Sunteți pe pagina 1din 125

TratamentuI diabetuIui zaharat

DZ este o boal cronic


Obiectivul principal: mentinerea parametrilor clinici si
biochimici specifici ct mai aproape de normal
Tratamentul trebuie privit n perspectiva sperantei de
viat
!reventia primar a DZ tip 1
Promovarea alimentrii copilului la sn
Evitarea bolilor infectioase cu potential diabetogen
Evitarea substantelor toxice pancreatotrope
Msuri farmacologice
!reventia primar a DZ tip 2
Controlul greuttii
Promovarea activittii fizice
Diete bogate n fibre si srace n grsimi
Msuri farmacologice
!reventia secundar - prevenirea aparitiei
compIicatiiIor
Diagnostic precoce
Controlul glicemiei (HbA1c)
Tratamentul factorilor de risc vascular (obezitate,
dislipidemie, hipertensiune)
Evitarea fumatului
Detectarea complicatiilor cronice n stadiul subclinic
!reventia tertiar
Tratamentul activ al complicatiilor cronice
Evitarea complicrii complicatiilor
riteriiIe unui bun controI metaboIic
Glicemia preprandial: 80-110 mg/dl
Glicemia postprandial: 100-145 mg/dl
HbA1c: < 6,5 %
Colesterol total: < 200 mg/dl
Trigliceride a jeun: < 150 mg/dl
TA < 130 / 80 mm Hg (120 / 70 mm Hg)
MC < 25 kg/m
2
(B);
< 24 kg/m
2
(F)
etode de tratament
Tratamentul dietetic
Exercitiul fizic
Tratamentul medicamentos (insulin si/sau ADO)
Educatia specific
TratamentuI dietetic
Locul dietoterapiei n tratamentul DZ
Obiectivele tratamentului nutritional:
- mentinerea glicemiei la un nivel ct mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea si tratarea complicatiilor acute si cronice
- cresterea calittii vietii printr-o alimentatie adecvat
#ecomandriIe nutritionaIe generaIe pentru
pacientuI diabetic
Calorii
Glucide: 55-60 % din aportul caloric
Fibre alimentare: 30-40 g/zi
Lipide: sub 30 % din calorii
Colesterol: < 300 mg/zi
Proteine: 12-15 % din aportul caloric
Sodiu: < 6 g NaCl / zi; la hipertensivi < 3 g NaCl / zi
Alcoolul
Edulcorantele
Vitamine si minerale
EtapeIe aIctuirii unei diete
Precizarea caracteristicilor generale ale dietei
Calculul aportului caloric
Distributia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
Distribuirea glucidelor pe numrul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
Alegerea alimentelor
Pregtirea corect a alimentelor (reguli de gastrotehnie)
EfortuI fizic terapeutic - beneficii
Scade glicemia si HbA1c
Amelioreaz profilul lipidic
- G TG
- G LDL-colesterolul
- HDL-colesterolul
Amelioreaz HTA usoar si moderat
Adjuvant al dietei pentru scderea ponderal
Amelioreaz factorii de risc cardio-vascular
Creste tonusul psihic si calitatea vietii
EfortuI fizic terapeutic - riscuri
Hipoglicemie
Hiperglicemie dup eforturi fizice foarte intense
Hiperglicemie si cetoz la pacientii insulino-deficienti
Precipitarea si exacerbarea bolilor cardio-vasculare (angin
pectoral, infarct de miocard, aritmii, moarte subit)
Agravarea complicatiilor cronice ale DZ
- retinopatie proliferativ: hemoragii vitreene, deslipiri de retin
- nefropatie: proteinuria
- neuropatie periferic: leziuni ale articulatiilor si ale tes. moi
- neuropatie vegetativ: scade rspunsul cardio-vascular la
efort, hipotensiune ortostatic
TratamentuI insuIinic
!!rincipaIeIe etape n dezvoItarea rincipaIeIe etape n dezvoItarea
insuIinoterapiei insuIinoterapiei
Descoperirea insulinei (1921)
nsuline "clasice" (conventionale) (1922)
nsuline cu actiune prelungit (1936)
nsuline NPH (1950)
nsuline nalt purificate (monocomponent) (1978)
nsuline umane (1982)
Analogi de insulin (1996)
Iasificarea insuIineIor
Dup provenient - animale
- de tip uman
Dup durata de actiune
- cu durat scurt de actiune
- cu actiune intermediar
- cu durat lung de actiune
- insuline premixate
28 28
LYS LYS
28 28
LYS LYS
29 29
!# !#
29 29
!# !#
SS
SS
SS
SS
S S S S S S S S
SSSS
SSSS
A A- -chain chain A A- -chain chain
- -chain chain - -chain chain
1 1 1 1
1 1 1 1
21 21 21 21
30 30 30 30
InsuIina LIS!# HumaIog
AnaIogii rapizi de insuIin
GIuIisine
AnaIogii de insuIin cu actiune Iung
InsuIina gIargine
(Iantus)
InsuIina detemir
(Ievemir)
!reparate de insuIin
u actiune scurt
- Actrapid HM
- Humulin R
- nsuman Rapid
u actiune intermediar
- nsulatard HM
- Humulin N (NPH)
- nsuman Bazal
u actiune Iung
- Monotard HM
- Humulin L
AnaIogi de insuIin
AnaIogi de insuIin cu actiune (uItra)rapid
- NovoRapid
- Humalog
- Apidra
AnaIogi de insuIin cu actiune Iung
- Lantus
- Levemir
InsuIine premixate
- Mixtard 10 50 HM (Mixtard 30 HM)
- Humulin M1 5 (Humulin M3)
- nsuman Comb 25; nsuman Comb 50
AnaIogi premixati
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Scheme de insuIinoterapie
Conventional
ntensificat
Administrarea insuIinei
Cile de administrare
Dispozitivele de administrare
Autocontrolul si ajustarea dozelor
Pompa de insulin
ndicatiile insulinoterapiei
IndicatiiIe insuIinoterapiei
n diabetuI zaharat tip 2
Mentinerea dezechilibrului glicemic n ciuda dozelor
maxime de agenti orali combinati
Hiperglicemie cu cetonemie si cetonurie
Decompensarea generat de evenimente intercurente
Managementul perioperator
Sarcina si lactatia
Hepatopatii si/sau nefropatii
Alergia sau alte reactii adverse serioase la ADO
Hiperglicemii importante n momentul prezentrii
EfecteIe secundare aIe insuIinoterapiei
Hipoglicemia
Hipovolemia indus de insulin
Cresterea n greutate
Reactii induse de anticorpii antiinsulin
Lipodistrofia
Abcesele la locul injectiei
Edemul insulinic
Neuropatia indus de insulin
"ncetosarea vederii
Agravarea retinopatiei diabetice
Efecte adverse ale insulinei inhalatorii
HipergIicemiiIe matinaIe
Subinsulinizarea
Fenomenul Somogyi
Fenomenul de zori (Dawn phenomenon)
TratamentuI cu preparate non-insuIinice
edicamente care cresc secretia pancreatic de insuIin
- sulfonilureice
- reglatori prandiali ai glicemiei
edicamente care scad rezistenta Ia insuIin
- biguanide
- tiazolidindione
edicamente care scad absorbtia intestinaI de gIucoz
- inhibitori de alfa-glucozidaz
IncretineIe
Canalul K
ATP
cu cele dou componente: receptorul
sulfonilureic (SUR 1) si canalul rectificator de K (Kir 6.2)
Ansamblul
canalului
Componenta SUR
edicamente care cresc secretia pancreatic
de insuIin (secretagoge)
Componenta Kir 6.2
nchiderea canalului K nchiderea canalului K
ATP ATP
prin prin
legarea unei molecule de ATP la legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1 unul din cele 4 situsuri de pe SUR 1
!reparateIe suIfoniIureice
AgentuI suIfoniIureic !reparate comerciaIe Doza maxim
Generatia I
- tolbutamid
- clorpropamid
Tolbutamid; 500 mg
Diabinese; 250 mg
3000 mg
500 mg
Generatia a II-a
- glibenclamid
- glipizid
- gliclazid
- gliquidona
Glibenclamid; 5 mg
Maninil; 1,75; 3,5 mg
Glucotrol; 5 si 10 mg
Diaprel MR; 30 mg
Glurenorm; 30 mg
15 mg
10,5 mg
10 mg
120 mg
90 mg
Generatia a III-a
- glimepiride Amaryl; 1, 2, 3 si 4 mg 6 mg
#egIatorii prandiaIi ai gIicemiei
Acelasi mecanism de actiune ca al sulfonilureicelor
Durat scurt de actiune
Risc hipoglicemic redus
"O mas o doz, nici o mas nici o doz
Preparate: - Repaglinida (NovoNorm; 0,5 1 2 mg)
- Nateglinida (Starlix)
edicamente care scad rezistenta Ia insuIin
iguanideIe
Mecanism de actiune
Efecte adverse
Contraindicatii
Preparate:
- fenformin
- metformin: Meguan, Siofor, Metfogamma, Metformin,
Glucophage (1 cp = 500 mg, 850 mg, 1000 mg; doza
maxim = 3000 mg)
- buformin: Silubin Retard
(1 cp = 100 mg; doza maxim = 300 mg)
TiazoIidindioneIe (gIitazoneIe)
Mecanism de actiune: PPAR (peroxisome proliferator
activated receptors)
Efecte adverse
Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia) nu se mai foloseste)
edicamente care scad absorbtia intestinaI
de gIucoz
Inhibitorii de aIfa-gIucozidaz
Mecanism de actiune
Efecte adverse
Preparate
- acarboza (Glucobay, 1 cp = 50; 100 mg; doza maxim =
300 mg)
- miglitolul
IncretineIe

