Sunteți pe pagina 1din 196

Diabetul zaharat

Definiţie

•Sindrom heterogen caracterizat printr-o tulburare


complexă în reglarea metabolismului energetic al
organismului, care afectează deopotrivă utilizarea
glucidelor, lipidelor şi proteinelor, precum şi celelalte
metabolisme; aceste alterări sunt datorate insuficienţei
absolute sau relative de insulină. Modificările biochimice pe
care aceste tulburări le antrenează conduc la modificări
celulare funcţionale urmate de leziuni anatomice ireversibile
în numeroase ţesuturi şi organe.
Definiţie

• Nu este o “boală” în sensul tradiţional al termenului

• “Sindrom”
- alcătuit dintr-un grup heterogen de tulburări cu
etiologie şi patogenie diferite
- componentele sindromului au ca element comun
hiperglicemia
Etimologie

• “Diabeiu” (greaca veche) = “a se scurge ca printr-un sifon”


(aluzie la poliuria marcată a acestor pacienţi)

• Thomas Willis (medic, anatomist şi profesor la Oxford)


- a adăugat cuvântul “mellitus” (ca mierea)

Diabetes mellitus
(Diabet zaharat)
Presentation of the new
IDF DIABETES
ATLAS
WORLD DIABETES DAY
Numărul de persoane cu diabet zaharat în 2017 șiîn 2045

IDF Diabetes Atlas Eighth Edition 2017


Prevalența diabetului zaharat
Prevalenţa DZ şi a pre-diabetului în România – 2014
În România: 11,6% persoane cu diabet zaharat

Diabet
Prediabet nediagnosticat
18,4% 2,4%

Diabet
Diabet zaharat
11,6% diagnosticat
Glicemie normală 9,2%
69,2%

Mota M et al. Studiul PREDATORR. Prezentare la Congresul SRDNBM, Mai 2014


Pancreasul endocrin - noţiuni de anatomie şi
fiziologie

Insulele Langerhans

• 800.000 – 1.500.000
1 – 2 % din masa
pancreatică totală
• Celule: A, B, C, D
Hormonii secretaţi în celulele insulelor
Langerhans

Tipul Hormonul Efect pe metabolismul glucidic


celular produs
A Glucagon Hiperglicemiant prin glicogenoliză

B Insulină Hipoglicemiant prin mec. multiple


Peptidul C Efecte metab. incomplet cunoscute
Amilină Hiperglicemiant
C(PP) Polipeptid Influenţă pe motilitatea gastrică şi
pancreatic absorbţia principiilor nutritive
D Somatostatin Hiperglicemiant, inhibă secreţia
insulinei
Insulina – structură, sinteză, secreţie
Secreţia insulinei
Secreţia insulinei
• bazală  insulinemia plasmatică = 10-12 μU/ml
• stimulată  insulinemia plasmatică  50-75 μU/ml
Controlul hormonal al glicemiei
Insulina Hormoni de contrareglare
Efect net: scăderea glicemiei Efect net: creşterea glicemiei

 înlăturării glucozei din sânge  înlăturării glucozei din sânge


- intrării glucozei în celule - intrării glucozei în celule
- glicogenezei - glicogenezei
 eliberării glucozei din  eliberării glucozei din
depozite depozite
- glicogenolizei - glicogenolizei
- gluconeogenezei - gluconeogenezei
- lipolizei şi cetogenezei - lipolizei şi cetogenezei
- catabolismului proteic - catabolismului proteic
Clasificarea DZ (OMS,1998)
• DZ tip 1 - autoimun
- idiopatic

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet imun
- sindroame genetice rare

• Diabetul gestaţional
Diabetul zaharat tip 1

• Poate apare la orice vârstă, dar mai frecvent sub 30 ani


• Deşi există o predispoziţie genetică, majoritatea
pacienţilor nu au antecedente familiale de DZ
• Debut relativ abrupt, cu simptome evidente şi tendinţă la
cetoacidoză
• De obicei, pacienţii sunt slabi
• Rezultă în urma distrugerii celulelor -pancreatice
• Insulina plasmatică este foarte redusă sau absentă
• Anticorpi circulanţi: antiinsulină, anticelule , anti-GAD
• Pacienţii sunt “dependenţi” de insulină
Etiopatogenia DZ 1 autoimun

• Predispoziţie genetică
• Factor de mediu (viral, toxic, alimentar)
• Activare autoimună  insulită
• Scăderea capacităţii β-secretoare; afectarea fazei secretorii
iniţiale, dar insulinemia plasmatică este normală
• Diabet clinic manifest; insulinemie plasmatică scăzută,
hiperglicemie, apar simptomel
• Apariţia complicaţiilor
Diabetul zaharat tip 2

• Apare, de obicei, după vârsta de 40 ani


• 80% din cazuri: obezi
• Perioadă prediagnostică lungă
• Simptomatologie de debut ştearsă sau absentă, fără
tendinţă la cetoacidoză
• Asocierea a două defecte celulare: rezistenţa la insulină
şi deficienţa funcţiei -celulare
• Cel puţin iniţial, capacitatea secretorie -pancreatică
este relativ păstrată, răspunzând bine la dietă şi ADO;
ulterior, unii vor necesita insulinoterapie
Etiopatogenia DZ 2

• Factori genetici – transmitere poligenică

• Rezistenţă crescută la acţiunea insulinei

• Hiperinsulinism funcţional

• Deficienţă în secreţia insulinică  hiperglicemie persistentă

• Scăderea absolută a secreţiei insulinice 

 DZ 2 insulinonecesitant
Clasificarea DZ (OMS,1998)
• DZ tip 1 – autoimun (1A)
- idiopatic (1B)

• DZ tip 2

• Alte tipuri specifice - defecte genetice ale celulelor β


- defecte genetice ale acţiunii insulinei
- boli ale pancreasului exocrin
- endocrinopatii
- medicamente şi substanţe chimice
- infecţii
- forme rare de diabet imun
- sindroame genetice rare

• Diabetul gestaţional
Diagnosticul clinic al DZ

• Poliurie
• Polidipsie
• Polifagie
• Scădere ponderală
• Astenie
Caracteristicile generale ale DZ 1 şi 2
Particularitate Tipul 1 Tipul 2
Ereditate Concordanţă 30-50% Concordanţă 90%

Baza genetică Defect în programarea IR şi/sau insulino-


imunităţii deficienţă
Semne de Prezente Absente
autoimunitate
Debut Sub 40 de ani Peste 40 de ani
IMC Scăzut Crescut (80%)
Insulinemia Scăzută Crescută
plasmatică
Tendinţa la Marcată Absentă
cetoză
Tratament oral Ineficient Eficient
Criterii de diagnosticare a DZ
(diagnosticul paraclinic)

• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)


sau
• Prezenţa simptomelor şi o glicemie întâmplătoare (în
orice moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• N.B. - glicozuria NU este un criteriu de dg.


