza TG din adipocite
 concentraţia LDL mici şi dense
 HDL de volum crescut
 hiperlipemia postprandială
 fibrinogenul  efect antitrombogen
• Efecte secundare - disconfort abdominal, greţuri, erupţii,
mialgii (miopatie),  efectul anticoagulantelor

• Contraindicaţii - insuficienţă hepatică, renală, sindrom


nefrotic, sarcină, alăptare

• Monitorizare - teste funcţionale hepatice, creatin-kinaza

• Preparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil


Statinele

• Mecanism de acţiune
- inhibă HMG-CoA reductaza, deci sinteza colesterolului
-  sinteza receptorilor LDL, deci catabolizarea acestuia
-  procentul de LDL mici şi dense
-  oxidabilitatea LDL
-  fibrinogenul, Lp(a), PAI-1  efecte favorabile pe
sistemul de coagulare-fibrinoliză

• Efecte secundare – flatulenţă,  enzimelor hepatice şi


musculare, erupţii
• Contraindicaţii – boli hepatice active, sarcină, alăptare

• Monitorizare - teste funcţionale hepatice, creatin-kinaza

• Preparate - rosuvastatin, atorvastatin, simvastatin,


pravastatin, lovastatin, fluvastatin
Indicaţii de utilizare a claselor de
hipolipemiante

Tipul de hiperlipidemie Prima alegere Alternativă

Hipercolesterolemie Statine Rezine, acid


nicotinic, fibraţi
Hipertrigliceridemie Fibraţi Acid nicotinic, ulei
de peşte
Hiperlipidemie mixtă Fibraţi, statine Acid nicotinic

Asocieri medicamentoase recomandate


• Colestiramină + statine
• Fibraţi + statine
Obezitatea
• Definiţie - obezitatea este o boală caracterizată prin
creşterea greutăţii corporale pe seama ţesutului adipos

• Etimologie - “obedo-obedere” (lat) = “a mânca în


exces”, “a mânca mult şi lacom”

• Prevalenţă - în lume > 250 milioane obezi


- în 2025 > 300 milioane obezi
Obezitatea
problemă majoră de sănătate publică

• Prevalenţă crescută la nivel populaţional

• Costuri directe şi indirecte ridicate implicate de îngrijirea


obezităţii

• Complicaţii multiple
Formule de calcul a greutăţii ideale

• Formula lui Broca: GI = I – 100

• Formula lui Lorentz: GI = (I – 100) – (I – 150)/4 (B)


GI = (I - 100) – (I – 150)/2 (F)

• Formula Societăţii Asigurărilor Metropolitane din New York:


GI = 50 + 0,75(I – 150) + (V – 20)/4 (B)
F: GI (B) X 0,9
Indici de apreciere a obezităţii

• Indicele de masă corporală:


IMC = G/I2 (n = 18,5 – 24,9 kg/m2)
• Indicele abdomino-fesier:
IAF = CA / CF (F: IAF < 0,85; B: IAF < 0,95)
• Indicele abdominal:
IA = CA / I (n < 0,5)
• Grosimea paniculului adipos în regiunea tricipitală:
n < 20 mm (B); n < 30 mm (F)
• CA: n < 94 cm (B); n < 80 cm (F)
Clasificarea greutăţii în funcţie de valorile IMC
(Kg/m2)

Subponderal < 18,5


Normal 18,5 - 24,9
Supraponderal 25 – 29,9
Obezitate gradul I 30 – 34,9

Obezitate gradul II 35 – 39,9


Obezitate gradul III ≥ 40
Clasificarea obezităţii în funcţie de distribuţia
ţesutului adipos
Tipul obezităţii Talia (cm) B Talia (cm) F

Abdominal ≥ 94 ≥ 80
Gluteo-femural < 94 < 80

Riscul cardiovascular în funcţie de talie şi sex


Risc scăzut Risc probabil Risc cert
Bărbaţi < 94 94 – 101 ≥ 102

Femei < 80 80 – 87 ≥ 88
Clasificarea obezităţii

• Criteriul etiopatogenic
- obezitate primară
- obezitate secundară

• Criteriul histologic
- obezitate hiperplazică
- obezitate hipertrofică
- obezitate mixtă