-30
-10
10
30
50
70
90
0 15 30 45 60 75 90
TIE (min)

0
50
100
150
200
0 15 30 45 60 75 90
TIE (min)
cIntyre N. Lancet 1964; 2: 20-21

G
L
U

(
m
g
/
d
I
)

I
N
S
U
L
I
N

(
m
U
/
L
)

oral
intravenos
Secretia de insuIin dup administrarea de gIucoz
oraI / intravenos
EfectuI incretinic
ngestia de glucoz determin un rspuns insulinic mai
pronuntat dect glucoza administrat intravenos, indicnd
prezenta unor substante secretate de tractul
gastrointestinal care stimuleaz eliberarea de insulin
printr-un mecanism glucodependent."
reutzfeIdt. abetologa 1985; 28: 565
Definitia incretineIor
"Gut-derived factors that increase
glucose-stimulated insulin secretion
In

cret

in
Intestine Secretion InsuIin
Oral
V

n
s
u
l
i
n


(
m
U
/
l
)

n
s
u
l
i
n


(
m
U
/
l
)
Persoane sntoase Pacienti cu DZ tip 2
Timp (min)
Timp (min)
Oral
V
EfectuI incretinic Ia persoaneIe sntoase
si Ia pacientii cu diabet zaharat tip 2
IncretineIe
Y
A
E
G
T
F
I
S
D
Y
S
I
A