- NU se recomandă ca dg. de DZ să se bazeze pe
glicemii efectuate pe glucometre
- HbA1c NU se foloseşte pentru diagnosticul DZ
Criterii de diagnosticare a DZ
(diagnosticul paraclinic)

• Prezenţa simptomelor şi o glicemie întâmplătoare (în orice


moment al zilei) ≥ 200 mg/dl (11,1 mmol/l)
sau
• Cel puţin două glicemii a jeun ≥ 126 mg/dl (7 mmol/l)
sau
• O glicemie ≥ 200 mg/dl (11,1 mmol/l) la 2 ore după
administrarea a 75 g glucoză (TTGO)

• Criteriu nou – HbA1c ≥ 6,5%


Glucoza plasmatică versus glucoza din
sângele total

Glucoza din plasmă Glucoza din sângele total

126 mg/dl (7 mmol/l) 110 mg/dl (6,1 mmol/l)

200 mg/dl (11,1 mmol/l) 171 mg/dl (9,5 mmol/l)


Criterii de interpretare a glicemiei bazale

• 70-110 mg/dl – normal

• 110-125 mg/dl – glicemie bazală modificată

• ≥ 126 mg/dl – diabet zaharat probabil;


confirmarea se face după a doua dozare
Criterii de interpretare a TTGO
Glicemie în plasma venoasă
Diabet zaharat
- bazal ≥ 126 mg/dl (7 mmol/l)
- la 2 h după glucoză ≥ 200 mg/dl (11,1 mmol/l)

Scăderea toleranţei la
glucoză
< 126 mg/dl (7 mmol/l)
- bazal
≥ 140 mg/dl (7,8 mmol/l) şi
- la 2 h după glucoză
< 200 mg/dl (11,1 mmol/l)

Normal
- bazal < 110 mg/dl (7 mmol/l)
- la 2 h după glucoză < 140 mg/dl (7,8 mmol/l)
Modalităţi de debut şi de diagnostic ale DZ

• Pacient simptomatic
- simptomele clasice de diabet
- simptome ale complicaţiilor - acute
- cronice

• Pacient asimptomatic
- bilanţ al stării de sănătate
- depistare activă la subiecţi cu risc
Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici cu ajutorul glicemiei bazale (1)

• Toţi subiecţii cu vârsta ≥ 45 ani

• Glicemia à jeun se va repeta la intervale de minimum 3 ani


• Testarea se va face la vârste sub 45 ani şi se va repeta la
intervale mai scurte la toțisubiecții cu IMC ≥ 25 kg/m2 (IMC

≥ 23 kg/m2 la asiatici) care mai prezintă șialțifactori de risc


Indicaţiile screening-ului pentru DZ 2 la subiecţii
asimptomatici cu ajutorul glicemiei bazale (2)
Subiecți cu factori de risc:
- sedentarii
- persoanele cu rude de gradul I cu DZ
- grupurile etnice cu risc crescut
- hipertensivii (≥ 140/90 mmHg sau sub trat. antihipertensiv)
- dislipidemicii (HDL < 35 mg/dl şi/sau TG > 250 mg/dl)
- femeile care au născut copii cu greutatea peste 4,5 kg
- femeile care au avut diabet gestaţional
- femeile cu ovar polichistic
- persoanele cu HbA1c ≥ 5,7%, GBM sau STG la testări ant.
- alte condiții clinice asociate cu insulinorezistență (obezitate
severă, acanthosis nigricans)
- antecedente de BCV
Complicaţiile DZ

• Acute
- infecţiile
- comele - hiperglicemice - cetoacidozică
- hiperosmolară
- lactacidemică
- hipoglicemică
• Cronice
- microangiopatice
- macroangiopatice
- neuropatice
Infecţiile

• Frecvente la diabeticul dezechilibrat

• Predispoziţia către infecţii explicată prin modificări legate


de hiperglicemie:
-  mobilizării şi chemotactismului leucocitar
-  capacităţii fagocitare a polimorfonuclearelor
-  capacităţii bactericide a polimorfonuclearelor
-  funcţiilor monocitare
• Infecţii puternic asociate diabetului (quasi-specifice),
severe, dar foarte rare:
- mucormicozele
- otita externă malignă
- pielonefrita emfizematoasă
- colecistita emfizematoasă
• Infecţii postterapeutice:
-abcese insulinice, infecţii asociate transplantului renal,
dializei peritoneale, hemodializei
• Infecţii nespecifice asociate DZ:
- infecţii urinare: cistite, pielonefrite, abcese renale/perirenale
- infecţii respiratorii
- infecţii cutanate, mucoase, ale ţesutului celular s.c.
-altele: fasceita necrozantă, gangrena Fournier a organelor
genitale
Hipoglicemiile

• Definiţie – scăderea valorilor glicemiei sub 70 mg/dl în


plasma venoasă (sub 60 mg/dl în sângele venos total)

• Triada Whipple:
-simptome sugestive pentru hipoglicemie după post
prelungit sau exercițiu fizic
- documentarea unei valori glicemice scăzute
- corecția simptomelor după corecția valorilor glicemice

• Cauze - exces de insulină sau de ADO secretagoge


- scăderea aportului glucidic
- efort fizic excesiv
- consumul de alcool
Hipoglicemiile - fiziopatologie

• Mecanismele de apărare împotriva hipoglicemiei


- scăderea secreţiei de insulină
- creşterea secreţiei pancreatice de glucagon
- stimulare simpatică   secreţiei de catecolamine
- creşterea secreţiei de cortizol şi h. de creştere

• La pacientul diabetic
- scăderea secreției de insulină nu e un mecanism activ
-afectarea secreției de glucagon la DZ 1 cu o perioadă
lungă de evoluție
-diminuarea secreției de catecolamine prin neuropatie
vegetativă
Hipoglicemiile – manifestări clinice

• Semne periferice (de „alarmă adrenergică”)


- tremurături ale extremităițlor, transpirații, paloare,
tahicardie, palpitații, anxietate, foame, parestezii distale
• Semne centrale (de neuroglicopenie)
- tulburări de atenție, concentrare, memorie, coordonare,
comportament; oboseală, somnolență; tulburări de vorbire;
tulburări de vedere; parestezii peribucale; cefalee; contracturi
musculare localizate/generalizate; comă profundă, agitată
• Atenție:
- idiosincrazia manifestărilor hipoglicemice
-alterarea contrareglării adrenergice prin neuropatie
vegetativă
Hipoglicemiile

• Clasificare
–uşoare: recunoscute și corectate de către pacient, nu
afectează capacitatea de muncă șiinserția în mediu
–medii (moderate): afectează capacitatea de muncă și inserția
în mediu
–severe: totalitatea hipoglicemiilor care necesită intervenția în
urgență a unei alte persoane (tratament injectabil); includ, dar
nu se limitează la comele hipoglicemice

• Cazuri particulare
- hipoglicemiile neconştientizate
- hipoglicemiile nocturne
Complicaţiile hipoglicemiilor

• Accident vascular cerebral

• Infarct de miocard

• Tulburări funcţionale cerebrale minore

• Encefalopatia posthipoglicemică

• Hemoragii retiniene masive

• Decerebrare
Tratamentul hipoglicemiilor

• Tratament preventiv – educaţia pacientului diabetic

• Tratament curativ
- hipoglicemiile uşoare şi medii
- glucide rapid + lent absorbabile

- hipoglicemiile severe
- glucoză i.v.
- glucagon
- glucide rapid + lent absorbabile
Cetoacidoza diabetică - date generale

• Definiţie – triada - hiperglicemie


- cetoză
- acidoză

• F>B
• Vârsta medie 43 ani
• 20 % episoade multiple
• 20 % apar la diabetici nou diagnosticaţi
Fiziopatologia cetoacidozei diabetice
Insuficienţă absolută sau relativă
Lipoliză de insulină

Hiperproducţie de Proteoliză
corpi cetonici Accelerarea glicogenolizei şi
neoglucogenezei
Eliberarea de alanină
şi alţi aminoacizi
Acidoză metabolică
Hiperglicemie şi
glicozurie
Pierdere de apă, K+ PO-4, Creşterea ureei
baze tampon
Poliurie osmotică Hiperosmolaritate

Deshidratare Sete

Colaps Aritmie Polidipsie

COMĂ
Cauzele cetoacidozei diabetice

• Insulinodeficienţa absolută
- întreruperea insulinoterapiei
- cetoacidoză inaugurală (20%)

• Insulinodeficienţa relativă
- afecţiuni intercurente
- endocrinopatii: tireotoxicoza, sdr. Cushing, acromegalia
- iatrogen (corticoizi, simpatomimetice)
- sarcină
- stress
Tablou clinic

• Facies – vultuos
• Temp. cutanată 
• Semne neuromusculare hipotonie moderată, diminuarea ROT
• Semne de deshidratare cutaneo-mucoasă
• Semne cardiovasculare – tahicardie; TA e de obicei normală
• Semne respiratorii – halenă acetonemică, dispnee Küssmaul
• Semne digestive – grețuri, vărsături, dureri abdominale
• Starea de conştienţă – de obicei păstrată
Diagnostic paraclinic

