Sunteți pe pagina 1din 404

misiune i valori

MISIUNEA RTC

Oferim clienilor confort i consultan n


procurarea ntregului necesar pentru birou, prin
excelen operaional i atitudine responsabil.

nseamn excelen
Dorim s simplificm viaa clienilor i s le oferim soluii pragmatice.
Pentru c n servicii simplitatea nseamn excelen.

SIMPLITATE

parteneriatul este de curs lung

PARTENERIAT

Cnd construieti cu ncredere, promii s te ii de cuvnt, s-i respeci


partenerul i s fii acolo cnd are nevoie de tine. Parteneriatul este
ntotdeauna de curs lung.

ambiia e creativitate,
motivare i asumare
Ambiia noastr de a reui ne face s fim mai creativi, mai motivai, mai
responsabili. Curajul n afaceri se msoar n soluii funcionale care vin
n ntmpinarea clienilor.

IMPLICARE

INIIATIV

s fii atent la nevoile


celor din jur
Implicarea ne face s fim mai responsabili, s avem grij la detalii
i s fim ateni la nevoile clienilor.

cu ncredere i bune relaii


poi cldi
Vrem s cldim pe ncredere i pe relaii bune. Prin ndrumare,
colaborare i plcerea de a lucra mpreun ajungem la rezultate comune.

RELAIONARE

pentru tine

Apeleaz cu ncredere la un
consultant RTC!

Ai toate motivele s colaborezi cu RTC.


Cu siguran oferta noastr te va convinge
c ai luat cea mai bun decizie.

Ai la dispoziie mai multe modaliti


de a ne transmite comanda ta.
Noi suntem mereu pregtii!

Poi alege toate produsele de care ai


nevoie dintr-un sigur loc.

Livrm comanda ta rapid i sigur,


n locul indicat de tine.

Poi s te bucuri de relaxare.


Vei avea o zi bun la birou!

curenie

protocol

La RTC gseti cea mai


diversificat gam de
detergeni, dispensere,
accesorii pentru curenie,
produse din hrtie i multe
alte articole pentru curenie
n toate spaiile de lucru ale
oricrui birou. Un real ajutor
profesional!

O selecie rafinat
de buturi calde i
buturi rcoritoare.
Pe lng acestea, de
la RTC poi achiziiona
snacksuri i gustri,
pentru o complet
servire ireproabil a
invitailor sau clienilor.

papetrie

Varietate de excepie a
categoriei de produse care te
ajut n activitile tale office.
Mrci renumite, caracteristici
remarcabile. Produse pentru
organizare, comunicare,
instrumente de scris, articole
din hrtie, accesorii pentru
birou i multe alte categorii
indispensabile oricrei activiti
productive. O adevrat plcere s
lucrezi!

tiprituri
IT
Avem cele mai noi tehnologii
n materie de echipamente IT i
telecomunicaii. Poi s contezi
pe RTC pentru o super gam de
aparate de ultim generaie!

echipamente
de protecie

Chitane, facturi, tipizate pentru


reete. Sunt doar cteva din
formularele pe care le poi
comanda la RTC. Pentru c gama
noastr e mult mai mare i
cuprinde de la popularele cri
de vizit, pn la flyere,
roll-upuri, caiete sau role pentru
case de marcat. Vezi categoria
complet de
tiprituri
promoionale
personalizate
la paginile
Personalizrile ofer o imagine
233 i 387 ale
profesionist companiei tale,

catalogului!

Dac lucrezi ntr-un


mediu cu grad sporit
de risc, avem soluia potrivit
pentru tine! Indiferent c este
vorba de antiere, depozite,
hale, service-uri auto sau
spitale, i oferim cel mai adecvat
echipament pentru protecia ta
personal.

fie c este vorba de articole


promoionale pentru angajaii
companiei tale, fie c alegi
s oferi cadouri remarcabile
partenerilor ti de afaceri.

schimb o via!

Cu 20 de ani de activitate i peste 15.000 de


beneficiari anual, SOS Satele Copiilor este
membr a SOS Kinderdorf International,
cea mai mare organizaie caritabil din
lume, cu sediul central n Austria.

FURNIZORI CARE SUSIN CAMPANIA "SCHIMB O VIA!"

CUM ALEGI PRODUSELE DIN


CAMPANIA "SCHIMB O VIA?"
Produsele care fac parte din campania Schimb o
via! sunt marcate specific n catalogul RTC: au
sigla dedicat "Schimb o via!" i sunt ncadrate
ntr-un chenar albastru, cu o latur ngroat.

N CEI DOI ANI DE CAMPANIE


AM COLECTAT MPREUN:

198.207 lei
V MULUMIM!

IMPLIC-TE N EDUCAIE!
MPREUN PENTRU COAL!
Din Septembrie 2013, mpreun cu furnizorii i clienii notri, dm un scop nobil activitii de
birou: susinerea educaiei copiilor care au primit mai puine anse, prin programul "Schimb o
via!". Am ales ca partener pentru iniiativa noastr SOS Satele Copiilor, organizaie umanitar
care ocrotete copiii ce nu pot fi ngrijii de proprii prini, asigurndu-le o familie substitutiv i
un cmin permanent, pn la integrarea lor social i profesional sau pn la reintegrarea n
familia natural.
CUM FUNCIONEAZ?
RTC, mpreun cu partenerii si, direcioneaz o parte din veniturile generate de produsele
care fac parte din programul Schimb o via! ctre SOS Satele Copiilor, care se va ocupa de
gestionarea lor n cele mai importante proiecte educaionale.
Cnd alegi un produs alege i s faci diferena n viaa unui copil care are nevoie de implicarea ta.
Alege s schimbi o via!
REZULTATELE CAMPANIEI
n cei doi ani de existen, campania a reuit s cumuleze 198.207 de lei, care au fost donai sub
form de rechizite colare copiilor aflai n centrele SOS Satele Copiilor din Bucureti, Hemeiu
(Bacu) i Cisndie (Sibiu). La nceputul anului colar 2014-2015, toi copiii din cele 3 centre SOS
din Bucureti i ar au primit rechizite noi, iar Crciunul i 1 Iunie au fost zile speciale, cu surprize
i cadouri pentru toi.
ALTUR-TE INIIATIVEI!
Amintete-i ct de important a fost aportul educaiei n viaa ta. Orice copil merit s aib parte
de coal. Alege s contribui la mbuntirea procesului de educaie din Romnia!

FURNIZORI CARE SUSIN CAMPANIA "SCHIMB O VIA!"

produse noi

articole noi n catalog


Le poi identifica uor cu ajutorul pictogramei de produs nou.
Echipamente de protecie
pag. 60-71

Detergeni Cif

Electrocasnice

pag. 37

pag. 58-59

Lmpi de birou

Vesel plastic metalizat

pag. 77

pag. 24

Becuri

Clipboarduri

Indeci

pag. 76

pag. 128

pag. 106

Band Tesafilm invizibil


pag. 161

Band adeziv transparent


pag. 162

produse noi
Pix BK-417

Pix Leitz Stylus Pro


Presenter pag. 190

pag. 192

Notie autoadezive galben pastel

Image Impact

pag. 247

pag. 224

Cub notie
autoadezive
pag. 245

Flipcharturi i table

Aviziere

Caiet Tranz

pag. 262, 272

pag. 266

pag. 257

Mouse i
tastaturi

Imprimant DURACARD ID 300


pag. 287

Ghilotin
Fusion

Promoionale
pag. 384-395

pag. 310-311

Distrugtoare Automax
pag. 324

pag. 322

Tiprituri personalizate
Aparat de laminat Neptun
pag. 334

pag. 387

logistic de top

Depozitul RTC este cea mai modern platform logistic din


industria de birotic-papetrie, la standardele celor mai
mari furnizori din Europa.
7.000 mp
2.000 ml de benzi conveioare
20.000 de comenzi procesate lunar
180.000 de linii de picking lunar
100.000 de colete expediate lunar
500 de palei expediai lunar

Beneficii clieni:
acoperire naional
livrri n 24 h
nivel ridicat de serviciu
transport asigurat

Livrm oriunde n Romnia!

ghid catalog

Cod produs

Descriere produs

Permite identificarea
produsului. Precizeaz acest
cod n comand!

Scoate n eviden
caracteristicile eseniale
ale produsului i/sau
ntrebuinrile recomandate.

denumire
subcapitol

tiai c?
tim multe din secretele
de culise ale produselor de
birou i abia ateptm s le
mprtim cu tine!

Chenar evideniere produse


care fac parte din campania
SCHIMB O VIA

foto aplicaie
produs

numr
capitol

denumire
capitol

Sfatul specialistului
Povestea unei mrci
caracteristic
special

numrul
paginii

Afl cum au ajuns celebre companiile care


astzi fac ca industria produselor pentru
birou s arate complet diferit fa de
acum 10, 20 sau... 100 de ani.

trimitere
ctre produse
complementare

Cele mai performante produse au de


multe ori caracteristici care este bine s fie
nelese corect, pentru ca tu s te bucuri
din plin de tot ce poate face acel produs
pentru activitatea ta de la birou.