D
K
I
H
Q
Q
D
F
V
N
W
L
L
A
Q
K
G
K
K
N
D
W
K
H
N Q
T
I
GI!: Gastric Inhibitory !oIypeptide
GIucose-Dependent InsuIinotropic !oIypeptide
H
A
E
G
T
F
T
S
D
V
S
S
Y
L
E
G
Q
A
A
K
E
F
I
A
W
L
V
K
G
#
G
GL!-1: GIucagon-Like !eptide 1
GI!
astrc nhbtory polypept/e"
lucose-me/ate/ nsulnotropc polypept/e"
G: 4984
EIiberare: duoden, jejun, ileonul proximal
Actiuni:
- inhibarea secretiei gastrice acide
- stimularea secretiei de insulin
- actiuni insulin-like asupra metabolismului lipidic
GL!-1
lucagon-le pept/e-1"
G: aprox. 4000
EIiberare: intestinul subtire distal, colon
Actiuni:
- stimularea secretiei de insulin
- inhibarea golirii gastrice
- actiuni insulin-like extrapancreatice
- inhibarea apetitului
GL!-1
eIuIa L
#
GIuco GIucoza za
Enteroc Enterociit t
!ancreas !ancreas: :
nsulin nsulina a
G G Glucagon Glucagonul ul
Stomac Stomac: :
G G otiIit otiIitatea atea
H HiipotaIamus potaIamus: :
G G Apetit ApetituI uI
GI! vs. GL!-1
GP GLP-1
42 aa 30-31 aa
Celulele K duoden Celulele L ileon +
colon
| Secretia de insulin | Secretia de insulin
Efect minim asupra golirii gastrice | Golirea gastric
Efect nesemnificativ asupra
secretiei de glucagon
| Secretia de glucagon
Efect nesemnificativ asupra
satiettii si greuttii corporale
| Apetitul si greutatea
corporal
| Masa .-celular | Masa .-celular
EfectuI administrrii de GL!-1
n diabetuI zaharat tip 2
GIucoz
InsuIin
GIucagon
300
250
200
150
100
50
0
0 60 120 180 240
16
12
8
4
0
GL!-1
!Iacebo
p<0.0001
*
*
*
*
*
*
*
G
I
u
c
o
z

(
m
g
/
d
I
)
G
I
u
c
o
s
e

(
m
m
o
I
/
I
)
GL!-1 i.v. (1.2 pmoI
.
kg
-1.
min
-1
)
40
30
20
10
0
0 60 120 180 240
250
200
150
100
50
0
p<0.0001
* *
*
*
*
*
*
I
n
s
u
I
i
n