• Hiperglicemie: 350 – 1200 mg%

• Hipercetonurie: > 30 mEq/l


Tratamentul cetozei incipiente

• Creşterea dozelor de insulină


• Hidratare corespunzătoare
• Băuturi reci îndulcite cu zahăr sau glucoză,
în cantităţi mici şi la intervale scurte
• Sucuri de fructe, supe de legume, ceai cu zahăr, compot
• Scăderea grăsimilor din alimentaţie
Tratamentul cetoacidozei avansate şi severe

• Combaterea tulburărilor hidroelectrolitice


• Combaterea tulburărilor metabolice (hiperglicemia)
• Combaterea tulburărilor acido-bazice
• Combaterea tulburărilor hemodinamice
• Combaterea factorului infecţios
• Măsuri nespecifice
- oxigenoterapie
- sondaj vezical
- sondă de aspiraţie gastrică
- heparină 5000 u/8h
- tratament etiologic
Mortalitatea în CAD severă

• < 0,5% în comele “simple”

• 5 – 15% în comele “complicate”

• 45% când este abolită starea de conştienţă


Coma hiperosmolară

• Definiţie
Absenţa cetoacidozei la un diabetic care are o
osmolaritate plasmatică hiperglicemică sau mixtă
(hiperglicemică şi hipernatremică) > 350 mOsm/l

• Osmolaritatea = (Na+ + 10) x 2 + glicemia /18 + ureea /6


(mosm/l)

• Frecvenţă
- 10% din comele diabetice hiperglicemice
Criterii de diagnostic

• Osmolaritate plasmatică > 350 mOsm/l


• Glicemie > 600 mg/dl
• pH > 7,25
• HCO3 > 15 mEq/l
• Semne de deshidratare masivă
Complicaţiile cronice ale DZ
Complicaţiile cronice ale DZ

• Microangiopatice
• Macroangiopatice
• Neuropatice
• Gangrena diabetică
• Alte complicaţii - hepatopatia dismetabolică
- cardiomiopatia diabetică
- parodontopatia
- complicaţii osteo-tendino-articulare
- osteoartropatia diabetică (piciorul Charcot)
- afectarea cutanată
În momentul diagnosticului DZ 2 un procent mare
din persoane au deja complicaţii cronice sau
asocieri morbide
80

70

60

50

40

30

20

10

0
Ob e z it. HT A DZ P BC V Re tin o p .d iab Nefrop.diab. Neurop.diab.

N. Hancu et al. Quality of care of newly-diagnosed diabetes mellitus:"EPIDIAB" program/lessons from the first
three years. Diabetologia 2003; 46(Suppl.2): A282.
Clasificarea neuropatiei diabetice

• Neuropatia subclinică

• Neuropatia clinică

• Periferică
• Vegetativă (autonomă)
Neuropatia subclinică

• Teste de electrodiagnostic anormale


- viteză de conducere nervoasă scăzută

• Testare cantitativă senzorială anormală


- vibratorie, tactilă, termică
Neuropatia periferică

• Polineuropatia distală simetrică


• Neuropatia diabetică acută
• Neuropatia diabetică hiposenzitivă
• Neuropatia motorie proximală a membrelor inferioare
• Mononeuropatiile
• Neuropatiile truncale
Polineuropatia distală simetrică

• Cea mai frecventă


• Tulburări de sensibilitate (hiperestezie sau hiposensibilitate)
• Membrele inferioare
• Evoluţie centripetă
• Disestezie
• “Anestezie dureroasă”
• Agravare nocturnă
• Semne de disfuncţie vegetativă
• Piele uscată / aspect pseudo-inflamator
• Sensibilitatea vibratorie / proprioceptivă
• Atrofie şi hipotonie musculară
Neuropatia diabetică acută

• Rară, dar caracteristică DZ


• Instalare acută
• Dureri intense în membrele inferioare
• “Caşexie neuropată”
• Insomnie
• Depresie
• Impotenţă
Neuropatia diabetică hiposenzitivă

• Lipsesc acuzele subiective


• Scădere / dispariţie a sensibilităţii dureroasă, termică,
vibratorie
• Alterare variabilă a funcţiilor vegetative
• VCN 
• Risc  de leziuni cutanate
• Evaluare cantitativă: determinarea pragului de electropercepţie
Neuropatia motorie proximală a membrelor
inferioare

• Rară

• Amiotrofii

• “Poliradiculopatia diabetică”

• Instalare acută / subacută

• “Topirea muşchilor”
Mononeuropatiile

• Cel mai frecvent:

nervii cranieni

• Cubital

• Sciatic popliteu extern


Neuropatiile truncale

• Rare

• Instalare acută sau progresivă

• Durere abdominală sau truncală unilaterală

• T3 - T12
Tratamentul neuropatiei periferice

• Echilibrare metabolică riguroasă


• AINS, analgezice opioide cu acţiune centrală
• Tranchilizante minore
• Carbamazepina, Gabapentin
• Antidepresive triciclice
• TENS, electroacupunctura
• Capsaicina
• Vitaminoterapia, benfotiamina, acidul alfa-lipoic
• Ionizări ale membrelor inferioare cu Xilină 1% şi vit. B1
• Balneofizioterapia (mofete, băi carbogazoase, ionizări)
Neuropatia vegetativă

• Neuropatia cardio-vasculară
• Neuropatia digestivă
• Neuropatia vezicală
• Tulburările sexuale
• Neuropatia pupilară
• Tulburările cutanate
• Hipoglicemiile neconştientizate
Neuropatia cardio-vasculară
Manifestările cardiovasculare ale neuropatiei

Cardiace Vasculare
Tahicardie cu ritm stabil Hipotensiune ortostatică
Infarct miocardic nedureros Tulburări circulatorii cerebrale

 intervalului QTc (>400 ms) Tulburări circulatorii ale


extremităţilor
Tulburări de ritm Edeme ale membrelor
inferioare
Moarte subită Fenomenul non-dipping
Accidente anestezice
Tratamentul hipotensiunii ortostatice

• Stoparea medicaţiei care exacerbează hipotensiunea


• Trecere treptată din clino în ortostatism
• Ciorapi elastici
• Creşterea moderată a aportului de sare
• Simpatomimetice (etilefrin - Effortil)
• Mineralocorticoizi (9--fluorohidrocortizon – 400 μg/zi)
• Antiinflamatorii nesteroidiene
• Derivaţii de ergotamină (DH-ergotoxină – 7 pic. de 3 X / zi)
• Agonişti ai receptorilor 1 - Midodrin – 2,5-10 mg/zi
• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o
Neuropatia digestivă

• Disfuncţia esofagiană (tulburări de motilitate)

• Disfuncţia gastrică: control glicemic dificil, plenitudine post-


prandială, sațietate precoce, anorexie, intoleranță digestivă totală în
formele severe (gastropareza diabetică)

• Disfuncţia intestinală: constipație neuropată, diaree neuropată


(accentuată nocturn, episoade de remisie/agravare, scaune
apoase, fără fenomene de malabsorbție), rar incontinență fecală

• Disfuncţia veziculei biliare (hipomotilitate, litiază biliară)


Tratamentul neuropatiei autonome digestive

• Gastropareza: control glicemic riguros (inclusiv pe termen


scurt), prokinetice

• Diareea neuropată: loperamid, eritromicină, clonidină

• Constipația neuropată: aport ↑ de fibre, prokinetice, lactuloză

• Acid alfalipoic - 600 mg/zi i.v. 10 zile, apoi 600 mg/zi p.o

Atenție: este necesară investigarea altor etiologii ale


manifestărilor digestive (diagnostic de excludere)
Neuropatia digestivă

• Disfuncţia esofagiană

• Disfuncţia gastrică

• Disfuncţia intestinală

• Disfuncţia veziculei biliare


Neuropatia vezicală
• Hipotonie ureterală
• Pareza vezicală
• “vezica neurogenă”

Tulburările sexuale
B – impotenţă - tulburări de erecţie
- ejaculare retrogradă
F – tulburări menstruale
Neuropatia pupilară
• Asimptomatică
• Măsurarea reflexului pupilar la lumină

Tulburările cutanate
• Anhidroză distală
• Hipersudoraţie compensatorie în ½ superioară a corpului

Hipoglicemiile neconştientizate
• Absenţa semnelor de “avertizare” a hipoglicemiilor
Macroangiopatia diabetică

Ateroscleroza – date generale

• Arterioscleroza
• Ateroscleroza
• Athero (terci) + sclerosis (induraţie)
• Istoric
• Localizare
Fiziopatologia aterosclerozei

• Ipoteza “răspunsului la injurie” (R. Ross)


Leziunile aterosclerotice

• Striurile lipidice

• Placa de aterom fibroasă

• Placa de aterom complicată


Diagnosticul clinic al aterosclerozei

• Faza preclinică, asimptomatică


- diagnostic de suspiciune
- modificări metabolice (hipercolesterolemia)
- factori de risc (fumat, HTA, DZ etc.)