PICTOGRAME
Produs nou n catalog

Produs din materiale


reciclate

Produs fabricat n
Romnia

Calitate superioar

Inele ptrate

Caracteristici sau utilizri


excepionale ale produsului
Garanie produs
(ani)

Raport excelent
calitate-pre

Capsare nchis

Tiere pe o singur direcie

Salvare energie

Capsare deschis

Tiere ncruciat

Tiere dreapt

Capsare tip cui

Capacitate de tiere

Tiere ondulat

Capsare plat

Nivel de securitate

Tiere cu perforaii

Capsare bypass

Tiere cri de credit

Biguire

Sistem de blocare a clapei

Format

Tiere CD/DVD

Piele natural

Numrul i tipul
de capse utilizate

Numr coli

Tiere agrafe i capse

Timp recomandat
de stat pe scaun

Capacitate de capsare

Densitate hrtie

Capacitate co

Disponibil la
comand special

capsare

Inele rotunde

Inele semirotunde

Capacitate de perforare

Prevzut cu distanier

Sistem antiblocaj capse

capsare
tip cui

capsare

capsare
bypass

cuprins catalog

index
Accesorii de prindere

Accesorii ergonomice

Botoei de unic folosin


172, 173
312-313, 382

Accesorii ndosariere i laminare

335-336

70

Boxe portabile

309

Burete pentru tabl

282

Burei pentru vase

49

Accesorii mobilier

382

Buretiere

173

Accesorii pentru arhivare

100

Buzunar magnetic

270

Buzunare autoadezive

100

Accesorii pentru table

280-283

Ace cu gmlie

172

Ace pentru tabl

283

Acoperitoare toalet

29

Acumulatori

74-75

Adezivi

167-169

Agrafe pentru birou

172

Alcool sanitar

43

Alonje de ndosariere

100

Alonje pentru cutii de arhivare


Alune

Cafetier
Caiete de birou
Caiete mecanice
Caiete i blocnotesuri
Calculatoare de birou
Calculator solar din silicon

24

Calgon

25

Can termoizolant din plastic

390

330-331

Capion

332-334

Cappuccino
Cappy

Articole pentru menaj

52-53

Capsatoare

216
57-58
266

Balsam pentru rufe

48

Band adeziv din hrtie


Band adeziv pentru ambalare
Band adeziv tip arici
Band autoadeziv
antialunecare
Band delimitare
Band dublu adeziv pentru
montare
Band electroizolatoare
Band magnetic

39
84
83-84
88
88
86
165
90
283

Baterii

74-75

Buturi rcoritoare

25-27

Becuri
Benzi adezive de marcare
Benzi adezive pentru birou
Benzi adezive pentru mascare

76
86
161-163
86

Benzi adezive speciale

86-90

Benzi corectoare

212, 213

Benzi dublu adezive

87, 164

Benzi dublu adezive buretate

87, 164

Biblioraft A3
Bibliorafturi
Birouri
Bocanci de protecie

38
390

28-31

Axion

389

Can termo

Articole curenie i igien

Aviziere

59
250-254,
256-260
101
250-254,
256-260
320-321

61

Ap mineral

Aspiratoare

18-20

390

Antifoane

Ascuitori

Corectoare

Can ceramic

81-85

Aparate de laminat

117

Ambalare

Aparate de ndosariat

Cafea

96
92-93, 95-96,
98-99
366
63

Consumabile IT
Container de arhivare pentru
bibliorafturi
Cooler pentru laptop
Coperi din carton pentru
ndosariere
Coperi din plastic pentru
ndosariere
Coperi pentru ine de prindere

69, 70
19
27
135, 137, 138,
139, 140, 141,
143-147
147

338-351
114, 115, 116
313
336
336
113
212-213

Corector cu rescriere

213

Couri pentru colectare selectiv


Couri pentru hrtii
Covor de protecie pentru
mochet
Creioane

54
55, 155
382
211

Creioane corectoare

213

Creioane mecanice

210, 211

Cuburi hrtie

248

Cuburi notie autoadezive


Cuiere

244, 245
371

Cutie colectoare

117

Cutii de arhivare

114-117

Cutii din carton

82

Cutii pentru chei

73

Cuttere

171

Capse

151

Decapsator
Detartrant
Detergent Ariel

Capse pentru tackere

151

Detergent pentru covoare

39

Capsule cafea

20

Detergent pentru mobil

37

Carcas CD

314

Detergent pentru toalet

Crlige adezive

89

Detergent pentru vase

Capsator cu bra

Carton pentru cri de vizit


Cartue cu cerneal originale
Crucior curenie
Casc de protecie
CD
Ceai
Ceas flexibil
Cif
Ciocolat
Cizme de lucru

227
342-344,
345, 347
52
61

44, 46

Detergeni oglinzi

44, 46

Detergeni pentru baie

40-41, 44
48

22, 23

Detergeni pentru pardoseli

36-37, 44

388
37, 40, 42,
44, 45
24
63

Clasoare pentru cri de vizit

129-132

Clipboard dublu

128

Clipboard simplu

128

Clipboarduri

128

Clipsuri

172
290
39, 40

Coca-Cola

26

Coloan rotativ pentru


bibliorafturi

371

Consumabile compatibile

47

Detergeni geamuri

Detergeni pentru buctrie

120, 370

Clor

40
45, 48

314

Clasificatoare metalice

Clipsuri pentru ecusoane

Detergeni diverse suprafee

151
40, 44
38

Detergeni pentru textile

38-39

Detergeni universali

42-45

Dezinfectant

43

Diluant pentru fluid corector

214

Dispenser band adeziv

85

Dispenser file de protecie

111

Dispenser hrtie igienic

29

Dispenser pentru agrafe de birou

173

Dispenser prosop din hrtie

28

Dispenser pungi igienice

30

Dispenser spun lichid


Dispensere pentru benzi adezive
de birou
Distrugtoare de documente
Domestos

350-351

31
160
324-326, 328
43, 44, 45

Dosar de prezentare

125

Dosare cu burduf

124

index
Dosare cu clip

125

Dosare cu guri

121, 122

Dosare cu multiperforaii
Dosare cu in

124
121, 122, 123

Dosare cu in i perforaii
Dosare de ncopciat

Formulare comune

Dosare din carton

121-123

Geni frigorifice

Dosare din plastic

124-125

Geni pentru laptop

Dosare plic

121, 122, 123

Dosare simple din carton


Dosare suspendabile

123
367

Halate

Dulapuri

367

Hard disk-uri externe

Dulapuri metalice

368-369

Hri

DuraFrame

268-269

Hrtie autocopiativ

Echipamente de protecie
personal
Ecrane de proiecie
Ecusoane

60-71
279
289

Elastice

81

Electrocasnice

58-59

393

Mnui latex pudrate

68, 70

293-297

Mnui pentru menaj

51

66, 67, 71

226-229
219-221,
223, 225
264

Hrtie reciclat

221
224

Etajere

367

Hub USB

389

Etichete bibliorafturi

Indeci

240

Index autoadeziv zig-zag

98, 99

Etichete multifuncionale
Etichete pentru marcatoare
Etichete textile de identificare
Europubele

Fanta

240

Fra

Info Sign

240, 289

Instrumente de scris Parker

54

Instrumente de scris pentru


personalizare

384-386

Instrumente de scris Senator

180-181

26
53

File de protecie cu burduf

107

File de protecie cu clap lateral

107

File de protecie cu fermoar

107

File de protecie orange peel


File de protecie pentru cri de
vizit
File de protecie pentru CD-uri

112

Flipcharturi
Fluide corectoare
Foarfeci

105
279

59

Fistic

104-106

335

Fierbtor

File din plastic

300, 302, 303

Inele de ndosariere

79, 80

ncrctor acumulatori
ndulcitor

110

Laptopuri

24
262-265
214-215
170

Lavete pentru curare IT


Lmpi pentru birou

201

Markere pe baz de vopsea

199

Markere pentru CD-uri

203

Markere pentru flipchart

196

Markere pentru tabl

196, 197

Markere permanente

202-207

Markere cu dou capete


Markere speciale

205
200-201
367

Masc chirurgical

69, 70

Maini de numrat bani


Mtur

308
53

Medii de stocare

314-315

392

179

Mese de conferin

366

Miere

23

Mine pentru creion mecanic


Minge anti-stres

74

Mobilier configurabil

364-365

Mobilier HORECA

381

Monitoare

299

Mop

52

Mouse

311

Multifuncionale

292
50, 51
318, 319
77

Lnior pentru ecusoane

290

Linere

189

Lingurie din plastic

Folie stretch

82

Lipici gel

169

24

Folii pentru laminare

335

Lipici lichid

169

211
389

Mouse pad
23

81

Folie cu bule

201

Markere industriale

Memorii flash USB pentru


personalizare

310

Lavete

Markere cu cret lichid

270

L
Lapte condensat

78-80

315

23

Kituri wireless

113

Marcatoare

Memorii flash USB

110

107-113

Mape transparente

Mas calculator

Indicator cu laser

241

126

277

227

Imprimante

Mape din carton

127

Hrtie i carton color

241

126

127

59

Etichete autoadezive multimedia


Etichete autoadezive rezistente la
intemperii
Etichete autoadezive translucide

126

Mape cu elastic

Mape pentru semnturi

227

51, 68, 70

Mape cu caps

Mape pentru coresponden

Hrtie pentru plottere

238-241

Mnui unic folosin

315

227

Hrtie operaional
Hrtie pentru copiator i
imprimant
Hrtie pentru flipchart

283
62, 68

29, 33

Hrtie n rol

Magnei pentru tabl


Mnui de protecie

174, 229

Hrtie calc

265

393

Espressor
Etichete autoadezive

M
Magic Chart

62, 68

35

167

Mnui cu aplicaii PVC

322

Hrtie igienic

287-290

Ecusoane de birou

Glade

Dulpioare mobile

314

24

Ghilotine

118-119

DVD

374-375

Furculie din plastic

Geni

Lipici solid

58

Fotolii directoriale

124
121, 122, 123

230-232

Frigider

Nescafe Dolce Gusto


Nestea
Notebook
Notie adezive zig-zag
Notie autoadezive
Notie autoadezive cu forme
pretiate
Notie autoadezive liniate