(
m
U
/
I
) I
n
s
u
I
i
n

(
p
m
o
I
/
I
)
*
20
15
10
5
0
0 60 120 180 240
p=0.0009
G
I
u
c
a
g
o
n

(
p
m
o
I
/
I
)
Timp (min)
* *
*
*
GL!-1 i.v. (1.2 pmoI
.
kg
-1.
min
-1
)
GL!-1 i.v. (1.2 pmoI
.
kg
-1.
min
-1
)
IntestinaI
GL!-1
reIease
GL!-1
inactive
eaI
Active
GL!-1
D!!-4
EIiberare de
GL!-1
intestinaI
GL!-1
inactiv
as
GL!-1 activ
D!!-4
.
GL!-1
SoIutii farmacoIogice
GL!-1 uman recombinant infuzie s.c. continu
Agonisti de receptor GL!-1
- Exenatida (Byetta)
- Liraglutida
Inhibitori de D!!-4
Exenatida (yetta)
Gila monster (eloderma suspectum)
Aprobat de FDA (2005) si de EMEA (2006) pt. trat. DZ 2
Capt C-terminal bogat n reziduuri de prolin
Actiune de 10 ori mai intens dect a GLP-1 nativ
T1/2 mai lung
GL!-1 si Exenatida
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Exenatida
GL!-1
Exenatida (yetta)
ndicat n tratamentul DZ tip 2 necontrolat prin:
- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice
metformin + TZD
Doza initial: 5 3g x 2/zi
Adm. sc cu (pn la) 60 min. naintea meselor principale
Dup o lun, doza se poate creste la 10 3g x 2/zi
LiragIutida
Derivat acil al GLP-1
Adugarea unei grupri
de acizi grasi F activeaz
legarea de albuminele
plasmatice F ntrzie
eliminarea renal
T1/2 ~ 12 ore
Administrare injectabil o
singur dat pe zi
SoIutii farmacoIogice
GL!-1 uman recombinant infuzie s.c. continu
Agonisti de receptor GL!-1
- Exenatida (Byetta)
- Liraglutida
Inhibitori de D!!-IV
IntestinaI
GL!-1
reIease
GL!-1
inactive
eaI
Active
GL!-1
D!!-4
GL!-1
inactiv
as
GL!-1 activ
D!!-4
GL!-1
Inhibitor de
D!!-4
EIiberare de
GL!-1
intestinaI
Inhibitori de D!!-4
SitagIiptina (Januvia)
- inhibitor competitiv, reversibil si nalt selectiv al DPP-4
- aprobat de FDA (2006) si de ANM (2007) pt. trat. DZ 2
ViIdagIiptina (GIavus)
- se leag de DPP-4 F complex inactiv
SitagIiptina (Januvia)
ndicat n tratamentul DZ tip 2 necontrolat prin:
- monoterapie cu metformin, sulfonilureice sau TZD
- terapie oral combinat: metformin + sulfonilureice
Doza recomandat: 100 mg/zi (doz unic), indiferent de
orarul meselor
Efecte non-gIicemice aIe incretineIor
AnaIogii de GL!-1
- scdere n greutate progresiv si dependent de doz
- usoar reducere a LDL-colesterolului
- ameliorare a functiei ventriculare la pacientii post-M
Inhibitorii de D!!-4
- efecte neutre asupra greuttii
- usoar reducere a TG si o crestere a HDL-colesterolului
Efecte adverse aIe incretineIor
AnaIogii de GL!-1
- greturi si vrsturi (50% dintre pacienti)
- dependente de doz
- se amelioreaz pe parcursul tratamentului
- diaree
- hipoglicemii usoare si moderate (cnd se asociaz cu SU)
Inhibitorii de D!!-4
- cefalee
- susceptibilitate pentru infectii de ci aeriene superioare
AIgoritmuI de tratament n DZ 2
Dieta si exercitiul fizic
Antidiabetice orale
Asocieri de antidiabetice orale
nsulin antidiabetice orale
ADA/EASD Chid (2006)
Bailey C et al. Br J Diabetes Vas Dis 2006; 6: 147148.
LifestyIe + metformin
Add
suIphonyIurea
Add basaI
insuIin
Add
gIitazone
If HbA
1c
K 7%
Add
suIphonyIurea
Add basaI
insuIin
If HbA
1c
K 7%
Further intensify insuIin or add basaI
insuIin + metformin insuIin sensitiser
Add basaI
insuIin
Intensify
insuIin
If HbA
1c
K 7%
Add
gIitazone
!reparate combinate de AD
Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg
5 mg/500 mg
Preparate combinate TZD + metformin
Competact 15 mg/850 mg
Preparate combinate inhibitori DPP-4 + metformin
Janumet 50 mg/850 mg
50 mg/1000 mg
DisIipidemiiIe
Definirea termeniIor
Dislipidemii
Hiperlipidemii
Valorile normale
- colesterol seric total < 190 mg/dl (< 5 mmol/l)
- trigliceride serice < 180 mg/dl (< 2 mmol/l)
- colesterol - HDL > 40 mg/dl (> 1 mmol/l)
- colesterol - LDL < 115 mg/dl (< 3 mmol/l)
Obiectivele terapeutice
Importanta disIipidemiiIor
ImpactuI epidemioIogic
- boli populationale
- n Romnia: 55% din populatia ntre 20 si 60 ani
ImpactuI bioIogic: risc cardio-vascular
risc de pancreatit acut
ImpactuI economic
LipoproteineIe
Asocieri moIecuIare dintre diferite componente lipidice
sanguine (TG, colesterol, fosfolipide, AG) si proteinele
circulante
onstituite din:
- partea transportat: AG esterificati sub form de TG si
esteri de colesterol
- transportorul: apoproteine
#oIuI apoproteineIor:
- structural
- functional: legarea de receptori
activarea sau inhibarea unor enzime
(LPL, LCAT)
Iase majore Iipoproteice
hiIomicronii 90% TG
VLDL 60% TG, 12% colesterol
IDL forme tranzitorii; 30% colesterol, 40% TG
LDL 60% colesterol
- fenotip A
- fenotip B
- fenotip intermediar
HDL
Iasificarea disIipidemiiIor (Frederickson)
Tipul chilomicronemie bazal
Tipul a hiper - LDL
Tipul b hiper - LDL si hiper - VLDL
Tipul cu DL n conditii bazale
Tipul V hiper VLDL
Tipul V chilomicronemie bazal + hiper - VLDL
Tipul V hiper - HDL
Iasificarea disIipidemiiIor
sociatia European de ateroscleroz)
Forma de disIipidemie oIesteroI TrigIiceride
Hipercolesterolemie
- de granit
- moderat
- sever
190-249
250-300
> 300
< 180
< 180
< 180
Hipertrigliceridemie
- moderat
- sever
< 190
< 190
180-400
> 400
Hiperlipidemie mixt
- moderat
- sever
190-300
> 300
180-400
> 400
Etiopatogenia disIipidemiiIor
Factori genetici
- defect cromozomial monogenic (ex. HLP tip a)
- defect cromozomial poligenic
Factori cstigati
- excesele alimentare
- abuzul de alcool
- fumatul
- sedentarismul
- stress-ul
- obezitatea
- diverse boli: DZ dezechilibrat, hipotiroidismul, sdr. nefrotic
- unele medicamente: corticoizii, contraceptivele orale
ecanisme patogenetice
resterea sintezei sau productiei Iipoproteice
- diet hipercaloric, hiperlipidic, hipercolesterolic,
bogat n glucide simple F fluxul de AGL spre ficat F
F VLDL F DL si LDL
Diminuarea cataboIismuIui Iipoproteic
- G activittii LPL F hiperchilomicronemie si/sau VLDL