• Faza clinică
- obstrucţie > 60-70% din lumenul arterial
- ischemie în diverse teritorii - coronarian
- cerebral
- membrele inferioare
- renal
- mezenteric
- particularităţile ATS la diabetici
Diagnosticul paraclinic al aterosclerozei

• Ecg
• Ecg de efort
• Scintigrafia cu taliu
• Ecocardiografia
• Angiografia
• Ecografia intravasculară
Microangiopatia diabetică

• Nefropatia diabetică

• Retinopatia diabetică
Nefropatia diabetică – date epidemiologice

• 50 % dintre pacienţii aflaţi în programele de supleere


renală au drept cauză a insuficienţei renale diabetul

• După 20 de ani  30 % dintre pacienţii cu DZ 2 dezvoltă


nefropatie

• 20% dintre cei cu nefropatie ajung la insuficienţă renală


terminală
Eliminarea urinară de proteine

Prin consens:

• Normoalbuminurie < 30 mg/24 ore

• Microalbuminurie – 30-300 mg/24 ore

• Macroalbuminurie > 300 mg/24 ore


Stadializarea nefropatiei diabetice

• Stadiul I – Hiperfuncţie şi hipertrofie renală

• Stadiul II – Silenţios, normoalbuminuric

• Stadiul III – Nefropatia diabetică incipientă

• Stadiul IV – Nefropatia diabetică patentă (clinic manifestă)

• Stadiul V – Insuficienţa renală cronică terminală


Evoluţia în timp a filtratului glomerular şi a
eliminării urinare de albumină
Diagnostic clinic

• Semne de HTA
• Semne de sindrom nefrotic, IRC
• Prezenţa altor complicaţii ale diabetului: retinopatie,
macroangiopatie, neuropatie
•  numărului de hipoglicemii nejustificate şi 
necesarului de insulină
Caracteristicile clinice ale diabeticilor
hipertensivi

•  presiunii pulsului arterial

• Hipotensiunea ortostatică

• Hipertensiunea nocturnă
Diagnostic paraclinic

• Rata filtrării glomerulare

• Eliminarea urinară de proteine

• Biopsia renală
Screening pentru nefropatia diabetică

• Microalbuminuria se evaluează la
diagnosticarea DZ şi apoi anual

• Creatinina serică trebuie dozată anual


Eliminarea urinară de proteine

normoalbuminurie microalbuminurie macroalbuminurie

Rata de excreţie
a albuminei < 30 30-300  300
(mg/24 ore)

Raportul
albumină/creati-
nină (mg/g)
Bărbaţi < 20 20-200  200

Femei < 30 30-300  300


Factori de risc pentru progresia
nefropatiei diabetice

• HTA

• Albuminuria

• Controlul glicemic insuficient

• Fumatul

• Consumul crescut de proteine

• Dislipidemia
Metode terapeutice

• Menţinerea unui control glicemic optim pe termen lung


• Tratamentul precoce al hipertensiunii arteriale
• Tratamentul dietetic
• Reducerea lipidelor serice
• Prevenirea şi tratamentul comorbidităţilor existente
• Tratamentul anemiei renale
• Profilaxia şi tratamentul bolii osoase renale
Retinopatia diabetică – date generale

• RD – unul din primele semne de afectare vasculară

• Prima cauză de cecitate – 20-74 ani

• Prevalenţa – corelată cu durata de evoluţie a DZ

• > 20 ani de DZ – toţi pac.cu DZ 1


> 60% pac. cu DZ 2
Fiziopatologia retinopatiei diabetice

• Alterarea compoziţiei membranei bazale



- extravazare - plasmă  edem
- hematii  hemoragii
- lipoproteine  exsudate dure

•  Pericitelor
- proliferarea cel. endoteliale
-  tonicităţii peretelui capilar  ectazii capilare 
 microanevrisme
Proliferarea cel. endoteliale + microanevrismele

Încetinire curent sanguin

 adezivitatea plachetară

Ocluzie capilară

Hipoxie retiniană

Stimularea angiogenezei

Vase de neoformaţie
Leziunile din RD (1)

• Dilataţia capilarelor
• Microanevrismele
• Hemoragiile intraretiniene
• Exsudatele dure
• Exsudatele moi
• Anomalii intravasculare intraretiniene
• Anomalii venoase
• Neovascularizaţia retiniană
Leziunile din RD (2)

• Hemoragiile preretiniene

• Hemoragiile vitreene

• Dezlipirea de retină

• Rubeoza iriană. Glaucomul neovascular

• Maculopatia diabetică
Clasificarea retinopatiei diabetice

• Retinopatie diabetică neproliferativă


- uşoară

- severă (preproliferativă)

• Retinopatie diabetică proliferativă


Diagnosticul retinopatiei diabetice

• Examenul FO
- oftalmoscopia directă
- biomicroscopia FO
- oftalmoscopia indirectă
• Angiografia cu fluoresceină
• Fluorometria vitreană
• Ecografia oculară
• Electroretinograma
• Teste de discriminare cromatică
• Adaptometria
Screening-ul retinopatiei diabetice

• Acuitatea vizuală poate fi normală chiar în prezenţa unor


leziuni avansate ale retinei  necesar screening
periodic pentru toate persoanele cu diabet

• Examenul oftalmologic se va face la depistarea


diabetului şi apoi anual

• Pacienţii cu retinopatie diabetică vor fi evaluaţi mai des


în funcţie de indicaţiile medicului oftalmolog
Frecvenţa examinărilor în funcţie de stadiul RD

Anomalii retiniene Urmărire la


Normal + rare microanevrisme Anual
RDNP uşoară 9 luni
RDNP moderată 6 luni
RDNP severă 4 luni
EMCS 2-4 luni
RDP 2-3 luni
Tratamentul medicamentos al RD

• Echilibrarea metabolică a DZ
• Evitarea hipoglicemiilor
• Vitamine A, E
• Extractul de ginkgo biloba
• Dobesilat de calciu
• Aspirina
• Tratamentul HTA
• IECA, Sartani, Sandostatin
Tratamentul chirurgical al RD

• Tratamentul laser
- panfotocoagularea laser
- tratamentul laser focal

• Vitrectomia posterioară

• Crioterapia
Alte afectări oculare în diabetul zaharat

• Cataractă
• Glaucom
• Infecţii
• Neuropatii de nervi oculomotori
•  adaptării la întuneric
•  discriminării cromatice
Piciorul diabetic - date epidemiologice

• 25% dintre bolnavii cu DZ internaţi sunt spitalizaţi pentru


complicaţii la nivelul piciorului

• 50-70% dintre amputaţiile netraumatice sunt la pacienţii


cu DZ

• Neuropatia diabetică este a doua cauză, pe plan


mondial, de durere neuropată, după lumbago
Fiziopatologia piciorului diabetic

Principalele modificări sunt


determinate de:
– neuropatie
– arteriopatie
Diagnostic diferenţial - simptome

Arteriopatia diabetică
Claudicaţie intermitentă
Durere de repaus
Durere spontană, brusc instalată