311, 312
301, 302,
303, 304
20
27
292
242
242-247
243
243

index
Ochelari de protecie

Rol industrial
60

Odorizant auto

35

Odorizant camer

35

Odorizant gel

35

Odorizant toalet

41

Odorizante

35

Organizatoare cu sertare

Pahare din plastic

153, 155

30

Rol medical
Rol pentru scame
Role din hrtie termic

30
51
228

Role fax

228

Roller adeziv
Rollere
Rucsac pentru laptop
Rucsacuri

24

erveele de mas

32

erveele pentru curare ecran

317

erveele umede antibacteriene

34

erveele umede pentru mobil

47

Saboi de lucru

Pantofi de lucru

63

Saci menajeri

56

69, 71

Salopete de lucru

65

Pastile autoadezive

168

Pastile pentru pisoar

41

Sandale de protecie

71

Pelerin impermeabil
Pelerine de ploaie pentru
personalizare
Pepsi

64

Sandwich maker

59

391

Spun lichid

31

Spunuri

34

Perforatoare
Pioneze

erveele

oruri unic folosin

175
52

tergtor podele

52

T
Table de conferin

Scaune vizitator

379-380

Table din fetru

Scurt impermeabil

64

Table din plut

373

Table magnetice

195

Seifuri

Pix cu touchpad i LED

385

Semimasc

61

Pix multifuncional

190, 279

Separatoare

102-103

Tablete

Pixuri cu gel

187, 188

Serviete

126

Tackere

Pixuri cu mecanism

190-192

Set carduri personalizate

287

Tastaturi

Pixuri fr mecanism

194-195

53

Sfoar

81

Plicuri cu protecie

237

Sisteme de afiare

Plicuri pentru CD-uri

235

Sisteme de prezentare

234-235

Sisteme PC

Plicuri pentru documente

236

Sit odorizant pisoar

Plicuri speciale

237

Smartphone

Port cri de vizit

132, 388

Powerbank

392

266, 268-270
284-286
298
41

51

tergtor geamuri

376-378

Set pentru curare toalet

24

272-274,
276-277
276
277
272, 273

Table mobile

271
306
147

Telefoane fixe

310
154, 155,
156, 157
309

Textmarkere

208-209

Tvie pentru documente

338-341, 345,
346, 348-349
65, 67,
394-395

Tonere originale
Tricouri

307

Snacksuri

289, 290, 388

tampile

Scaune operaionale

237

113

nururi pentru ecusoane

378

Plicuri cu burduf

391
32

ine de prindere

Pix cu suport

Plicuri pentru coresponden

293, 294

65

Scaune call center

312, 382

epci

Pantaloni cu pieptar

26
135, 137, 138,
139, 140, 141,
148-150
172

Suporturi pentru spate

154, 155, 156


153, 155, 156,
159
312, 382

168
182-184,
186-188

393

Suporturi pentru documente


Suporturi pentru instrumente
de scris
Suporturi pentru picioare

Trimmere

323

Soluie pentru curare table

281

Triunghi reflectorizant

Prjitor de pine

59

Spire metalice

336

Trus sanitar

72

Prelungitoare

77

Spray adeziv permanent

90

Tuburi fluorescente

76

317, 319

Tu pentru tampile

175

Tu pentru tuier

174

Tuier din plastic

174

Presenter

279

Prigat

27

Produse curare IT

316-319

Prosoape din hrtie

28, 32, 33

Protocol

23-24

Pungi igienice

30

Pungi ziplock

81

R
Rafturi pentru depozitare

371
259

90

Ulei pentru distrugtoare

328

Sprite

26

Umbrele

391

Stingtor

72

Usctor de mini

Suport card acces


216

319

47

Stocare date

Radiere

Registre

Spray curare IT
Spray pentru curare cu jet de
aer
Spray pentru ndeprtarea
adezivului
Spray pentru praf

72

314-315
288

Suport pentru cri de vizit

132

Suport pentru dosare suspendabile

119

Suport tablet

153

Rezerve pentru cutter

171

Suporturi cuburi hrtie

248

Rezerve pentru rollere

183

Rezerve tip Parker

195

Rigle

216

Suporturi etichete pentru chei


Suporturi pentru accesorii de
birou
Suporturi pentru birou

73
158-159
152-156

Vesel din plastic

31

24

Vest de semnalizare

64

Vestiare metalice

370

Videoproiectoare

278

Zahr

23

1. Protocol, curenie i administrative


cafea
ceai
protocol
buturi rcoritoare
articole curenie i igien
produse din hrtie
spunuri
odorizante
detergeni pentru pardoseli
detergeni pentru textile
detergeni pentru baie
detergeni universali
detergeni geamuri
detergeni diverse suprafee
detergeni pentru buctrie
burei
lavete

18
22
23
25
28
32
34
35
36
38
40
42
46
47
48
49
50

lavete i articole menaj


articole pentru menaj
colectare selectiv
couri pentru birou
saci menajeri
aspiratoare
electrocasnice
echipamente de protecie personal
truse sanitare, stingtoare
i triunghiuri reflectorizante
cutii pentru chei i accesorii
baterii i acumulatori
electrice
marcare
ambalare
benzi adezive speciale

51
52
54
55
56
57
58
60
72
73
74
76
78
81
86

cafea

cafea boabe

01

TIAI C?
Mirosul cafelei se afl printre
primele 10 cele mai uor de
recunoscut mirosuri.

Cafea Lavazza

PROTOCOL, CURENIE I ADMINISTRATIVE

Arom deosebit, adevrata cafea espresso.


Cod
FDEL001

Qualita Oro

Sortiment

Gramaj
250 g

FDEL905

Gran Espresso

1000 g

povestea unei mrci


Doncaf este cafeaua momentelor destinate ie, cnd ntre zeci de momente druite altora i iei un
moment pentru tine, n care te opreti, te liniteti i te ncarci cu energie pentru a continua ziua
- Momentul tu Doncaf. Gustul, aroma, armonia i echilibrul Doncaf se bucur de recunoatere
internaional - Doncaf este singura cafea din Romnia premiat de trei ori pentru calitate de
prestigiosul Institut German DLG.

Cafea Doncaf Selected


n lumea trepidant n care trim, avem nevoie de un moment pentru noi. Doncaf
Selected te invit s savurezi un amestec de boabe conceput special pentru gustul
romnilor. Recomandat pentru toate metodele de preparare, dar n special pentru
filtru i ibric, Doncaf Selected este perfect pentru momentele tale de pauz i
relaxare, iar gustul proaspt i aromat i va oferi energie pozitiv pe tot parcursul
zilei.
Cod
SR020001

Gramaj
600 g

Doncaf Espresso Crema Perfetta boabe


Doncaf Espresso Crema Perfetta este amestecul ideal de boabe de cafea atent
selecionate, realizat din cafele Arabica i Robusta de origini asiatice, africane i
braziliene. Avnd o culoare armie, specific procesului de prjire lent i ndelungat,
confer cafelei gustul de espresso autentic, cu o crem dens.
Cod
SR020003

Gramaj
1000 g

Grano Ricco Espresso Cremoso boabe


Grano Ricco Espresso Cremoso este o cafea boabe prjit cu o reet exclusiv italian, creat
special din cele mai bune sortimente de cafea, pentru un espresso deosebit, cremos i tare.
Boabele de cafea, atent selecionate, se contopesc ntr-un gust incomparabil i o arom
desvrit.
Cod
SR020005

18

Gramaj
1000 g

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

cafea

Cafea Jacobs Krnung


Jacobs este mai mult dect o cafea. Este o licoare puternic aromat, cu o textur
mtsoas ce-i rsfa simurile i pe care vrei s-o savurezi alturi de cei dragi.
Dincolo de inovaiile tehnologice, dincolo de simpla desftare, Jacobs Krnung
nseamn plcerea mprtit, regsit zi de zi, a Alintaromei. Delectndu-te cu
o ceac de cafea Jacobs Krnung, orice moment obinuit devine unul special.
Gramaj

FDTB002

500 g

250 g

Cafea NESCAF 3 n 1
Combinaia ideal de cafea, zahr i gust de lapte, readuce consumatorilor cheful de
distracie cu 1 gust de 3 x bun. Fiecare consumator poate nvinge plictiseala alegnd
plicul preferat din gama NESCAF 3 n 1: Original, Strong i Mild.
Unitate de vnzare: 24 buci/cutie.
Cod
NS000101

NESCAF 3 n 1 Original

Sortiment

NS000102

NESCAF 3 n 1 Mild

NS000103

NESCAF 3 n 1 Strong

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
FDTB001

Cafea NESCAF Cappuccino i Mochaccino


NESCAF Cappuccino, cu un gust autentic de cappuccino cu mult spum i
NESCAF Mochaccino, cu arom de ciocolat, vor aduce farmecul unei ore petrecute
pe o teras sau ntr-o oaz de linite, chiar la birou.
Unitate de vnzare: 10 plicuri/cutie.
Cod
NS000119

NESCAF Cappuccino

Sortiment

NS000118

NESCAF Mochaccino

Doncaf Cappuccino Classic i Hot Choco


Doncaf Cappuccino Classic. n orice moment al zilei, un rsf mereu la ndemn!
Cantitate: 10 g/plic. Unitate de vnzare: 24 plicuri/cutie.
Doncaf Hot Choco. Un gust fin, dulce, de ciocolat. O plcere irezistibil!
Cantitate: 18 g/plic. Unitate de vnzare: 24 plicuri/cutie.