- absenta receptorilor LDL sau G activittii lor F LDL
- anomalii ale Apo E F DL nu mai sunt recunoscute de
receptorii LDL F hiperlipidemia mixt sever
ombinarea mai muItor factori si mecanisme de
producere
TabIou cIinic
Xantoame de tip eruptiv, tendinos, tuberos, palmar
Xantelasma
Arc cornean
ipemia retinalis
Dureri abdominale, manifestri de pancreatit
Manifestri ale ATS cerebrale, coronariene si periferice
Simptome osteo-articulare (rar)
Investigatii paracIinice
Aprecierea aspectului plasmei sau serului dup 24 de
ore de la recoltare si pstrare la frigider (+ 4
0
C)
Dozarea colesterolului total si a TG
Dozarea HDL-colesterolului
Calculul LDL-colesterolului (formula lui Friedwald):
LDL-col = colesterol total HDL-col TG/5 (mg/dl)
LDL-col = colesterol total HDL-col TG/2,2 (mmol/l)
onditie: TG < 400 mg/dl
Alte metode (electroforeza, ultracentrifugarea, dozarea
apoproteinelor)
Depistarea disIipidemiiIor
IdeaI: screening sistematic la ntreaga populatie cu
vrsta > 20 ani
!ractic: la grupele cu risc crescut
GrupeIe cu risc crescut Ia care se recomand
depistarea disIipidemiiIor
1. Bolnavi cu boli cardio-vasculare aterosclerotice
2. Persoane cu factori de risc cardiovascular
3. Persoane cu arc cornean sau xantomatoz
4. Rudele de gradul ale persoanelor de la punctele 1 si 2
Depistarea compIet
- determinarea CT, TG, HDL-col
- recoltare dimineata, dup 8-12 ore de post
- recomandat la persoane cu boli cardio - vasculare ATS
DZ
xantomatoz
Depistarea partiaI
- determinarea doar a colesterolului total
- recoltare n orice moment al zilei
- recomandat la persoanele care au si alti factori de risc
rudele de gradul ale celor cu BCV ATS
alte persoane care se prezint la consultatie
DisIipidemiiIe aterogene
Hipercolesterolemie de granit (190-249 mg/dl)
Hipertrigliceridemie > 180 mg/dl
Scderea colesterolului HDL < 40 mg/dl la brbati
< 50 mg/dl la femei
Modificarea LDL care devin mici si dense
DisIipidemiiIe secundare
HipercoIesteroIemii hipotiroidie, colestaz, sindrom
nefrotic, sarcin, medicatie cu tiazide si progesteron
HipertrigIiceridemie DZ necontrolat, sindrom nefrotic,
insuficient renal cronic, paraproteinemie
HiperIipidemie mixt DZ necontrolat, sindrom nefrotic,
medicatie cu tiazide, corticosteroizi, progestageni
ompIicatii si asocieri morbide
Patologia cardio-vascular aterosclerotic
Pancreatita acut
Diabetul zaharat
Obezitatea
Hipertensiunea arterial
Sindromul X metabolic
anagement-uI disIipidemiiIor
StabiIirea obiectiveIor
ptimizarea stiIuIui de viat
- dieta hipolipidic
- exercitiul fizic
TratamentuI medicamentos
!rincipiiIe dietei hipoIipidice
Adaptarea aportului caloric n functie de necesitti si
greutatea corporal
Reducerea aportului caloric provenit din lipide < 30%
Scderea lipidelor saturate la 1/3 din totalul lipidelor
Lipidele mononesaturate si cele polinesaturate (forma "cis)
vor reprezenta baza aportului lipidic (cte 1/3)
Scderea aportului de colesterol < 300 mg/zi
Cresterea aportului de glucide complexe (50-55%)
Fibrele alimentare 20-30 g/zi
Glucidele simple 10% din necesarul caloric
Alcoolul va fi suspendat sau mult limitat
Evitarea fumatului
Dieta trebuie "negociat cu pacientul
Control la 3 luni
Scade colesterolul cu 10-20%
ExercitiuI fizic
Scade trigliceridele
Creste HDL-colesterolul
TratamentuI medicamentos
#ezineIe (oIestiramina)
ecanism de actiune
- blocheaz circuitul enterohepatic al acizilor biliari
- activeaz transformarea colesterolului n acizi biliari
- stimuleaz captarea LDL pe calea receptorilor LDL
Efecte secundare - disconfort abdominal, constipatie,
diaree, cresterea TG, G absorbtiei altor medicamente
ontraindicatii - obstructie biliar complet, ulcer peptic,
sarcin
onitorizare - leucocite
AciduI nicotinic si derivatii (Acipimox)
ecanism de actiune
- inhib eliberarea AG din depozite
- G sinteza si secretia de VLDL
Efecte secundare - prurit, greturi, congestia fetei, vrsturi
ontraindicatii - insuficient hepatic, infarct miocardic
recent, cardiopatie congestiv, gut, sarcin, ulcer gastric
onitorizare - glicemie, teste functionale hepatice, acid uric
UIeiuI de peste
Contine AG polinesaturati omega 3
nhib sinteza si secretia de VLDL
Fibratii
ecanism de actiune
- PPAR F exprimarea genei LPL
exprimarea genei Apo A si Apo A
diminuarea genei Apo C
F activeaz LPL
stimuleaz catabolismul LDL si VLDL
inhib lipoliza TG din adipocite
G concentratia LDL mici si dense
HDL de volum crescut
G hiperlipemia postprandial
G fibrinogenul F efect antitrombogen
Efecte secundare - disconfort abdominal, greturi, eruptii,
mialgii (miopatie), efectul anticoagulantelor
ontraindicatii - insuficient hepatic, renal, sindrom
nefrotic, sarcin, alptare
onitorizare - teste functionale hepatice, creatin-kinaza
!reparate - fenofibrat, bezafibrat, ciprofibrat, gemfibrozil
StatineIe
ecanism de actiune
- inhib HMG-CoA reductaza, deci sinteza colesterolului
- sinteza receptorilor LDL, deci catabolizarea acestuia
- G procentul de LDL mici si dense
- G oxidabilitatea LDL
- G fibrinogenul, Lp(a), PA-1 F efecte favorabile pe
sistemul de coagulare-fibrinoliz
Efecte secundare flatulent, enzimelor hepatice si
musculare, eruptii
ontraindicatii boli hepatice active, sarcin, alptare
onitorizare - teste functionale hepatice, creatin-kinaza
!reparate - rosuvastatin, atorvastatin, simvastatin,
pravastatin, lovastatin, fluvastatin
Indicatii de utiIizare a cIaseIor de
hipoIipemiante
TipuI de hiperIipidemie !rima aIegere AIternativ
Hipercolesterolemie Statine Rezine, acid
nicotinic, fibrati
Hipertrigliceridemie Fibrati Acid nicotinic, ulei
de peste
Hiperlipidemie mixt Fibrati, statine Acid nicotinic
Asocieri medicamentoase recomandate
Colestiramin + statine
Fibrati + statine