Neuropatia diabetică
Dureri de repaus, nocturne
Arsuri
Parestezii
Diagnostic diferenţial – semne clinice

Arteriopatia diabetică Absenţa pulsului, picior rece


Paloare la ridicarea membrului inf.
Roşeaţă la trecerea în ortostatism
Cianoză
Modificări trofice

Neuropatia diabetică Piele atrofică


Calus
Unghii distrofice
Deformări osoase
Picior cald
Reducerea/absenţa sensibilităţii
Absenţa reflexelor
Arteriopatia diabetică
Evaluare Echo-Doppler
Angiografie

Management Medicaţie
Exerciţii fizice
Trimitere la specialist

Neuropatia diabetică
Evaluare Monofilament
Sensibilitate vibratorie
Reflexe osteo-tendinoase

Management Controlul durerii


Trimitere la specialist
Examinare picior

Examen vascular periferic Examen neurologic

• palpare puls arterial • ROT


• examinare circulaţie venoasă • testare sensibilitate
• culoare tegumente - tactilă
• T° tegumente - termică
- dureroasă
- vibratorie
Prevenţia piciorului diabetic

Educaţia pacientului pentru îngrijirea piciorului


– Examinarea piciorului zilnic
– Îngrijirea pielii şi unghiilor
– Încălţăminte adecvată

Renunţarea la fumat

Identificarea deformărilor osoase

Evaluarea / ameliorarea controlului:


– Glicemiei
– TA
– Factorilor de risc cardiovascular
Important de reţinut în managementul piciorului
diabetic

• Claudicaţia intermitentă din angiopatie poate lipsi sau


poate fi estompată datorită neuropatiei

• Paradoxal, la începutul tratamentului hipoglicemiant


durerile se pot intensifica
Piciorul diabetic - concluzii

Inspecţia piciorului se va efectua la fiecare vizită iar examinarea


completă anual

Testarea sensibilităţii periferice la bolnavul cu diabet se face


anual

Se recomandă un control agresiv al glicemiei pentru a reduce


riscul apariţiei piciorului diabetic

Pacientul trebuie învăţat să-şi examineze piciorul si să-l


îngrijească

Se va trimite pacientul la chirurg, ortoped, dermatolog la


apariţia unei răni, infecţii, onicomicoze
Complicaţiile cutanate ale diabetului zaharat

• Dermatoze datorate diabetului zaharat şi complicaţiilor sale


- manifestări cutanate ale neuropatiei diabetice
- manifestări cutanate ale angiopatiei diabetice
- infecţiile cutanate

• Dermatoze datorate tratamentului specific diabetului zaharat

• Dermatoze asociate cu diabetul zaharat


Manifestări cutanate ale neuropatiei diabetice

• Tegumentul uscat
• Pierderea părului la nivelul gambelor
• Hiperhidroza
• Durilloamele şi hiperkeratoza plantară
• Hematoamele subungheale
• Venectaziile
• Edemul neuropat
• Ulcerele neuropate
Manifestări cutanate ale angiopatiei diabetice

• Dermopatia diabetică

• Necrobioza lipoidică

• Rubeoza facială

• Ulcerele arteriopate
Infecţiile cutanate

• Tinea pedis
• Onicomicoza
• Onicodistrofia
• Alte infecţii micotice cutanate
• Foliculite
• Furunculoze
• Fasceita necrozantă
Dermatoze datorate tratamentului specific
diabetului zaharat

• Lipodistrofia insulinică
• Alergia la insulină
• Reacţiile la ADO - eritem polimorf
- necroliză epidermică toxică
• Reacţiile lichenoide
• Infecţii cutanate la locurile de injectare (S. aureus)
Dermatoze asociate cu diabetul zaharat

• Buloza diabetică
• Scleredemul
• Acanthosis nigricans
• Xantoamele eruptive
• Vitiligo
• Granulomul inelar
• Carotenodermia
Evaluarea iniţială

Obiective
• evaluarea statusului bolii şi a factorilor de risc pentru
complicaţiile diabetului
• informarea pacientului despre natura şi severitatea bolii
• educaţia pacientului în legătura cu dieta adecvată,
exerciţiul fizic, medicaţie, automonitorizarea glicemiei
• stabilirea unui plan terapeutic
• stabilirea unui plan de monitorizare

Metode
- anamneză
- examen clinic complet
- investigaţii paraclinice
Examen clinic

• Greutate si înălţime, IMC (Kg/m²), circumferinţa abdominală


• TA
• Frecvenţa cardiacă
• Palparea tiroidei
• Examinarea cordului
• Examinarea piciorului
• Examinarea pielii
• Examinarea neurologică (reflexe, sensibilitatea vibratorie,
tactilă, termică, dureroasă)
Investigaţii paraclinice

• Glicemia bazală şi la 2 ore postprandial


• Colesterol total, LDL-colesterol, HDL-colesterol
• Trigliceride
• Acid uric
• Uree, creatinină serică, clearence-ul de creatinină
• Examenul de urină
• Microalbuminuria
• EKG
• Examen FO
• Radiografia toracică
• Ecografie abdominală
• Oscilometrie
Monitorizare
Evaluarea iniţială
Prima vizită Educaţia pacientului: informaţii asupra bolii
şi stilului de viaţă

Urmărirea rezultatelor automonitorizării


La fiecare glicemiei (dacă aceasta s-a făcut)
Măsurarea TA
consultaţie Măsurarea greutăţii / IMC şi a CA
Inspecţia piciorului
Determinarea HbA1c pentru evaluarea
La 3 luni controlului glicemic

Examen FO
Anual Depistarea microalbuminuriei
Profil lipidic
Evaluarea riscului pentru picior diabetic,
testarea sensibilităţii
Tratamentul diabetului zaharat

• DZ este o boală cronică

• Obiectivul principal: menţinerea parametrilor clinici şi


biochimici specifici cât mai aproape de normal

• Tratamentul trebuie privit în perspectiva speranţei de


viaţă
Criteriile unui bun control metabolic

• Glicemia preprandială: 80-110 (130) mg/dl


• Glicemia postprandială: 100-145 (180) mg/dl
• HbA1c: < 7% (selectiv 6,5 %, chiar 8% la pacienții cu risc)
• Colesterol total: < 200 (180) mg/dl
• LDL-colesterol: < 100 (70) mg/dl
• HDL-colesterol > 40 mg/dl (B), 50 mg/dl (F)
• Trigliceride a jeun: < 150 mg/dl
• TA < 140/90 mmHg (selectiv 130/80 mmHg)
• IMC < 25 kg/m2 (B), < 24 kg/m2 (F)
Importanţa controlului glicemic

Obiectivul principal al terapiei în DZ 2 este de


a obţine valori ale glicemiei cât mai aproape

de valorile normale, în scopul de a preveni şi

încetini apariţia complicaţiilor macro şi

microvasculare
Hemoglobina glicozilată

• “Standardul de aur” pentru monitorizarea glicemiei

• Reflectă o medie a valorilor glicemiei pe o perioadă


anterioară de 2-3 luni

• Se exprimă ca procent din totalul Hb (normal 4-6%)

• Se corelează bine cu valorile glicemiei

• Obiectiv realistic - Valoarea cea mai scăzută a HbA1c


obţinută fără reacţii adverse inacceptabile
Corelaţii între valorile Hb A1c şi glicemie

A1c (%) Media glicemiilor

6 135 mg/dl (7,5 mmol/l)


7 170 mg/dl (9,5 mmol/l)
8 205 mg/dl (11,5 mmol/l)
9 240 mg/dl (13,5 mmol/l)
10 275 mg/dl (15,5 mmol/l)
11 310 mg/dl (17,5 mmol/l)
12 345 mg/dl ( 19,5 mmol/l)
Avantajele HbA1c