Cod
SR030000

Doncaf Cappuccino Classic

Sortiment

SR040000

Doncaf Hot Choco

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

19

cafea
NESCAF Dolce Gusto Mini Me
Mica main NESCAF Dolce Gusto este un magician. Umple cu ap rezervorul,
introdu o capsul n suportul special i gata! Nu gunoi. Nu resturi. Doar cafea
excelent. n numai cteva secunde te poi bucura de o delicioas ceac de
cafea exact pe gustul tu, oricnd vrei!
Putere: 1500 W. Capacitate rezervor ap: 0.8 l. Presiune: 15 bari.
Tip butur: Espresso Intenso, Espresso Barista, Espresso Macchiato, Caffe lungo,
Latte macchiato, Cappuccino, Cafe au lait.
Culoare

NS000301

negru

NS000302

rou/gri

alb/gri

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
NS000300

NESCAF Dolce Gusto


Ristretto Ardenza
Mai scurt dect un espresso standard,
cu arom delicat i note de piper, are
un gust uor picant i intens.
Unitate de vnzare: 16 capsule/cutie.
Cod
NS000226

NESCAF Dolce Gusto


Espresso Intenso

NESCAF Dolce Gusto


Caff Lungo

Scurt, dens i aromat, cu un strat distins


de crem, Barista ofer luxul unei
cafele n stil italian oricnd i-o doreti.
Unitate vnzare: 16 capsule/cutie.

Espresso Intenso este o cafea profund


ca arom i gust, nvluit de un strat
catifelat de crem.
Unitate de vnzare: 16 capsule/cutie.

O cafea lung, cu o arom intens i


catifelat, ascuns sub un strat generos
de spum.
Unitate de vnzare: 16 capsule/cutie.

Cod
NS000216

NESCAF Dolce Gusto


Cafe Au Lait

NESCAF Dolce Gusto


Cortado Espresso Macchiato

Specialitate de cafea solubil cu lapte


praf integral. O combinaie delicioas
de cafea cu lapte ntr-o singur
capsul.
Unitate de vnzare: 16 capsule/cutie.

Espresso cu un strop fin de lapte, totul


ntr-o singur capsul. Acest Espresso
mbin gustul bogat i aroma rafinat
cu un strat fin de spum de lapte.
Unitate de vnzare: 16 capsule/cutie.
Cod
NS000217

Cod
NS000222

20

NESCAF Dolce Gusto


Espresso Barista

Cod
NS000211

NESCAF Dolce Gusto


Latte Macchiato Unsweetened
Produs din 100% boabe de cafea arabica
prjite i mcinate, Unsweetened Latte
Macchiato conine zaharuri naturale i
are aroma mai intens de cafea dect
Latte Macchiato clasic.
Unitate de vnzare: 16 capsule/cutie.
Cod
NS000213

Cod
NS000212

NESCAF Dolce Gusto


Cappuccino
Espresso cu o spum delicat, catifelat
i consistent. O experien de neuitat
gustului, care te va face sa revii la ea.
Unitate de vnzare: 16 capsule/cutie.
Cod
NS000214

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ceai

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Ceaiuri Lipton
Lipton, marca de ceai numrul 1 n lume, contribuie la contientizarea de ctre
consumatori a efectelor benefice pe care le au ceaiul negru i cel verde, datorit
coninutului de antioxidani din aceste varieti de ceai.

22

Cod
FDLI04

Sortiment
Ceai negru cu arom Earl Grey

25 plicuri x 2 g

FDLI05

Ceai negru cu arom Fructe de pdure

25 plicuri x 1.6 g

FDLI06

Ceai negru cu arom Cpuni

25 plicuri x 1.6 g

FDLI07

Ceai negru cu arom Lmie

25 plicuri x 1.6 g

FDLI22

Ceai negru cu arom Blue Fruit

25 plicuri x 1.6 g

FDLI08

Ceai verde Tchae Orient

25 plicuri x 1.3 g

FDLI18

Ceai verde cu arom de citrice

25 plicuri x 1.3 g

FDLI09

Ceai verde cu ment

25 plicuri x 1.6 g

FDLI17

Ceai infuzie Zmeur i Mcee

25 plicuri x 2.5 g

FDLI21

Ceai infuzie Frunze de Rooibos

25 plicuri x 1.6 g

FDLI23

Variety Pack (12 sortimente de ceai)

180 plicuri

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Cantitate

protocol
Ceai Belin
Ceaiurile din plante contribuie la crearea unui stri generale de bine, asigurnd
condiii optime instalrii unei senzaii de calm i relaxare, favorabile desfurrii
normale a activitilor intelectuale. Unitate de vnzare: 20 plicuri/cutie.
Sortiment

BI001001

tei

BI001002

suntoare

BI001003

glbenele

BI001004

mueel

ment

01

Zahr
Zahr cubic

Cristale de mrime medie, liber curgtoare. Dulce, fr miros sau gust strin.

Cod

Cantitate

Sortiment

FDAG01

1 kg

alb

Sortiment

FDAG02

5 g, 200 pliculee/cutie

alb

alb

FDAG05

5 g, 200 pliculee/cutie

brun

Zahr de un alb imaculat i avnd cristalele fine, ce l fac s se topeasc uor n butura
aleas: cafea, ceai, cocktail, buturi rcoritoare. Cantitate: 0.5 kg/cutie.
Cod
FDAG03

PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
BI001000

ndulcitor Clio
Clio este un nlocuitor al zahrului - practic, sntos
i fr calorii. Poate fi folosit deopotriv n dietele
diabeticilor sau de ctre persoanele care doresc s
evite zahrul n alimentaia zilnic.
Unitate de vnzare: 650 tablete/cutie.

Miere poliflor porionat 20 g

Cod
FDAG06

Cod
FDWH003

Este unul dintre cele mai preferate sortimente de miere pentru a fi consumate la mas,
avnd proprieti energizante i un bogat coninut n vitamine. Excelent pentru micul
dejun, ceaiuri sau consumul cu brnzeturi. Unitate de vnzare: 60 buci/cutie.

Lapte UHT

Lapte condensat pentru cafea

Lapte de consum UHT, 1.5% grsime.


Cantitate: 1 l.

Ingredientul perfect, ce poate fi consumat la cafea fr a-i lua acesteia din trie.
Cantitate: 10 x 10 g, 10% grsime. Unitate de vnzare: 10 buci/folie.
Cod
FDWH001

Cod
FDWH011

Oricare ar fi meseria ta, avem produsul potrivit.

23

protocol
Ciocolat After Eight
O inovaie n sine, After Eight i surprinde consumatorii nc din 1962, prin
combinaia perfect de ciocolat neagr cu umplutur delicioas de crem de
ment. After Eight este ciocolata care desvrete pauza de cafea i relaxare sau o
sear elegant petrecut n compania colegilor i a prietenilor.
Gramaj cutie: 200 g.
Cod
NS000100

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Alune i fistic

Snacksuri

Produse atent selecionate, pregtite dup o reet proprie. Pachetele sunt de diferite
gramaje i ambalate practic, potrivit oricrei situaii.

Srate i crocante, pregtite dup o reet original pentru a corespunde celor mai
exigente cerine.

Cod
FDIN006

Produs

Gramaj
200 g

Cod
FDIN013

Sortiment

alune srate

Mini Brezli Original

500 g

FDIN113

fistic

150 g

FDIN008

Maxi Mix

750 g

Gramaj

Vesel plastic metalizat


Vesel de unic folosin, realizat din plastic metalizat, cu aspect
argintiu.
Cod
IG5745
IG5721
IG5769
IG5813
IG1060
IG9475

Produs
cuite, lungime 19 cm
furculie, lungime 20 cm
linguri, lungime 18 cm
lingurie, lungime 13.5 cm
lingurie cafea, lungime 10 cm
castron plastic, margine
metalizat, 400 ml

Unitate de vnzare
50 buci/set
50 buci/set
50 buci/set
100 buci/set
50 buci/set
4 buci/set

Vesel plastic
Vesela de unic folosin este convenabil i practic: nu se stric, ocup
puin loc, este uoar i v ajut s facei economie de timp i detergeni.
Cod
GL000105
GL000804
IG9406
IG9407
IG94008
IG9405
IG9203
IG9201
IG9202
IG9204

24

Produs
pahar 200 ml
pahar 160 ml
farfurie plat
farfurie adnc
farfurii desert
beioare cafea
cuit
furculi
lingur
linguri

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Unitate de vnzare
100 buci/set
100 buci/set
50 buci/set
50 buci/set
50 buci/set
1000 buci/set
100 buci/set
100 buci/set
100 buci/set
100 buci/set

buturi rcoritoare

NTOARCEREA LA PURITATE

Apa mineral natural AQUA Carpatica izvorte din inima Bucovinei i aduce
puritatea munilor pe mesele de edin pentru un plus de creativitate. Designul
elegant, ct i motenirea romneasc pe care o reprezint, o fac alegerea ideal
pentru prime impresii de durat.
Cod
AC031003