bezitatea
Definitie - obezitatea este o boal caracterizat prin
cresterea greuttii corporale pe seama tesutului adipos
EtimoIogie - "obedo-obedere (lat) = "a mnca n
exces, "a mnca mult si lacom
!revaIent - n lume > 250 milioane obezi
- n 2025 > 300 milioane obezi
bezitatea
probIem major de sntate pubIic
Prevalent crescut la nivel populational
Costuri directe si indirecte ridicate implicate de ngrijirea
obezittii
Complicatii multiple
FormuIe de caIcuI a greuttii ideaIe
Formula lui Broca: G = 100
Formula lui Lorentz: G = ( 100) ( 150)/4 (B)
G = ( - 100) ( 150)/2 (F)
Formula Societtii Asigurrilor Metropolitane din New York:
G = 50 + 0,75( 150) + (V 20)/4 (B)
F: G (B) X 0,9
Indici de apreciere a obezittii
IndiceIe de mas corporaI:
MC = G/
2
(n = 18,5 24,9 kg/m
2
)
IndiceIe abdomino-fesier:
AF = CA / CF (F: AF < 0,85; B: AF < 0,95)
IndiceIe abdominaI:
A = CA / (n < 0,5)
Grosimea panicuIuIui adipos n regiunea tricipitaI:
n < 20 mm (B); n < 30 mm (F)
A: n < 94 cm (B); n < 80 cm (F)
Iasificarea greuttii n functie de vaIoriIe I
(Kg/m
2
)
Subponderal < 18,5
Normal 18,5 - 24,9
Supraponderal 25 29,9
Obezitate gradul 30 34,9
Obezitate gradul 35 39,9
Obezitate gradul < 40
Iasificarea obezittii n functie de distributia
tesutuIui adipos
TipuI obezittii TaIia (cm) TaIia (cm) F
Abdominal
Gluteo-femural
< 94
< 94
< 80
< 80
#iscuI cardiovascuIar n functie de taIie si sex
Risc sczut Risc probabil Risc cert
Brbati < 94 94 101 < 102
Femei < 80 80 87 < 88
Iasificarea obezittii
riteriuI etiopatogenic
- obezitate primar
- obezitate secundar
riteriuI histoIogic
- obezitate hiperplazic
- obezitate hipertrofic
- obezitate mixt
riteriuI evoIutiv
- obezitate dinamic (faza de acumulare)
- obezitate static (de regul cnd a atins maximul ponderal)
Schema generaI de producere a obezittii
Factori genetici Factori cstigati
DezechiIibru energetic:
AportuI energetic > cheItuiaIa energetic
G
Acumulare de trigliceride n adipocite
G
- Crestere n greutate: obezitate
- Acumulare selectiv intraabdominal
de tesut adipos: obezitate abdominal
rganismuI normoponderaI aduIt
EA = EC (MB + TM + TR + ADS)
rganismuI obez
EA = EC + ED
EA = energie de aport
EC = energie de consum
MB = energie consumat pentru nevoile bazale
TM = travaliu muscular
TR = energie de termoreglare
ADS = actiunea dinamic specific a alimentelor
!rincipaIii factori de risc obezogen (1)
Factori genetici istoric familial de obezitate
Subnutritia mamei gestante, greutate mic Ia nastere a
ftuIui
StiI de viat nesntos alimentatie hipercaloric, alcool,
sedentarism, stress
Factori psihoIogici, sociaIi si cuIturaIi
- depresia, anxietatea F tulburri de comportament alimentar
- urbanizarea
- obiceiuri alimentare nesntoase
- lipsa actiunilor de educatie si prevenire la nivel populational
- mentalitti gresite
!rincipaIii factori de risc obezogen (2)
TuIburri de comportament aIimentar gustri
interprandiale de alimente bogate caloric, bulimie, binge
eating, night eating, carbohydrate-craving
Factori fizioIogici sarcin, lactatie, menopauz
Factori endocrini si hipotaIamici
edicamente
AIti factori ntreruperea fumatului n absenta unei diete
corespunztoare
ortaIitatea
Riscul cel mai mic: MC = 20 25 F 27 Kg/m
2
excesiv la MC > 30 Kg/m
2
MC sczut F neoplasme
MC crescut F boli cardio-vasculare
Durata medie de supravietuire F cu 10 ani mai mic
Efectul fluctuatiilor greuttii
ompIicatiiIe cardio-vascuIare aIe obezittii (1)
oaIa coronarian
Factorul determinant al riscului coronarian legat de
obezitate este cstigul ponderal de dup vrsta de 18 ani
Studiul Framingham obezitatea este si un factor de risc
independent, pe lng efectele sale asupra altor factori de
risc (HTA, hiperlipidemie, DZ)
Cu fiecare kg peste greutatea normal, riscul coronarian
cu 3,1 %
Obezitatea abdominal riscul cel mai mare
Sindromul X metabolic riscul exponential
ompIicatiiIe cardio-vascuIare aIe obezittii (2)
Insuficienta cardiac
De 2 X mai frecvent la obezi
Dat de HTA, boala coronarian, insuficienta respiratorie
secundar obezittii
Obezitatea factor de risc independent
AritmiiIe si moartea subit
Hipocrate moartea subit mai frecvent la obezi
Framingham obezitatea: factor predictiv
Obezii cu HVS excentric incident a aritmiilor de 10 X >
Tahicardie ventricular si fibrilatie ventricular
ompIicatiiIe cardio-vascuIare aIe obezittii (3)
Hipertensiunea arteriaI
44% dintre hipertensivi sunt cu greutatea > normal
Riscul de dezvoltare a HTA este de 3 X >
n greutate cu 10% F TA sistolic cu 6 mmHg
G ponderal la obezi F G TA
VariceIe membreIor inferioare
2/3 dintre cei cu varice sunt supraponderali sau obezi
Patogenie: - hipotonie venoas (tulb. hormonale,
sedentarism, ineficienta pompei)
- compresiune pe vena cav, vene iliace
Risc de tromboz venoas profund
ompIicatiiIe respiratorii aIe obezittii
Hipoventilatie F hipoxie si hipercapnie F tulburri nervoase
centrale (somnolent, convulsii)
Hipoxemia F poliglobulie secundar F volumul sanguin F
F HTP F CPC F VD F CCG
1956, Burnwell "Sdr. !ickwick obezitate marcat,
hipoventilatie, somnolent, uneori convulsii, cianoz,
respiratie periodic, policitemie secundar, HVD, CPC
decompensat
Pneumopatii acute si bronsite
Dispnee, chiar n lipsa insuficientei cardiace
Sindromul apneei n timpul somnului
ompIicatiiIe digestive aIe obezittii
Litiaza biliar
Angiocolecistite
Herniile hiatal, inghinal, ombilical
Steatoza hepatic
Hemoroizi
TuIburri endocrine
Distrofie ovarian (ovare polichistice)
Tulburri ale ciclului menstrual
Hiperestrogenism si hiperandrogenism la femei
Hipogonadism la brbati
ancereIe
La B: prostat, colorectal
La F: endometru, sn, ci biliare, col uterin, ovar
ompIicatiiIe metaboIice aIe obezittii
Diabetul zaharat
Hiperlipidemia
Hiperuricemia