• Evaluare obiectivă a controlului glicemic

• Se corelează cu riscul de apariţie a complicaţiilor

• Nu poate fi manipulată de pacient

• Neinfluenţată de modificările recente ale glicemiei ca


urmare a ingestiei de alimente
Automonitorizarea glicemiei

• Creşte complianţa la tratament şi are efect favorabil


asupra schimbării stilului de viaţă
• Frecvenţa se stabileşte în funcţie de pacient, stadiul bolii,
riscul evenimentelor hipoglicemice
• Ajută la individualizarea tratamentului şi adaptarea
măsurilor nefarmacologice
• Dezavantaje
– cost crescut
– disconfort fizic
Metode de tratament

• Tratamentul dietetic

• Exerciţiul fizic

• Tratamentul medicamentos (insulină şi/sau ADO)

• Educaţia specifică
Tratamentul dietetic

• Locul dietoterapiei în tratamentul DZ

• Obiectivele tratamentului nutriţional:


- menţinerea glicemiei la un nivel cât mai aproape de
valorile normale
- normalizarea profilului lipidic
- asigurarea unui aport caloric adecvat
- prevenirea şi tratarea complicaţiilor acute şi cronice
- creşterea calităţii vieţii printr-o alimentaţie adecvată
Recomandările nutriţionale generale pentru
pacientul diabetic

• Calorii
• Glucide: 55-60 % din aportul caloric
• Fibre alimentare: 30-40 g/zi
• Lipide: sub 30 % din calorii
• Colesterol: < 300 mg/zi
• Proteine: 12-15 % din aportul caloric
• Sodiu: < 6 g NaCl / zi; la hipertensivi < 3
g NaCl / zi
• Alcoolul
• Edulcorantele
• Vitamine şi minerale
Etapele alcătuirii unei diete

• Precizarea caracteristicilor generale ale dietei


• Calculul aportului caloric
• Distribuţia caloriilor pe cele 3 principii energetice
- 55-60 % glucide
- 25-30 % lipide (1/3 animale, 2/3 vegetale)
- 12-15 % proteine (1/2 animale, 1/2 vegetale)
• Distribuirea glucidelor pe numărul de mese precizat
- 20% - 10% - 30% - 10% - 20% - 10%
• Alegerea alimentelor
• Pregătirea corectă a alimentelor (reguli de gastrotehnie)
Factori care influenţează indexul glicemic

• Concentraţia în glucide a alimentelor


• Conţinutul de proteine şi lipide al alimentelor
• Conţinutul în fibre alimentare
• Prezenţa de amidon greu digerabil
• Mărimea particulelor de amidon
• Forma fizică a hranei
• Conţinutul hidric al alimentelor
• Temperatura alimentelor
• Prezenţa inhibitorilor enzimatici naturali, a fitaţilor şi taninelor
• Gradul de prelucrare mecanică prin masticaţie
Exemple de index glicemic

138% Glucoză
126% Miere
100% Glucoză 100% Pâine albă
90-99% Pâine integrală, piure de
cartofi, biscuiţi
80-89% Piure de cartofi, morcovi 80-89% Cartofi, banane
70-79% Pâine integrală, orez, cartofi 70-79% Chips-uri
60-69% Pâine albă, banane 60-69% Macaroane, spaghete fierte
15 minute
50-59% Spaghete fierte 5 minute, 50-59% Mere, portocale, mazăre
chips-uri
40-49% Mazăre, portocale 40-49% Spaghete fierte 5 minute,
lapte
30-39% Lapte, mere 30-39% Fructoză
20-29% Fasole păstăi, fructoză
10-19% Arahide, soia 10-19% Arahide, soia
Efortul fizic terapeutic - beneficii

• Scade glicemia şi HbA1c


• Ameliorează profilul lipidic
-  TG
-  LDL-colesterolul
-  HDL-colesterolul
• Ameliorează HTA uşoară şi moderată
• Adjuvant al dietei pentru scăderea ponderală
• Ameliorează factorii de risc cardio-vascular
• Creşte tonusul psihic şi calitatea vieţii
Efortul fizic terapeutic - riscuri

• Hipoglicemie
• Hiperglicemie şi cetoză la pacienţii insulino-deficienţi
• Precipitarea şi exacerbarea bolilor cardio-vasculare (angină
pectorală, infarct de miocard, aritmii, moarte subită)
• Agravarea complicaţiilor cronice ale DZ
- retinopatie proliferativă: hemoragii vitreene, deslipiri de retină
- nefropatie:  proteinuria
- neuropatie periferică: leziuni ale articulaţiilor şi ale ţes. moi
-neuropatie vegetativă: scade răspunsul cardio-vascular la
efort, hipotensiune ortostatică
Tratamentul insulinic

• Istoric

Nicolae Paulescu
1869 - 1931
Clasificarea insulinelor

• După provenienţă - animale


- de tip uman

• După durata de acţiune


- cu acţiune ultrarapidă (analogi)
- cu durată scurtă de acţiune
- cu acţiune intermediară
- cu durată lungă de acţiune
- insuline premixate
Insulinemia plasmatică la persoane cu diabet
zaharat tip 1 şi subiecţi sănătoşi

N=8 Subiecţi sănătoşi N=24 DZ1


480 Insulină umană regular
Analog rapid de insulină
400

320
pmol/L
240

160

80

0
07:00 12:00 18:00 24:00 06:00 h
Momentul zilei
Insulina LISPRO Humalog®

S S
A-chain 21

1
S
S

S S
1
B28 B29 30
LYS PRO
B-chain
Analogii rapizi de insulină

Glulisine
Analogii de insulină cu acţiune lungă

Insulina glargine
(lantus)

Insulina detemir
(levemir)
Preparate de insulină
• Cu acţiune ultrarapidă (analogi de insulină):
- NovoRapid
- Humalog
- Apidra
• Cu acţiune scurtă:
- Actrapid HM
- Humulin R
- Insuman Rapid
• Cu acţiune intermediară:
- Insulatard HM
- Humulin N (NPH)
- Insuman Bazal
• Cu acţiune lungă:
- Monotard HM
- Humulin L
• Analogi de insulină cu acţiune lungă:
- Lantus
- Levemir
• Insuline premixate:
- Mixtard 10 – 50 HM (Mixtard 30 HM)
- Humulin M1 – 5 (Humulin M3)
- Insuman Comb 25; Insuman Comb 50
• Analogi premixaţi:
- NovoMix 30
- Humalog Mix 25, Humalog Mix 50
Scheme de insulinoterapie

• Convenţională

• Intensificată
Insulinoterapia intensificată

• Insuline prandiale
• Insuline bazale
Administrarea insulinei

• Căile de administrare

• Dispozitivele de administrare

• Autocontrolul şi ajustarea dozelor

• Pompa de insulină

• Indicaţiile insulinoterapiei
Efectele secundare ale insulinoterapiei

• Hipoglicemia
• Lipodistrofia
• Abcesele la locul injecţiei
• Alergia la insulină
• Producţia de anticorpi la preparatele insulinice
• Creşterea în greutate
• Edemul insulinic
• Neuropatia dureroasă
• Scăderea acuităţii vizuale
Hiperglicemiile matinale

• Subinsulinizarea

• Fenomenul Somogyi

• Fenomenul de zori (Dawn phenomenon)


Tratamentul cu preparate non-insulinice

• Medicamente care cresc secreţia pancreatică de insulină


- sulfonilureice
- reglatori prandiali ai glicemiei
• Medicamente care scad rezistenţa la insulină
- biguanide
- tiazolidindione
• Medicamente care scad absorbţia intestinală de glucoză
- inhibitori de alfa-glucozidază
• Incretinele
• Inhibitorii de SGLT2
Medicamente care cresc secreţia pancreatică
de insulină (secretagoge)
Canalul KATP cu cele două componente: receptorul
sulfonilureic (SUR 1) şi canalul rectificator de K (Kir 6.2)

Ansamblul
canalului

Componenta SUR Componenta Kir 6.2


Închiderea canalului KATP prin
legarea unei molecule de ATP la
unul din cele 4 situsuri de pe SUR 1
Preparatele sulfonilureice