Sortiment

Cantitate

carbogazoas

1.5 l

Unitate de vnzare
6 sticle/bax

AC031002

carbogazoas

0.5 l

12 sticle/bax

AC031001

plat

2l

6 sticle/bax

AC031000

plat

0.5 l

12 sticle/bax

Ap mineral
Extrase din regiunea protejat ecologic Vatra Dornei, apele Dorna sunt mbuteliate
cu mare grij pentru a pstra caracteristicile naturale ale apei, de la surs, pn n
momentul consumului.
Cod
FDCC28

Sortiment

Cantitate

Poiana Negri, carbogazoas 2 l

Unitate de vnzare
6 sticle/bax

FDCC0020 Dorna, carbogazoas


FDC001
Dorna, carbogazoas

0.5 l

12 sticle/bax

FDCC018

Dorna, plat

2l

6 sticle/bax

FDCO04

Dorna, plat

0.5 l

12 sticle/bax

2l

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Ap mineral

6 sticle/bax

Ap mineral
Consumul de ap mineral natural plat Bucovina asigur hidratarea corect cu
un aport optim de minerale, n orice situaie i la orice vrst, indiferent de tipul de
activitate depus.
Apa mineral carbogazificat Bucovina are un coninut redus de sodiu, gust plcut
i echilibrat, precum i proprieti deosebite de a lega i reine dioxidul de carbon,
asigurnd tranzitul de electrolii n organism, eseniali funcionrii normale a acestuia.
Cod
FDBC010

Sortiment

Cantitate

carbogazificat

2l

6 sticle/bax

FDBC011

carbogazificat

0.5 l

12 sticle/bax

FDBC020

plat

2l

6 sticle/bax

FDBC012

plat

0.5 l

12 sticle/bax

Unitate de vnzare

TIAI C?
Exist mai mult de 3.000
de mrci de ap mineral la
nivel mondial disponibile n
lumea ntreag.

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

25

buturi rcoritoare

povestea unei mrci

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Prima reet Coca-Cola a fost inventat n Atlanta, Georgia, de ctre un farmacist local,
John Styth Pemberton, la nceput ca un cocawine numit Pembertons French Wine Coca
n 1885. Primele vnzri au fost la Jacobs Farmacy din Atlanta, Georgia, pe 8 mai, 1886. A
fost vndut iniial ca un medicament brevetat, al crui pre era de cinci ceni. Pemberton
a publicat prima reclam pentru butur pe 29 mai a aceluiai an, n Atlanta Journal. n
primele opt luni doar nou buturi au fost vndute zilnic.
Prima mbuteliere de Coca-Cola a avut loc n Vicksburg, Mississippi, la Biedenharn Candy
Company n 1891. Coca-Cola a fost vndut n sticle, pentru prima oar pe 12 martie 1894.
Cutiile de Coke au aprut pentru prima dat n 1955.

Coca-Cola
Butur rcoritoare carbogazoas, cu un gust inconfundabil.

Coca-Cola zero
Butura rcoritoare cu acelai gust Coca-Cola de nenlocuit, dar cu Zero zahr.
n anul 2006 a fost lansat cu succes n 28 de ri din ntreaga lume.

Fanta
ntotdeauna surprinztoare, ntotdeauna nou, Fanta vine mereu n ntmpinarea
gusturilor tinerilor din ntreaga lume cu un numr impresionant de arome, forme i
idei noi de a savura timpul petrecut mpreun cu cei mai buni prieteni.

Sprite
zero calorii

Lansat n anul 1961, Sprite este liderul mondial al buturilor rcoritoare carbogazoase
cu arom de lmie i lime.
Cod

Sortiment

2l
FDCC006

Unitate de vnzare

Coca-Cola

6 sticle/bax

FDCC007

Coca-Cola Zero

6 sticle/bax

FDCC010

Sprite

6 sticle/bax

FDCC012

Fanta portocale

6 sticle/bax

0.5 l
FDC005

Coca-Cola

12 sticle/bax

FDCC069

Coca-Cola Zero

12 sticle/bax

FDC009

Sprite

12 sticle/bax

FDC011

Fanta portocale

12 sticle/bax

Pepsi
Butur rcoritoare carbogazoas. A fost produs pentru prima dat n anii 1890, de
ctre farmacistul Caleb Bradham n New Bern, Carolina de Nord.

26

Cod
FDPS001

Cantitate
0.5 l

12 sticle/bax

FDPS0005

1.25 l

6 sticle/bax

FDPS0006

2.25 l

6 sticle/bax

FDPS0007

2.75 l

6 sticle/bax

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Unitate de vnzare

buturi rcoritoare

Ceai Nestea Ice Tea

Cod

Sortiment

1.5 l
FDCC031

Unitate de vnzare

lmie

6 sticle/bax

FDCC032

piersici

6 sticle/bax

FDCO56

fructe de pdure

6 sticle/bax

0.5 l
FDCC045

lmie

12 sticle/bax

FDCC046

piersici

12 sticle/bax

FDCO57

fructe de pdure

12 sticle/bax

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Nestea este o combinaie de ceai atent selecionat, cu arome delicioase de fructe.


Acest ceai revigorant ready-to-drink este servit rece, oferind prospeime i un efect
revitalizant deosebit. Gust intens rcoritor i cu 30% mai puin zahr datorit puterii
de ndulcire a extrasului purificat din frunze de Stevia rebaudiana (de origine
natural).

Cappy Nectar
Cappy Tempo mbin aromele fructelor preferate n buturi rcoritoare i savuroase.
Cod
1l

Sortiment

Unitate de vnzare

CC001000

piersici

6 sticle/bax

CC001001

portocale

6 sticle/bax

Prigat Nectar
Un gust care te rsfa, o butur ca un desert. Prigat Nectar se produce prin
pasteurizarea produsului, ceea ce nseamn c nu este nevoie de conservani.
Cod

Sortiment

Unitate de vnzare

0.5 l
FDPS25

portocale

12 sticle/bax

FDPS35

cpuni - banane

12 sticle/bax

FDPS36

piersici

12 sticle/bax

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

27

articole curenie i igien

PROTOCOL, CURENIE I ADMINISTRATIVE

01

TIAI C?
Foarte multe boli i infecii provin
de la faptul ca oamenii duc mna
murdar la gur. Splatul pe mini
este o parte important n procesul
de prevenire a bolilor.

GARANIE

Dispenser auto-cut

Rol prosop auto-cut

Carcas fabricat din plastic alb ABS. Dispenserul este prevzut cu nchidere cu cheie
i vizor nivel. Capacitate: 1 rol midi. Kit de montaj inclus.
Dimensiuni (h x L x l): 40 x 31 x 25 cm.

Prosoape din hrtie, cu derulare central, fabricate din celuloz alb. Hrtia are 2
straturi, este gofrat i nesegmentat.
Dimensiuni (L x ): 120 m x 19 cm.

Cod
HX006000

Cod
HX006001

GARANIE

Dispenser rol prosop


derulare central

Rol prosop derulare central


Rol segmentat, hrtie de culoare alb.
Lungime: 100 m. Unitate de vnzare: 2 role/bax.

Material plastic ABS, ncuietoare


cu cheie. Kit de montaj inclus.

Cod
HX021000

Cod
HX000501

Tip

Caracteristici

celuloz

2 straturi laminate

GARANIE

Prosoape pliate din hrtie


Dispensere pentru prosoape pliate
Prevzute cu vizor de nivel i nchidere cu cheie. Capacitate de ncrcare dou seturi.
Kit de montaj inclus.

28

Gofrate, utilizare recomandat: trafic intens, industrial, retail etc.


Dimensiuni prosop: 25 x 23 cm.
Caracteristici

Material

Cod
HX000710

Produs

Cod
HX000200

erveele verzi

1 strat, 250 buci/pachet

inox

HX000712

erveele natur

1 strat, 250 buci/pachet

HX000201

plastic

HX000713

erveele albe

2 straturi, 160 buci/pachet

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

articole curenie i igien

GARANIE

Dispensere pentru hrtie igienic Jumbo

Hrtie igienic Jumbo

Prevzute cu vizor de nivel i nchidere cu cheie. Kit de montaj inclus.

Unitate de vnzare: 4 role/bax.

Cod
HX000100

Material

Cod
HX011000

Tip

Caracteristici

inox

celuloz

alb, 2 straturi, segmentat, lungime: 135 m

HX000101

plastic

HX013000

reciclat

natur, 1 strat, lungime: 120 m

TIAI C?

GARANIE

n 1857 americanul Joseph Gayetty


a inventat un produs destinat
toaletei care nu era fabricat
din hrtie, ci din ingrediente
vegetale mbibate cu aloe vera.
Foiele respective se vindeau ca
medicament in farmacii. Numele
inventatorului era inscripionat
pe fiecare foi.

Dispenser pentru hrtie igienic intercalat

Hrtie igienic intercalat

Realizat din material plastic ABS, nchidere cu cheie. Kit de montaj inclus.

Celuloz 100%, 210 buci/set.


Cod
HX000620

Cod
HX000202

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Caracteristici
2 straturi

Rezerv acoperitoare colac WC


Dispenser de acoperitoare toalet
Dispenserul pentru acoperitoare colac WC are carcasa fabricat din plastic ABS. Kitul
de montaj este inclus. Capacitate: 200 rezerve biodegradabile. Fabricat n Italia.

Rezerv acoperitoare colac WC, de culoare alb. Este fabricat din hrtie
biodegradabil. Este cel mai important accesoriu pentru igiena locurilor publice.
Unitate de vnzare: 200 buci/set.
Cod
HX000704

Cod
HX000703

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

29

articole curenie i igien

PROTOCOL, CURENIE I ADMINISTRATIVE

01
Dispenser pungi igienice

Pungi igienice

Dispenser pungi igienice pentru tampoane, cu carcas fabricat din plastic alb ABS.
Dispenserul este util n orice baie.