ompIicatiiIe Ia niveIuI aparatuIui Iocomotor


Reumatism cronic degenerativ
Osteoartrite de sold si de genunchi
Boli periarticulare tendinite
ompIicatiiIe neuroIogice si psihice
Cefalee, vertij, astenie fizic
Tulburri psihice
ompIicatiiIe chirurgicaIe aIe obezittii
Risc chirurgical si anestezic mai mare
Risc de insuficient respiratorie, infectii ale plgilor,
dehiscenta plgilor, tromboflebite postoperatorii
ompIicatiiIe obstetricaIe aIe obezittii
Eclampsie, varice, tromboflebite, infectii urinare, diabet
gestational, mortalitate fetal crescut
Distocii
Retractie uterin ntrziat F hemoragii, soc; endometrite,
accidente mamare, pielonefrite
ompIicatiiIe cutanate
nfectii microbiene si fungice (intertrigo inghinal, axilar)
Eczeme
TratamentuI obezittii n functie de I
I (kg/m
2
) o-morbiditti Tratament
> 27 Da sau nu

Educatie privind schimbarea
stilului de viat
> 30 Nu Educatie si program de
modificare a obiceiurilor

> 30 Da

Educatie, program de modificare
a obiceiurilor si medicamente

> 35

Da sau nu Diet hipocaloric, medicamente
> 40 Da Toate cele enumerate anterior si
metode chirurgicale