Agentul sulfonilureic Preparate comerciale Doza maximă


Generaţia I
- tolbutamid Tolbutamid; 500 mg 3000 mg
- clorpropamid Diabinese; 250 mg 500 mg
Generaţia a II-a
- glibenclamid Glibenclamid; 5 mg 15 mg
Maninil; 1,75; 3,5 mg 10,5 mg

- glipizid Glucotrol; 5 şi 10 mg 10 mg
- gliclazid Diaprel MR; 30 mg 90 mg
- gliquidona Glurenorm; 30 mg 90 mg
Generaţia a III-a
- glimepiride Amaryl; 1, 2, 3 şi 4 mg 6 mg
Sulfonilureicele
• Efecte secundare:
- Hipoglicemia
- Creșterea în greutate
- Reacții alergice
- Împiedică precondiționarea ischemică → creșterea riscului de
IMA?
• Alte contraindicații:
- DZ tip 1 sau alte forme de DZ cu cetoacidoză
- Sarcina șialăptarea
- Dezechilibrul glicemic marcat
- Insuficiență hepatică, renală (RFG < 30 ml/min)
- Intervenții chirurgicale majore
Reglatorii prandiali ai glicemiei

• Acelaşi mecanism de acţiune ca al sulfonilureicelor

• Durată scurtă de acţiune

• Risc hipoglicemic redus

• “O masă o doză, nici o masă nici o doză ”

• Preparate: - Repaglinida (NovoNorm; 0,5 – 1 – 2 mg)

- Nateglinida (Starlix)
Medicamente care scad rezistenţa la insulină
Biguanidele
• Mecanism de acţiune
- Reduc insulinorezistența (mai ales prin reducerea PHG)
- Ameliorează captarea periferică a glucozei
- Favorizează activitatea GLUT 4 și glicoliza anaerobă, inhibă
statusul proinflamator și protrombotic, reduc lipoliza etc.
- Posibilă ameliorare a RCV șia riscului neoplazic

• Preparate:
- fenformin
- metformin: Glucophage, Metfogamma, Meguan, Siofor (1 cp
= 500 mg, 850 mg, 1000 mg; doza max. = 3000 mg)
- buformin: Silubin Retard (1 cp = 100 mg; doza max. = 300 mg)
Biguanidele

• Efecte secundare:
- Efecte digestive (grețuri, vărsături, dureri abdominale, tulburări
de tranzit, balonări, anorexie)
- Acidoza lactică (doar când nu sunt respectate contraindicațiile)
• Contraindicații:
- Insuficiență hepatică
- Insuficiență renală (RFG < 45/30 ml/min)
- Insuficiență cardiacă (FE < 45%)
- Insuficiență respiratorie
- Investigații cu substanțe de contrast iodate (temporar)
- Anestezia generală (temporar)
- Altele: deficitul de Vitamina B12, hipersensibilitatea, hipoxia etc.
Tiazolidindionele (glitazonele)

• Mecanism de acţiune: PPAR  (peroxisome proliferator


activated receptors)
• Reduc IR (mai ales cea periferică)
• Determină redistribuția adipozității centrale, cu adipogeneză
periferică (adipocite mici, insulinosensibile)

• Preparate:
- troglitazona
- pioglitazona (Actos)
(1 cp = 15; 30; 45 mg)
- rosiglitazona (Avandia)
Tiazolidindionele
• Efecte secundare:
- Creștere ponderală
- Retenție hidro-salină
- Agravarea ICC
- Hepatotoxicitate (efect discutabil la TZD noi)
- Creșterea riscului de fractură de șold
• Contraindicații:
- DZ tip 1
- Sarcină șilactație
- Afecțiuni hepatice active (transaminaze peste 2-3 x v.n.)
- APP de ICC, SCA
- RCV peste 15% la calculul prin soft-ul UKPDS
Medicamente care scad absorbţia intestinală
de glucoză

Inhibitorii de alfa-glucozidază

• Mecanism de acţiune: inhibarea α-glucozidazei intestinale


(dizaharidază) → reducerea și întârzierea absorbției intestinale a
glucozei → ameliorarea hiperglicemiei postprandiale

• Preparate
-acarboza (Glucobay, 1 cp = 50; 100 mg; doza maximă = 300
mg)
- miglitolul
Inhibitorii de α-glucozidază

• Efecte secundare:
- Diaree
- Dureri abdominale
- Flatulență

• Contraindicații:
- Sarcină șilactație
- Afecțiuni gastrointestinale (boala Crohn, RCUH)
- BCR avansată
Locurile de acţiune ale agenţilor
antihiperglicemianţi
Sulfonilureice şi Tiazolidindione
repaglinida
Stimulează secreţia de
Scad rezistenţa la
insulină.
Repaglinida insulină
Se administrează în în ţesutul adipos şi
special la pacienţii cu muşchi. Scad GNG
glicemii postprandiale la nivelul ficatului.
crescute.
Inhibitori de  glucozidază Biguanide (metformin)
(acarboza)
Scad rezistenţa la insulină
Întârzie absorbţia intestinală în ţesutul muscular.
a carbohidraţilor. Scad GNG la niv. ficatului.
Incretinele
Secreţia de insulină după administrarea de glucoză
oral / intravenos

oral 200
intravenos 
90

 INSULINĂ (mU/L)
 GLUCOZĂ (mg/dl)

  150 
70 
  
50 
   100

30  
    
10  50 

  
-10 
 
-30 0 
0 15 30 45 60 75 90 0 15 30 45 60 75 90
TIME(min) TIME(min)

McIntyre et al, 1964


Efectul incretinic

“Ingestia de glucoză determină un răspuns insulinic mai


pronunţat decât glucoza administrată intravenos, indicând
prezenţa unor substanţe secretate de tractul
gastrointestinal care stimulează eliberarea de insulină
printr-un mecanism glucodependent.”

Creutzfeldt. Diabetologia 1985; 28: 565


Definiţia incretinelor

“Gut-derived factors that increase


glucose-stimulated insulin secretion ”

In cret in
● ●

Intestine Secretion Insulin

Creutzfeldt. Diabetologia 1985; 28: 565


Efectul incretinic la persoanele sănătoase
şi la pacienţii cu diabet zaharat tip 2
Persoane sănătoase Pacienţi cu DZ tip 2

Oral
IV Oral
Insulină (mU/l)

Insulină (mU/l)
IV

Timp (min) Timp (min)


Incretinele
GLP-1: Glucagon-Like Peptide 1

H A E G T F T S D V S S Y L E G Q A
A
R K V L A I F K
G G W E

GIP: Gastric Inhibitory Polypeptide


Glucose-Dependent Insulinotropic Polypeptide
A
Y E G T F I S D Y S I A M D K I H
Q
D N K G K A L L N F D Q
W K Q W V
K I T
H N Q

Drucker D. Diabetes Care 2003; 26: 2929


GIP
“Gastric inhibitory polypeptide”
“Glucose-mediated insulinotropic polypeptide”

GM: 4984

Eliberare: duoden, jejun, ileonul proximal

Acţiuni:
- inhibarea secreţiei gastrice acide
- stimularea secreţiei de insulină
- acţiuni insulin-like asupra metabolismului lipidic
GLP-1
“Glucagon-like peptide-1”

GM: aprox. 4000

Eliberare: intestinul subţire distal, colon

Acţiuni:
- stimularea secreţiei de insulină
- inhibarea golirii gastrice
- acţiuni insulin-like extrapancreatice
- inhibarea apetitului
GLP-1
Glucoza
Celula L