• Criteriul evolutiv
- obezitate dinamică (faza de acumulare)
- obezitate statică (de regulă când a atins maximul ponderal)
Schema generală de producere a obezităţii
Factori genetici Factori câştigaţi

Dezechilibru energetic:
Aportul energetic > cheltuiala energetică

Acumulare de trigliceride în adipocite

- Creştere în greutate: obezitate
- Acumulare selectivă intraabdominală
de ţesut adipos: obezitate abdominală
• Organismul normoponderal adult
EA = EC (MB + TM + TR + ADS)

• Organismul obez
EA = EC + ED

EA = energie de aport
EC = energie de consum
MB = energie consumată pentru nevoile bazale
TM = travaliu muscular
TR = energie de termoreglare
ADS = acţiunea dinamică specifică a alimentelor
Principalii factori de risc obezogen (1)
• Factori genetici – istoric familial de obezitate

• Subnutriţia mamei gestante, greutate mică la naştere a


fătului

• Stil de viaţă nesănătos – alimentaţie hipercalorică, alcool,


sedentarism, stress

• Factori psihologici, sociali şi culturali


- depresia, anxietatea  tulburări de comportament alimentar
- urbanizarea
- obiceiuri alimentare nesănătoase
- lipsa acţiunilor de educaţie şi prevenire la nivel populaţional
- mentalităţi greşite
Principalii factori de risc obezogen (2)

• Tulburări de comportament alimentar – gustări


interprandiale de alimente bogate caloric, bulimie, binge
eating, night eating, carbohydrate-craving

• Factori fiziologici – sarcină, lactaţie, menopauză

• Factori endocrini şi hipotalamici

• Medicamente

• Alţi factori – întreruperea fumatului în absenţa unei diete


corespunzătoare
Mortalitatea

• Riscul cel mai mic: IMC = 20 – 25  27 Kg/m2

•  excesiv la IMC > 30 Kg/m2

• IMC scăzut  neoplasme

• IMC crescut  boli cardio-vasculare

• Durata medie de supravieţuire  cu 10 ani mai mică

• Efectul fluctuaţiilor greutăţii


Complicaţiile cardio-vasculare ale obezităţii (1)
Boala coronariană

• Factorul determinant al riscului coronarian legat de


obezitate este câştigul ponderal de după vârsta de 18 ani
• Studiul Framingham – obezitatea este şi un factor de risc
independent, pe lângă efectele sale asupra altor factori de
risc (HTA, hiperlipidemie, DZ)
• Cu fiecare kg peste greutatea normală, riscul coronarian 
cu 3,1 %
• Obezitatea abdominală – riscul cel mai mare
• Sindromul X metabolic – riscul  exponenţial
Complicaţiile cardio-vasculare ale obezităţii (2)
Insuficienţa cardiacă

• De 2 X mai frecventă la obezi


• Dată de HTA, boala coronariană, insuficienţa respiratorie
secundară obezităţii
• Obezitatea – factor de risc independent

Aritmiile şi moartea subită


• Hipocrate – moartea subită mai frecventă la obezi
• Framingham – obezitatea: factor predictiv
• Obezii cu HVS excentrică – incidenţă a aritmiilor de 10 X >
• Tahicardie ventriculară şi fibrilaţie ventriculară
Complicaţiile cardio-vasculare ale obezităţii (3)
Hipertensiunea arterială
• 44% dintre hipertensivi sunt cu greutatea > normal
• Riscul de dezvoltare a HTA este de 3 X >
•  în greutate cu 10%   TA sistolică cu 6 mmHg
•  ponderală la obezi   TA
Varicele membrelor inferioare
• 2/3 dintre cei cu varice sunt supraponderali sau obezi
• Patogenie: - hipotonie venoasă (tulb. hormonale,
sedentarism, ineficienţa pompei)
- compresiune pe vena cavă, vene iliace
• Risc de tromboză venoasă profundă
Complicaţiile respiratorii ale obezităţii