!rincipiiIe tratamentuIui dietetic n obezitate


Glucide: 55-58%
Proteine: 15-17%
Lipide: 27-28%
NaCl: < 6 g
Fibre alimentare: 20-30 g
Colesterol: < 300 mg
Lichide: > 2 litri
5 mese pe zi
Mic dejun: 20%
Gustare: 15%
Prnz: 30%
Gustare: 15%
Cina: 20%
Tipuri de diete utiIizate n obezitate
Dieta cu deficit de 500 kcal/zi
Dieta cu deficit de 1000 kcal/zi
Dieta hipocaloric standard de 1200-1300 kcal/zi
Reducerea la jumtate din aportul caloric anterior
Dietele foarte hipocalorice sau restrictive sub 800 kcal/zi
#oIuI efortuIui fizic n tratamentuI obezittii
Creste sensibilitatea tesuturilor la insulin
Determin scdere n greutate si mentine greutatea dorit
Scade riscul cardiovascular
Scade necesarul de agenti farmacologici
Creste capacitatea de efort
Creste calitatea vietii
TratamentuI medicamentos aI obezittii
rIistat (XenicaI)
nhib selectiv lipaza gastrointestinal F G absorbtia
grsimilor cu 30% (TG si colesterol)
Actiuni si efecte
- reducerea greuttii pe seama masei grase
- reducerea taliei si a MC
- reducerea RCV prin reducerea celorlalti FR (G col total,
LDL, TG, ameliorarea tolerantei la glucoz, a TA)
#eactii adverse
- digestive (n conditiile unui aport lipidic crescut)
- G nivelului plasmatic al vitaminelor liposolubile
ontraindicatii sindrom de malabsorbtie
!osoIogie 3 x 120 mg / zi la mesele principale
TratamentuI chirurgicaI aI obezittii
Indicatii
MC < 40 kg/m
2
MC < 35 kg/m
2
cu comorbiditti
Vrsta ntre 18 si 60 ani
Esecul tratamentului conservator aplicat cel putin un an
Pacient care va coopera pe termen lung dup operatie
TratamentuI chirurgicaI aI obezittii
ontraindicatii
MC < 35 kg/m
2
Vrsta sub 18 ani sau peste 60 de ani
Obezitate de cauz endocrin
Dependenta de droguri sau alcool
Risc operator inacceptabil
Boli asociate grave: hepatopatie, cardiopatie, patologie
digestiv
Tehnici chirurgicaIe
Tehnici restrictive
- gastroplastia orizontal
- gastroplastia vertical
- bandingul gastric
Tehnici de maIabsorbtie
- by-pass-ul jejunoileal
- by-pass-ul bilio-intestinal
- by-pass-ul bilio-pancreatic
HiperuricemiiIe
Definirea termeniIor
Hiperuricemia
Artrita acut uric
Artrita gutoas cronic si tofii gutosi
(guta cronic tofacee)
Nefropatia uric
Litiaza renaI uric
EpidemioIogie
Prevalenta hiperuricemiilor - 2 18%
- n Romnia 4,2% la adulti
Prevalenta gutei - 0,13 0,37%
- 2 5% din totalul artropatiilor
Sexotropism masculin
Vrf de incident - decada a 5-a de vrst
Iasificarea hiperuricemiiIor
!rimare
- diopatic (> 99%)
- Defecte metabolice specifice mostenite (<1%)
Secundare
- Deficitul de glucozo-6-fosfataz (boala von Gierke)
- Hemolize cronice: anemii hemolitice, leucemii, limfoame
- Mecanisme renale
- insuficient renal familial progresiv
- insuficient renal cronic dobndit
- medicamente (diuretice, citostatice)
- produsi metabolici endogeni (lactat, corpi cetonici)
TratamentuI dietetic n hiperuricemii
Diet srac n purine
Tratamentul obezittii
Reducerea consumului de alcool
Diet lacto-fructo-zaharat
TratamentuI atacuIui acut de gut
Colchicina
ANS
Glucocorticoizii (po sau intraarticular)
NU hipouricemiante
Profilaxia recurentelor
!revenirea formrii depoziteIor tisuIare de urati
si diminuarea sau disparitia ceIor constituite
Inhibitorii biosintezei aciduIui uric
- allopurinol, oxipurinol, tiopurinol
edicatia uricoeIiminatoare
- probenecidul
- benziodarona
- sulfinpirazona
IndicatiiIe uricofrenatoareIor
- litiaza renal cert sau colici nefretice eliminare de
calculi n antecedente
- uraturie > 700 mg/24 ore
- coexistenta unor afectiuni care contraindic aportul excesiv
de lichide (R sever, sdr. nefrotic, HTA)
IndicatiiIe uricoeIiminatoareIor
- uraturie < 700 mg/24 ore
- absenta litiazei renale sau a colicilor renale n antecedente
- cnd hiperuricemia e datorat tratamentului diuretic al HTA
- cnd e posibil cura de diurez si alcalinizarea urinei
SindromuI X metaboIic
Definitia sindromuIui X metaboIic (IDF, 2005)
bezitate abdominaI (CA < 94 cm la B / < 80 cm la F)
+
Oricare 2 din urmtoarele 4 elemente:
TG 2 150 mg/dI
HDL < 40 mg/dI Ia si < 50 mg/dI Ia F
TAs 2 130 mm Hg sau TAd 2 85 mm Hg
GIicemie a jeun 2 100 mg/dI