Enterocit
Hipotalamus:
 Apetitul

GLP-1

Pancreas:
Stomac:
 Insulina
 Motilitatea
 Glucagonul
GLP-1

Alimente… •stimulează secreţia insulinică


indusă de glucoză

• inhibă secreţia de glucagon

• inhibă golirea gastrică

Celulele L → GLP-1 • inhibă apetitul

• ameliorează insulinosensibilitatea

În studii experimentale…

• creşte masa β-celulară

Drucker DJ. Mol Endocrinol 2003; 17:161-171


Metabolism glucidic normal

Glucide alimentare
digestie
absorbţie

GIP + + GLP-1

Celula 

↑ secreţia de insulină  euglicemie


Diabet zaharat tip 2

Glucide alimentare

GIP  GLP-1

Celula 

Secreţie ↓ de insulină  hiperglicemie


Efectul administrării de GLP-1
în diabetul zaharat tip 2

Glucoză (mg/dl)
300 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 16

Glucose (mmol/l)
250
200 12
Glucoză 150 * 8
100 GLP-1 * *
* * 4
50 Placebo p<0.00*01 *
0 0
0 60 120 180 240
40 GLP-1 i.v. (1.2 pmol.kg-1.min-1) 250
Insulină (mU/l)

Insulin (pmol/l)
30 200
150
Insulină 20
* * * 100
10 * * * * * 50
p<0.0001
0 0
0 60 120 180 240
20 GLP-1 i.v. (1.2 pmol.kg-1.min-1)
Glucagon (pmol/l)

15

Glucagon 10

5 * * * * p=0.0009
0
0 60 120 180 240
Timp (min)
Nauck M et al. Diabetologia 1993; 36: 741–744
GLP-1

MMaesaăl

EIlnibteersatrineadle
GGLLPP--11
irnetelesatisneal

GLAPc-1tivaectiv
GLP-1

DPP-4

GLP-1
innaaccttivve

Ro.thenberg P et al. Diabetes 2000; 49 (suppl.1): A39


Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1


- Exenatida (Byetta)
- Liraglutida

• Inhibitori de DPP-4

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
Exenatida (Byetta)

• Gila monster (Heloderma


suspectum)
• Aprobat de FDA (2005) şi de
EMEA (2006) pt. trat. DZ 2
• Capăt C-terminal bogat în
reziduuri de prolină
• Acţiune de 10 ori mai intensă
decât a GLP-1 nativ
• T1/2 mai lung
GLP-1 şi Exenatida

GLP-1

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Exenatida

Eng L et al. J Biol Chem. 1992; 267: 7402


Exenatida (Byetta, Bydureon)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice
metformin + TZD
• Byetta
– Doza iniţială: 5 g x 2/zi
– Adm. sc cu (până la) 60 min. înaintea meselor principale
– După o lună, doza se poate creşte la 10 g x 2/zi

• Bydureon administrare o dată pe săptămână


Agonişti de receptor GLP-1
Soluţii farmacologice

• GLP-1 uman recombinant – infuzie s.c. continuă

• Agonişti de receptor GLP-1


- Exenatida (Byetta, Bydureon)
- Liraglutida

• Inhibitori de DPP-IV

Drucker. Diabetes Care 2003; 26: 2929


Dungan. Clin Diabetes 2005; 23: 56
GLP-1

MMaesaăl

EIlnibteersatrienadle
GGLLPP--11
inretelesatisneal

GLAPc-1
tivaectiv
GLP-1

DPP-4

Inhibitor de
DPP-4 GLP-1
innaaccttivve

Rothenberg P et al. Diabetes 2000; 49 (suppl. 1): A39


Inhibitori de DPP-4

• Sitagliptina (Januvia)
- inhibitor competitiv, reversibil şi înalt selectiv al DPP-4
- aprobată de FDA (2006) şi de ANM (2007) pt. trat. DZ 2

• Saxagliptina (Onglyza)
Sitagliptina (Januvia)

• Indicată în tratamentul DZ tip 2 necontrolat prin:


- monoterapie cu metformin, sulfonilureice sau TZD
- terapie orală combinată: metformin + sulfonilureice

• Doza recomandată: 100 mg/zi (doză unică), indiferent de


orarul meselor
Efecte adverse ale incretinelor

• Agoniștii de receptor de GLP-1


- greţuri şi vărsături (50% dintre pacienţi)
- dependente de doză
- se ameliorează pe parcursul tratamentului
- diaree
- hipoglicemii uşoare şi moderate (când se asociază cu SU)

• Inhibitorii de DPP-4
- cefalee
- susceptibilitate  pentru infecţii de căi aeriene superioare
Inhibitorii SGLT-2
Filtrarea glomerulară

Arteriola aferentă

H2O
Glucoza

Na+, Cl-, K+, HCO3-

Amino
acizi
Creatinina
Uree

Capsula Bowman

Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Arteriola aferentă Glucoza


Na+ Cl-,
K+,
H2O Amino
HCO3-
acizi

Tub contort proximal


Capsula Bowman
Arteriola eferentă
Reabsorbţia – la nivelul tubului contort proximal

Majoritatea glucozei
este reabsorbită de
către SGLT2 (90%)

Tub contort proximal

Glucoza
Glucoză restantă este Excreție a
reabsorbită de glucozei
către SGLT1 minimă pân
(10%) la absentă
Filtrarea glucozei
Inhibitorii SGLT2: O abordare inovativă, insulin-independentă,
de eliminare a excesului de glucoză
Reabsorbție
Reduced glucose SGLT2
scăzută a glucozei
reabsorption

Inhibitor SGLT2

Proximal tubule
Tub contort
proximal

Inhibitor
Excreție urinară
Increased urinary
SGLT2 crescută of
excretion a glucozei
excess
SGLT2 glucose ( 70
în exces(~70 g/zi,
g/day,
corespunzătorto
corresponding 280
Filtrarea kcal/zi*)
Glucose 280 kcal/day*)
glucozei

Inhibitorii SGLT2 inhibă în mod selectiv SGLT2


la nivelul tubului contort proximal

≈ 70g/zi
glucoza
Inhibitorii SGLT2: O abordare inovativă, insulin-
independentă, de eliminare a excesului de glucoză

Scăderi semnificative ale HbA1c

ELIMINARE
≈ 70g/zi
Pierderea a ≈280 kcal/zi Scădere ponderală
glucoza

Creşterea volumului
urinar cu ≈ 375ml/zi Scăderea tensiunii arteriale
Dapagliflozina

• Beneficii
- scăderea HbA1c
- scădere ponderală
- scăderea TA

• Efecte adverse
- risc crescut pentru infecții urinare șigenitale?
- risc de deshidratare șihipovolemie?
- risc de agravare a BCR / inducere a IRA prin deshidratare
Algoritmul de tratament în DZ 2

• Dieta şi exerciţiul fizic

• Antidiabetice orale

• Asocieri de antidiabetice orale

• Insulină ± antidiabetice orale


Preparate combinate de ADO
• Preparate combinate glibenclamid + metformin
Glibomet 2,5 mg/400 mg Glucovance 2,5 mg/500 mg
5 mg/500 mg

•Preparate combinate TZD + metformin


Competact 15 mg/850 mg

•Preparate combinate inhibitori DPP-4 + metformin


Janumet 50 mg/850 mg
50 mg/1000 mg
Komboglyze 2,5 mg/1000 mg
Individualizarea terapiei în DZ tip 2

Approach to the management


of hyperglycemia
Tinte mai ambitioas Tinte mai putin
more ambitioas HbA1c less
stringent 7% stringent
PATIENT / DISEASE FEATURES Atitudine pacienti
Risks potentially Pacienti
associated
mai putin
Pacienti motivati
with hypoglycemia and low motivati high
other drug adverse effects

Scazut Disease duration Crescut


newly diagnosed
Durata bolii long-standing

Scurta Lunga Usually not


Life expectancy
long
Speranta de viata short
modifiable

Lunga Scurta
Comorbiditati
Absente Important comorbidities
absent Severe few / mild severe

Complicatii CV
Absente Established vascular Severe
complications absent
Resurse
few / mild severe

Disponibile Absente

Patient attitude and


Adaptat dupa: Ismail‐Beigi, et al. Ann Intern Med 2011;154:554–9;
expected treatment Inzucchi SE, et al. Diabetes
efforts Care2012;35:1364–79.
highly motivated, adherent, ess motivated, non-adherent, Potentially
excellent self-care capacities poor self-care capacities
modifiable

Resources and support


Readily available limited
system
ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018
ADA-EASD consensus statement, 2018