Sunteți pe pagina 1din 13

Src Syk

González Ojeda Maritza


Granados Jaime Jessica
Hernández Hernández Naima Abigail
Quezada Pineda Lizbeth
SRC PROTEÍNA-TIROSINA QUINASA
Las proteínas quinasas de la familia c-Src y v-Src son
protooncogenes que desempeñan un papel clave en la
morfología celular, la motilidad, la proliferación y la
supervivencia.

v-Src (una proteína viral) está codificada por el oncogen


de pollo del virus del sarcoma de Rous, y c-Src (el
homólogo celular) está codificada por un gen fisiológico, el
primero de los protooncogenes.
La proteína Src es una proteína de señalización intracelular,
cuya función es transmitir señales desde varios receptores de
membrana a las proteínas que permiten la activación de la
síntesis proteica y el crecimiento celular, principalmente.

Es una tirosina quinasa, por lo que transmite sus mensajes


mediante la adición de grupos fosfato a los aminoácidos de
tirosina especiales en las cadenas proteicas. Agrega grupos
de fosfato a una amplia variedad de proteínas que controlan la
estructura, la comunicación y el crecimiento celular,
activándolas y liberándolas, para que puedan realizar sus
tareas individuales.
ESTRUCTURA
En la siguiente figura se muestra un esquema de las formas activa
(izquierda) e inactiva (derecha) de la quinasa c-SRC.
Dominios estructurales y funcionales
de la tirosina quinasa c-SRC
Catálisis: interacción con el sustrato

La actividad catalítica completa requiere la separación de los dominios SH3


y SH2 así como el cese de las interacciones moleculares entre ambos, lo
cual se consigue con la desfosforilación de Tyr 527 de la cola C-terminal.
Regulación
La actividad de la quinasa c-SRC puede regularse de manera
positiva o negativa por fosforilación en residuos de tirosina. El
plegamiento en la forma inactiva depende de la fosforilación de una
tirosina situada en la cola C-terminal (tirosina 527 en color verde).
Papel en la aparición y desarrollo de
tumores
El gen src es un gen que fue descrito por primera vez en el sarcoma de
Rous, un cáncer que desarrollaban los pollos y que estaba provocado por
la infección por un retrovirus (RNA monocaternario) que contiene este gen
integrado en su genoma. Además, se observó que este gen también estaba
presente en las células normales de los pollos. Esto llevó a diferenciar dos
versiones del gen:
- La versión celular (c-src), que se observaba en los pollos sanos.
- La versión vírica (v-src), que se observaba en los pollos con cáncer.
Figura 3: Estructura de las proteínas c-SRC y v-SRC
Cadena A, tirosina-proteína quinasa SYK

MALEEIRPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEKPYKDELLAEAN
VMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVH
RDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLM
WEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYD
VVNLEHHHHHHHHH
La tirosina quinasa del bazo (SYK) es una proteína tirosina quinasa no receptora citosólica

. Debido a que SYK media en vías de señalización de receptores clave que involucran al receptor
de células B y los receptores Fc, SYK es un objetivo atractivo para enfermedades autoinmunes y
tratamientos para el cáncer
Mientras que Syk y Zap-70 se expresan principalmente en tejidos hematopoyéticos, hay
expresión de Syk en una variedad de tejidos. Dentro de las células B y T, respectivamente, Syk y
Zap-70 transmiten señales desde el receptor de células B y el receptor de células T. [9] Syk
desempeña un papel similar en la transmisión de señales de una variedad de receptores de la
superficie celular