• Hipoventilaţie  hipoxie şi hipercapnie  tulburări nervoase


centrale (somnolenţă, convulsii)
• Hipoxemia  poliglobulie secundară   volumul sanguin 
 HTP  CPC  IVD  ICCG
• 1956, Burnwell – “Sdr. Pickwick” – obezitate marcată,
hipoventilaţie, somnolenţă, uneori convulsii, cianoză,
respiraţie periodică, policitemie secundară, HVD, CPC
decompensat
• Pneumopatii acute şi bronşite
• Dispnee, chiar în lipsa insuficienţei cardiace
• Sindromul apneei în timpul somnului
Complicaţiile digestive ale obezităţii
• Litiaza biliară
• Angiocolecistite
• Herniile – hiatală, inghinală, ombilicală
• Steatoza hepatică
• Hemoroizi
Tulburări endocrine
• Distrofie ovariană (ovare polichistice)
• Tulburări ale ciclului menstrual
• Hiperestrogenism şi hiperandrogenism la femei
• Hipogonadism la bărbaţi

Cancerele
• La B: prostată, colorectal
• La F: endometru, sân, căi biliare, col uterin, ovar
Complicaţiile metabolice ale obezităţii
• Diabetul zaharat
• Hiperlipidemia
• Hiperuricemia

Complicaţiile la nivelul aparatului locomotor
• Reumatism cronic degenerativ
• Osteoartrite de şold şi de genunchi
• Boli periarticulare – tendinite

Complicaţiile neurologice şi psihice


• Cefalee, vertij, astenie fizică
• Tulburări psihice
Complicaţiile chirurgicale ale obezităţii
• Risc chirurgical şi anestezic mai mare
• Risc de insuficienţă respiratorie, infecţii ale plăgilor,
dehiscenţa plăgilor, tromboflebite postoperatorii

Complicaţiile obstetricale ale obezităţii


• Eclampsie, varice, tromboflebite, infecţii urinare, diabet
gestaţional, mortalitate fetală crescută
• Distocii
• Retracţie uterină întârziată  hemoragii, şoc; endometrite,
accidente mamare, pielonefrite

Complicaţiile cutanate
• Infecţii microbiene şi fungice (intertrigo inghinal, axilar)
• Eczeme
Tratamentul obezităţii în funcţie de IMC

IMC (kg/m2) Co-morbidităţi Tratament


> 27 Da sau nu Educaţie privind schimbarea
stilului de viaţă
> 30 Nu Educaţie şi program de
modificare a obiceiurilor

> 30 Da Educaţie, program de modificare


a obiceiurilor şi medicamente

> 35 Da sau nu Dietă hipocalorică, medicamente

> 40 Da Toate cele enumerate anterior şi


metode chirurgicale
Principiile tratamentului dietetic în obezitate

• Glucide: 55-58% • 5 mese pe zi


• Proteine: 15-17% • Mic dejun: 20%
• Lipide: 27-28% • Gustare: 15%
• NaCl: < 6 g • Prânz: 30%
• Fibre alimentare: 20-30 g • Gustare: 15%
• Colesterol: < 300 mg • Cina: 20%
• Lichide: > 2 litri
Tipuri de diete utilizate în obezitate

• Dieta cu deficit de 500 kcal/zi

• Dieta cu deficit de 1000 kcal/zi

• Dieta hipocalorică standard de 1200-1300 kcal/zi

• Reducerea la jumătate din aportul caloric anterior

• Dietele foarte hipocalorice sau restrictive – sub 800 kcal/zi


Rolul efortului fizic în tratamentul obezităţii

• Creşte sensibilitatea ţesuturilor la insulină

• Determină scădere în greutate şi menţine greutatea dorită

• Scade riscul cardiovascular

• Scade necesarul de agenţi farmacologici

• Creşte capacitatea de efort

• Creşte calitatea vieţii


Tratamentul medicamentos al obezităţii
Orlistat (Xenical)
• Inhibă selectiv lipaza gastrointestinală   absorbţia
grăsimilor cu 30% (TG şi colesterol)
• Acţiuni şi efecte
- reducerea greutăţii pe seama masei grase
- reducerea taliei şi a IMC
- reducerea RCV prin reducerea celorlalţi FR ( col total,
LDL, TG, ameliorarea toleranţei la glucoză, a TA)