Rezerv pungue igien feminin, cu o capacitate de 25 buci/set. Suportul n care


se afl punguele este din hrtie cartonat.

Cod
HX000701

Cod
HX000702

Rol industrial albastr


Dispenser rol industrial
Confecionat din oel vopsit alb, n cmp electrostatic. Dotat cu lamel pentru tiere.
Cod
HX000503

Celuloz 100%, segmentat. Lungime rol: 180 metri, nlime rol: 38 cm.
500 de segmente, dimensiuni: 38 x 36 cm. Unitate de vnzare: 2 role/set.
Cod
HX000509

Caracteristici
3 straturi

Rol medical
Rol industrial albastr
Fabricat din hrtie reciclat, porionat, laminat i gofrat. Lungime rol: 200 m.
Dimensiuni segment: 23 x 25 cm. Unitate de vnzare: 2 role/set.
Cod
HX000507

30

Caracteristici
2 straturi

Rol medical tip cerceaf din hrtie, de unic folosin, de tip Medix 50 (pentru
canapea). Hrtia are 2 straturi i este din celuloz alb, gofrat, segmentat.
Lime rol: 50 cm. Lungime rol: 40 m.
Cod
HX000508

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

articole curenie i igien

GARANIE

GARANIE

Dozator spun lichid

Dozator spun lichid

Prevzut cu vizor de nivel i ncuietoare cu cheie. Kit de montaj inclus. Rezervor


rencrcabil, capacitate: 800 ml.

Prevzut cu vizor de nivel i ncuietoare cu cheie. Kit de montaj inclus. Rezervor


rencrcabil, capacitate: 800 ml.

Cod
HX000303

Cod
HX000304

Material
plastic

Material
inox

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Spun lichid cu dezinfectant Hygienium


Spun lichid
Spun lichid pentru splatul pe mini, cu miros plcut. Pentru utilizarea n
dispensere. Cantitate: 4 l.

Dezinfecteaz minile, distrugnd 99.9% din bacterii. Formul mbogit cu ageni


de condiionare a pielii, confer catifelare i ngrijire minilor. Testat i aprobat
de Institutul Naional de Cercetare-Dezvoltare pentru Microbiologie-Imunologie
CANTACUZINO. Cantitate: 5 l.
Cod
HY000301

Cod
SN040000

SFATUL SPECIALISTULUI
4 BENEFICII MAJORE ALE USCTOARELOR DE MINI

Usctor de mini Fluxo EcoLine


Acionare automat cu senzor. Usctorul are carcas fabricat din
aluminiu alb, este antivandalism i se recomand a fi folosit n
toaletele cu trafic intens.
Viteza aerului: 65 km/h.
Dimensiuni: (h x L x l) 23 x 27 x 21 cm.

1. Sunt igienice i sigure, meninnd ordinea i curenia. Toaletele rmn


curate i ordonate, nemaiexistnd problema courilor pline i a hrtiilor
aruncate peste tot.
2. Sunt economice i disponibile 24 de ore din 24, nu trebuie controlate, nici
umplute cu rezerve de prosoape.
3. Nu pot fi vandalizate. Un dispenser de hrtie poate fi rupt, iar rezerva de
hrtie aruncat. Usctoarele electrice n schimb, n special cele de inox, sunt
antifurt i antivandalism.
4. Salveaz natura. Fiind de regul acionate de senzori, imediat dup
folosire, usctoarele se opresc automat.

Cod
HX000919

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

31

produse din hrtie

povestea unei mrci

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Bazele mrcii Zewa au fost puse n ultima decad a secolului al XVIII-lea. Prima rol de hrtie a ieit de pe banda transportatoare a fabricii Zellstoff
Fabrik Waldhof din sudul Germaniei n anul 1884. ase decenii mai trziu numele Zewa a fost creat pornind de la iniialele acestei fabrici. n
anul 1960 s-a creat marca Zewa i a aprut pe pia prima gam de hrtie pentru igien de calitate superioar. Linia de produse a inclus hrtie
igienic, role de buctrie, scutece i bavete pentru copii, precum i prosoape sanitare. ncepnd din 1988, Zewa a pus mediul pe primul loc i
evitat utilizarea clorului n procesul de nlbire a fibrei
neprocesate, nlocuindu-l cu O2. n 2008, Zewa lanseaz
Campania Tiny Touches n 12 state, n format tiprit
i televizat. Cu sloganul A touch of care (O atingere
delicat), marca a reuit s impresioneze, artndu-le
oamenilor c, uneori, cea mai mic atingere poate s aib
un efect extraordinar.

SUPER
CALITATE

Prosoape de buctrie Zewa


Prosoape de buctrie Perletti
Calitate german, putere mare de absorbie.
Unitate de vnzare: 2 role/set.
Cod
IG5950

Caracteristici
2 straturi

Unitate de vnzare: 2 role/set.


Cod
TE20002

Caracteristici
2 straturi

SUPER
CALITATE

erveele cutie Gala

erveele Zewa Tissue


Dimensiuni: 21 x 20 cm. Unitate de vnzare: 100 buci/cutie.
Cod
IG5954

Caracteristici
2 straturi

Dimensiuni: 20 x 20 cm. Unitate de vnzare: 150 buci/cutie.


Cod
IG1103

Caracteristici
2 straturi

SUPER
CALITATE

erveele de mas

erveele de mas

Realizate din celuloz. Dimensiuni: 33 x 33 cm.


Unitate de vnzare: 100 buci/pachet.

Realizate din celuloz. Dimensiuni: 25 x 25 cm.


Unitate de vnzare: 100 buci/pachet.

Cod
IG001557

32

Caracteristici
1 strat

Cod
TE50011

Caracteristici
1 strat

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

produse din hrtie

Prosop de buctrie Dcor


Rol prosop din hrtie de calitate superioar, obinut printr-un proces de gofrare
deszle, segmentat, 2 straturi. Asigur eficiena a 10 role prosop clasice de uz casnic.
Ideal pentru tergerea geamurilor, suprafee lucioase, lavabile i orice alte tipuri de
suprafee. Lungime: 78 m.
Cod
PT000900

Caracteristici
2 straturi

Prosop de buctrie Midi


Prosop de buctrie, din celuloz 100%, segmentat, cu derulare central.
Lungime: 85 m.
Cod
GL000938

Caracteristici
2 straturi

3 straturi

Hrtie igienic Zewa

Prosop de buctrie Mini


Prosop de buctrie, din celuloz 100%, segmentat, cu derulare central.
Lungime: 60 m.
Cod
GL000918

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Caracteristici
2 straturi

Hrtie igienic de calitate superioar. Lungime: 21 m, 150 de segmente cu dimensiuni


de 14 x 10 cm. Culoare: alb.
Unitate de vnzare: 10 role/set.
Cod
IG5959

Caracteristici
3 straturi

3 straturi

Hrtie igienic Milde Relax

Hrtie igienic Pufina Soft

Hrtie igienic premium.


Unitate de vnzare: 8 role/set.

140 de segmente/rol.
Unitate de vnzare: 10 role/set.

Cod
MD000100

Caracteristici
3 straturi

Cod
HF000100

Caracteristici
2 straturi

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

33

spunuri

PROTOCOL, CURENIE I ADMINISTRATIVE

01
Spun lichid Palmolive
Gel antibacterian dezinfectant
Cur i protejeaz minile, omornd 99.9% din bacterii. Eficient mpotriva E.Coli.
Nu necesit folosirea apei i a spunului, ceea ce l face ideal de utilizat pentru
dezinfecia igienic a minilor atunci cnd splarea acestora nu este posibil.
Conine glicerin i extract de aloe vera. Cantitate: 300 ml.

Conine o combinaie unic de ageni i balsam care cur delicat pielea,


protejnd-o mpotriva uscrii excesive. Pielea devine hidratat i delicat.
Cantitate: 300 ml.

Cod
HY000300

Cod
LR000020

Milk&Honey

Sortiment

LR000021

Olive

LR000022

Orhidee

CALITATE
PRE

Spun Dove
Spun lichid
Conine combinaia perfect de ingrediente pentru a hrni pielea i a o cura
n acelai timp. Conine emolieni i extracte naturale care protejeaz i ajut la
hidratarea i catifelarea pielii. Cantitate: 500 ml.

Cu 1/4 crem hidratant i ageni de curare delicai, spunul-crem Dove las


pielea fin i catifelat i ajut la pstrarea nivelului optim de hidratare a pielii.
Gramaj: 100 g.

Cod
AV000500

Sortiment

Cod
DV000102

Original

Sortiment

liliac

DV000103

Sensitive

AV000501

miere

DV000104

Exfoliating

CALITATE
PRE

Spun Palmolive
Spun de toalet cu extracte naturale. ngrijire clasic
pentru o piele mtsoas i strlucitoare. Gramaj: 90 g.

34

Sortiment

Spun Teo

erveele umede antibacteriene

Cur i ngrijete pielea.


Gramaj: 75 g.

erveele igienice, umede, concepute special pentru


curarea i mprosptarea pielii. Produs hipoalergenic,
testat dermatologic i microbiologic. Cu glicerin i
vitamina E. Unitate de vnzare: 15 buci/pachet.