• Reacţii adverse
- digestive (în condiţiile unui aport lipidic crescut)
-  nivelului plasmatic al vitaminelor liposolubile

• Contraindicaţii – sindrom de malabsorbţie

• Posologie – 3 x 120 mg / zi la mesele principale


Tratamentul chirurgical al obezităţii

Indicaţii

• IMC ≥ 40 kg/m2

• IMC ≥ 35 kg/m2 cu comorbidităţi

• Vârsta între 18 şi 60 ani

• Eşecul tratamentului conservator aplicat cel puţin un an

• Pacient care va coopera pe termen lung după operaţie


Tratamentul chirurgical al obezităţii

Contraindicaţii

• IMC < 35 kg/m2


• Vârsta sub 18 ani sau peste 60 de ani
• Obezitate de cauză endocrină
• Dependenţa de droguri sau alcool
• Risc operator inacceptabil
• Boli asociate grave: hepatopatie, cardiopatie, patologie
digestivă
Tehnici chirurgicale

• Tehnici restrictive
- gastroplastia orizontală
- gastroplastia verticală
- bandingul gastric

• Tehnici de malabsorbţie
- by-pass-ul jejunoileal
- by-pass-ul bilio-intestinal
- by-pass-ul bilio-pancreatic
Hiperuricemiile
Definirea termenilor

• Hiperuricemia

• Artrita acută urică

• Artrita gutoasă cronică şi tofii gutoşi


(guta cronică tofacee)

• Nefropatia urică

• Litiaza renală urică


Epidemiologie

• Prevalenţa hiperuricemiilor - 2 – 18%


- în România 4,2% la adulţi

• Prevalenţa gutei - 0,13 – 0,37%


- 2 – 5% din totalul artropatiilor

• Sexotropism masculin

• Vârf de incidenţă - decada a 5-a de vârstă


Clasificarea hiperuricemiilor

• Primare
- Idiopatică (> 99%)
- Defecte metabolice specifice moştenite (<1%)
• Secundare
- Deficitul de glucozo-6-fosfatază (boala von Gierke)
- Hemolize cronice: anemii hemolitice, leucemii, limfoame
- Mecanisme renale
- insuficienţă renală familială progresivă
- insuficienţă renală cronică dobândită
- medicamente (diuretice, citostatice)
- produşi metabolici endogeni (lactat, corpi cetonici)
Tratamentul dietetic în hiperuricemii

• Dietă săracă în purine

• Tratamentul obezităţii

• Reducerea consumului de alcool

• Dietă lacto-fructo-zaharată
Tratamentul atacului acut de gută

• Colchicina

• AINS

• Glucocorticoizii (po sau intraarticular)

• NU hipouricemiante

• Profilaxia recurenţelor
Prevenirea formării depozitelor tisulare de uraţi
şi diminuarea sau dispariţia celor constituite

• Inhibitorii biosintezei acidului uric


- allopurinol, oxipurinol, tiopurinol

• Medicaţia uricoeliminatoare
- probenecidul
- benziodarona
- sulfinpirazona
• Indicaţiile uricofrenatoarelor
- litiaza renală certă sau colici nefretice ± eliminare de
calculi în antecedente
- uraturie > 700 mg/24 ore
- coexistenţa unor afecţiuni care contraindică aportul excesiv
de lichide (IR severă, sdr. nefrotic, HTA)

• Indicaţiile uricoeliminatoarelor
- uraturie < 700 mg/24 ore
- absenţa litiazei renale sau a colicilor renale în antecedente
- când hiperuricemia e datorată tratamentului diuretic al HTA
- cînd e posibilă cura de diureză şi alcalinizarea urinei
Sindromul X metabolic
Definiţia sindromului X metabolic (IDF, 2005)

Obezitate abdominală (CA ≥ 94 cm la B / ≥ 80 cm la F)

+
Oricare 2 din următoarele 4 elemente:

• TG ≥ 150 mg/dl
• HDL < 40 mg/dl la B şi < 50 mg/dl la F
• TAs ≥ 130 mm Hg sau TAd ≥ 85 mm Hg
• Glicemie a jeun ≥ 100 mg/dl