Cod
LR000001

Milk & Olive

LR000002

Chamomile & Vitamin E

Cod
IGCR28

Lily

LR000003

Milk & Rose

IGCR29

Magnolie

Sortiment

Cod
IG6001

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

odorizante

Aparat Automatic Spray


Aparat electric Essential Oil
Produsul elibereaz automat valuri delicate de parfum la intervalul de timp ales.
Pentru a regla intensitatea parfumului se poate selecta timpul de pulverizare (9, 18, 36
minute). Pentru un plus de prospeime se apas butonul de extra parfum.
Produs

Odorizant cu uleiuri naturale ce parfumeaz biroul n mod constant i uniform.


Intensitatea parfumului se poate regla dup preferine, cu ajutorul rotiei de pe aparat
i astfel v putei bucura de arome proaspete timp de mai multe sptmni.

Cod
JX000500

aparat Glade automatic cu rezerv Relaxing Zen

JX000501

aparat Glade automatic cu rezev Bali

Cod
IG5903

Love

JX000510

rezerv Relaxing Zen

IG5905

Lavand

JX000511

rezerv Bali

IG5913

rezerv Love

JX000512

rezerv Lavanda

IG5920

rezerv Lavand

Sortiment

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Microspray Bathroom
Odorizant gel
Odorizant pentru baie, cu aciune instantanee.
Conine un parfum concentrat. O singur apsare este
suficient pentru a parfuma plcut aerul, un timp
ndelungat.

Glade Gel a fost conceput special pentru a oferi o


prospeime continu i de lung durat. Poate fi folosit
n orice camer, dulap sau autoturism.

Odorizant cu aciune instantanee i de lung durat.


Este un produs care mprospteaz aerul din locuin,
repede i eficient. Cantitate: 300 ml.

Marin

Cod
IG5201

Marin

Lavand

IG5202

Lavand

IG5963

rezerv Marin

IG5205

Lcrmioare

Cod
IG5101

Lavand

IG5964

rezerv Lavand

IG5206

Relaxing Zen

IG5105

Lcrmioare

Cod
IG5961
IG5960

Sortiment

Sortiment

Odorizant spray

Sortiment

Odorizant auto

Odorizant camer lichid


Odorizant de camer ce neutralizeaz
mirosurile neplcute.
Cantitate: 350 ml.
Cod
SN000120

Odorizant lichid de main care alimenteaz constant i uniform arome proaspete n main deoarece
interacioneaz direct cu sistemul de ventilaie al mainii. Dispozitivul are un sistem de reglare a
intensitii parfumului. Pe intensitate medie de ventilaie, parfumul poate dura pn la 60 de zile.
Cantitate: 7 ml.
Cod
PG000500

odorizant Pacific Air

Sortiment

PG000501

odorizant Flowers and Spring

PG000502

rezerv Aqua

PG000503

rezerv Antitabac

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

35

detergeni pentru pardoseli

Detergent Pronto
Pronto Lemn curat cu spun detergent - pentru suprafeele din lemn, care trebuie
curate cu grij. Pronto detergent cu spun verde - pentru curarea suprafeelor
delicate: gresie, faian, marmur, granit. Formula sa delicat cur i ndeprteaz
mizeria i petele, fr s fie nevoie de cltire. Cantitate: 750 ml.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
IG5801

Lemn curat

Sortiment

IG5802

Detergent cu spun verde

Detergent Sano Floor


Ideal pentru orice tip de pardoseal, inclusiv gresie, marmur, linoleum, PVC.
Asigur o curenie riguroas a podelelor. Conine o formul special care
ndeprteaz insectele precum gndacii i furnicile. Cantitate: 2 l.
Cod
SN000600

Detergent Sano Poliwix Parquet


Detergent cu cear care cur, lustruiete, protejeaz parchetul laminat i podelele
din lemn natural. Coninutul de cear creeaz un strat lucios care protejeaz lemnul,
parchetul laminat i suprafeele sintetice. Cantitate: 2 l.
Cod
SN000500

Detergent Rivex Casa


Elimin i cele mai dificile pete, lsnd suprafeele curate i strlucitoare. Pentru
suprafee mari folosii dou cpcele de Rivex Casa la 5 litri de ap. Pentru suprafee
mici i greu de curat, folosii-l ca atare, nediluat. Cantitate: 1 l.

36

Cod
IGCR23

Flori smarald

Sortiment

IGCR241

Floral

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni pentru pardoseli


Detergent Cif pardoseli
Detergent pentru curarea pardoselilor lavabile. Cif confer strlucire suprafeelor i le
nvluie ntr-un parfum plcut. Cantitate: 1 l.
Cod
IG002200

Sortiment

IG002210

Lavand

IG002220

Orhidee

IG002230

Lemon

Ocean

PROTOCOL, CURENIE I ADMINISTRATIVE

01

SFATUL SPECIALISTULUI
CONDIII DE PSTRARE A DETERGENILOR
Nu depozitai detergenii n baie, deoarece
umiditatea i variaiile de temperatur nu le sunt
deloc favorabile. Condiiile ideale de pstrare sunt
spaiile uscate i reci.
Detergenii au i ei termen de valabilitate. n
condiiile n care nu sunt depozitai corect,
calitatea lor se poate deteriora drastic.

Detergent universal pardoseli i suprafee ceramice


Este un detergent cu acionare rapid, pe baz de alcool i substane tensioactive,
destinat currii suprafeelor din gresie i faian.
Cod
AV000300

Cantitate
1.25 litri
CALITATE
PRE

Pentru gama
de articole de
menaj consult
pagina 52!

Detergent pentru mobil i pardoseli din lemn


Produsul este destinat currii parchetului, a suprafeelor din lemn i suprafeelor
laminate. Conine un agent antistatic ce protejeaz suprafeele mpotriva depunerii
prafului. Rspndete un miros plcut de migdale.
Cod
AV000200

CALITATE
PRE

Cantitate (l)
1.25

Oricare ar fi meseria ta, avem produsul potrivit.

37

detergeni pentru textile

TIAI C?

01

nc de la apariia pe pia la nceputul anilor 60,


marca de detergent Ariel a cunoscut o rspndire
global rapid, fiind unul dintre primii detergeni
cu coninut de enzime pentru scoaterea petelor o
tehnologie revoluionar n acea vreme i care este
folosit i astzi. Nu ntmpltor, emblema Ariel este
menit s transmit mesajul de inovaie tiintific,
prin reprezentarea stilizat a unui atom.

PROTOCOL, CURENIE I ADMINISTRATIVE

Detergent Ariel pentru rufe


Ariel este partenerul ideal n curenie, chiar i pentru cele mai exigente persoane,
crora le rspltete loialitatea, oferindu-le rezultate impecabile i o protecie
ndelungat a culorilor.
Cod
PG000100

Sortiment

Cantitate (kg)

manual

1.8

PG000101

automat

PG000102

automat

TIAI C?
Unul din trei pachete de detergent
cumprate n Romnia poart
marca DERO. Asta pentru c este un
produs 100% romnesc, ce scoate
cele mai frecvente 99 de pete!

Detergent Dero pentru rufe


Prezent nc din 1966 n Romnia, DERO este un produs devenit clasic. DERO
cur bine hainele i le mprospteaz. Textura esturilor se pstreaz, iar
intensitatea culorilor se menine. DERO te ajut s ai hainele cu adevrat curate i i
mprospteaz ziua!

38

Cod
AQ010000

Sortiment

Cantitate

manual

400 g

AQ011001

manual

900 g

AQ021000

automat

400 g

AQ031000

automat

2 kg

AQ033000

automat

6 kg

IG00113

automat

14 kg

Detergent pentru rufe

Calgon automat

Detergentul este eficient de


la temperaturi de peste 300C.
Recomandat pentru rufe colorate.
Cod
Sortiment
HX004000
automat

Folosit la fiecare splare, Calgon protejeaz maina de splat mpotriva depunerilor


de calcar. Este singurul produs recomandat de principalii productori de maini de
splat.

Cantitate (kg)
10

Cod
RK000200

Cantitate (kg)
1

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni pentru textile

TIAI C?
Fiind un brand cu tradiie, Coccolino este cunoscut pentru efectul
de moliciune i pufosenie pe care l are asupra rufelor, ct i
prin faptul c este simbolizat de un personaj ndrgit, ursuleul
Coccolino. Prezent pe 23 de piee din ntreaga lume, Coccolino
este balsamul de rufe numrul 1 pe 14 dintre acestea, ce an de
an a inovat pentru a veni n ntmpinarea consumatorilor si.
Coccolino este prezent pe piaa din Romnia din 1996.

01

Folosirea balsamului de rufe Coccolino este recomandat la fiecare ciclu de splare,


fcnd hainele mai catifelate i mai uor de clcat. Datorit micro-capsulelor din
compoziie, balsamul de rufe Coccolino ofer rufelor o prospeime ce dureaz mai
mult timp.
Cod
AQ200200

Cantitate (l)
1.9

CALITATE
PRE

PROTOCOL, CURENIE I ADMINISTRATIVE

Balsam Coccolino pentru rufe

Clor Sano
nlbete i dezinfecteaz, cur i ndeprteaz grsimea, murdria i petele care
nu pot fi ndeprtate cu detergenii obinuii. Distruge bacteriile, ciuperca i mucegaiul.
Cod
SN000802

Cantitate (l)
2

SN000801

Clor
Produsul sporete eficacitatea detergenilor de rufe prin ndeprtarea petelor i
albirea rufelor.
Cod
IV000600

Cantitate (l)
1

CALITATE
PRE

Detergent pentru covoare


Biocarpet
ampon ce asigur o curare n profunzime a tuturor tipurilor de covoare, mochete,
tapierii, huse pentru scaunele mainii etc. Cantitate: 500 ml.
Cod
IGCR001

Detergent concentrat pentru curarea eficient a covoarelor, mochetelor i


tapieriilor textile. Poate fi utilizat fr restricii att la curarea manual, ct i
la cea mecanic, pentru meninerea cureniei. Rspndete un miros plcut,
parfumat.
Cod
Cantitate (l)
AV001000
1.25

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

39

detergeni pentru baie

TIAI C?
Baia, locul n care curenia i igiena
trebuie s vorbeasc de la sine, permite prin
condiiile de umiditate i temperatur ridicat
ca o singur bacterie s se poat multiplica
de pn la 8 miliarde de ori n 24 de ore.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Detergent Duck pentru toalet


Detergent Cif pentru baie

Duck Anitra detergent lichid pentru toalet cur, igienizeaz i mprospteaz


toaleta. Formula sa special a fost creat pentru a cura n profunzime, a ndeprta
depunerile de piatr, lsnd un parfum proaspt. Cantitate: 750 ml.

ndeprteaz uor murdria zilnic,


lsnd baia i duul strlucind de
curenie. Cantitate: 500 ml.
Cod
AQ020001

Cod
IG5601

Ocean

Sortiment

IG5602

Pine Fresh

Detergent pentru toalet Sano Bon

Detartrant Sano Bon

Formeaz un scut protector mpotriva depunerilor de calcar i mizerie.


Neutralizeaz mirosurile neplcute i parfumeaz.

Detartrant mbogit cu acid citric natural cu aciune de nlbire pentru vasul


toaletei. Cur, ndeprteaz depunerile de calcar i parfumeaz.

Cod
SN000803

Cantitate (l)
0.75

Cod
SN077101

Cantitate (l)
4

CALITATE
PRE

Clor dezinfectant Peak WC

Detergent gel pentru grupuri sanitare

Dezinfecteaz i omoar 99.9% din bacteriile din baie. Asigur o curenie maxim i
parfumeaz. nlbete si scoate petele de pe vasul de toalet.
Cod
IGCR22

40

Cantitate (l)
0.75

Igienizeaz, cur impecabil, previne depunerile de calcar i piatr.


Cod
AV000800

Cantitate (l)
0.75

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni pentru baie

01
Peak WC

Produs cu aciune tripl: cur cu fiecare jet de ap,


previne depunerea calcarului, mprospteaz pn la
4 sptmni.

Cur, dezinfecteaz i parfumeaz toaleta.


Ingredientele active din compoziia sa confer lui Peak
WC Block puterea de a cura, dezinfecta i parfuma
toaleta ntreaga zi. Cantitate: 40 g.

Cod
IG5301
IG5302

Cod
IGCR15
IGCR19

Sortiment
Ocean
Lavand

Sortiment
Frezie i Lcrmioare
Ment i Pin

Odorizant toalet Bon Blue


Odorizant solid pentru vasul toaletei, cur,
igienizeaz, spumeaz i coloreaz apa n albastru.
Rezist pentru 1.000 de utilizri. Cantitate: 55 g.
Cod
SN000102

PROTOCOL, CURENIE I ADMINISTRATIVE

Duck 3 n 1

Peak tablete
Cur, dezinfecteaz i mprospteaz toaleta de
fiecare dat cnd se trage apa. Coloreaz apa n
albastru i las suprafaa strlucitoare.
Cantitate: 2 x 50 g.
Cod
IGCR14

Odorizant toalet

Peak Out gel forte

Odorizant solid pentru bazinul toaletei.


Cantitate: 150 g.

Desfund rapid evile i sifoanele. Cur eficient i


elimin mirosurile neplcute. Cantitate: 500 ml.
Cod
IGCR271

Cod
SN000100

Sit odorizant pisoar

TIAI C?

Chiuveta are n jur de 100.000 de germeni


pe centimetru ptrat, iar capacul de la WC
are 100 de bacterii pe centimetru ptrat.

Pastile pentru pisoar


Cur, dezinfecteaz i nltur mirosurile
neplcute i difuzeaz un miros agreabil.
Ambalate individual. Gramaj: 20 g.
Cod
SN000115

Realizat din material cauciucat,


parfumeaz i mpiedic nfundarea
pisoarelor cu obiecte nedorite.
Eficien de pn la 60 de zile.
Cod
HX000908

Pastile pentru pisoar


Pastile cu efect dezinfectant, absorbant
de mirosuri. mpiedic formarea
depozitelor de calcar. Se utilizeaz n
bazinele de ap ale vaselor de toalet,
pisoare. Cantitate: 1 kg.
Cod
GL000504

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

41

detergeni universali
Detergent Cif Cream
Crem de curat pentru suprafee dure. ndeprteaz uor acele pete de murdrie
ce par imposibil de curat din toata casa, chiar i de pe suprafeele moderne.
ndeprteaz murdria dificil, precum: grsime ntrit, pete de cafea, urme de spun
i past de dini ntrite, vopsea de pr, machiaj, pete de rugin, calcar, plastilin,
markere lavabile. Cantitate: 500 ml.
Cod
IG00151

Cif Cream Ultra White

Sortiment

IG00152

Cif Cream Lemon

IG00158

Cif Cream Original

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Pentru mnui
de menaj
consult
pagina 51!

Cilit Bang
Sano X cream
Crem pentru ntreinerea cureniei n gospodrie, neiritabil, cu miros de lmie.
Este ideal pentru suprafee fine, nu zgrie i nltur foarte bine grsimea.
Cantitate: 700 g.
Cod
SN000814

Cod
RK000400

Cilit Bang portocaliu

Sortiment

RK000401

Cilit Bang verde

Detergent Cif pentru buctrie

Detergent Sano Anti Kalk Rust

Este un produs special creat pentru curenia buctriei. ndeprteaz uor grsimea i
murdria zilnic dup o singur aplicare, lsnd suprafeele strlucind de curenie i
degajnd un parfum plcut. Cantitate: 500 ml.

Detergent lichid, concentrat, mbogit cu acid, pentru curarea i eliminarea pietrei


i ruginei. Ideal pentru ndeprtarea depunerilor de calcar. Potrivit, de asemenea,
currii oelului inoxidabil, instalaiilor sanitare etc. Cantitate: 1 l.

Cod
AQ020002

42

Cilit Bang portocaliu - destinat suprafeelor, precum: robinete, chiuvete, czi de


baie, capete de du, vase de toalet i suprafee ceramice.
Cilit Bang verde - destinat suprafeelor, precum: aragaz, cuptor, blat de buctrie,
co de gunoi sau chiuvet. Cantitate: 750 ml.

Cod
SN000302

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni universali

Dezinfectant Domestos
nlbitor dezinfectant cu vscozitate ridicat - cur, dezinfecteaz, nlbete i
mprospteaz. Poate fi utilizat att concentrat (pentru toalet, canale de scurgere),
ct i diluat (pentru pardoseli, faian, obiecte sanitare i alte suprafee lavabile).
Cantitate: 750 ml.
Pine Fresh

IG00132

Atlantic Fresh

IG00138

White

01

Sortiment

PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
IG00131

fr clor

Dezinfectant universal multisuprafee Hygienium


Dezinfectant Igienol
Spray dezinfectant pentru suprafee i obiecte, distruge 99.9% din bacterii, dizolv
grsimea i depunerile de spun. Este sigur pentru suprafeele cu care copiii intr n
contact datorit faptului c nu conine clor. Cantitate: 750 ml.

Se utilizeaz n toate domeniile (uniti din industria alimentar, uniti de


alimentaie public, uniti sanitare, cree, coli, locuine) i dezinfecteaz complet
orice suprafa sau obiect. Distruge 99.9% din bacterii i fungii.
Nu conine clor. Testat i aprobat de Institutul Naional de Cercetare-Dezvoltare
pentru Microbiologie-Imunologie CANTACUZINO.

Cod
CR128040

Mr verde

Cod
HY000100

0.75

CR128050

Marin

HY000200

Sortiment

Cantitate (l)

Pudr universal Rivex


Alcool sanitar
Praf de curat pentru nlturarea petelor dificile. ndeprteaz eficient i fr efort
grsimea i resturile arse de pe obiectele din buctrie: cratie, tigi, aragaze i de
pe czile de baie, lsnd o strlucire de durat i un miros plcut. Arom de lmie.
Cantitate: 500 g.
Cod
IGCR25

Produs de concentraie 70%, recomandat igienei personale i ca dezinfectant pentru


suprafee, precum i n dotarea truselor de prim ajutor.
Cantitate: 500 ml.
Cod
IGCT101

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

43

detergeni universali
Cif detergent pentru baie 2 n 1
ndeprteaz calcarul, reziduurile de murdrie i spun, oferind un rezultat
strlucitor i un parfum proaspt, de lung durat. Recomandat pentru
czi de baie, cabine de du, chiuvete, WC, crom, inox, materiale plastice
i ceramice (nu este adecvat pentru marmur i alte suprafee sensibile la
acizi). Cantitate: 5 l.
Cod
JD000100

01

83

PROTOCOL, CURENIE I ADMINISTRATIVE

x8L

pn la 664 L soluie
gata de utilizat

Cif geamuri & suprafee


ndeprteaz rapid murdria i grsimea, lsnd suprafeele strlucitoare
i fr urme n cteva secunde. Gata de utilizat pe ferestre i suprafeele
interioare, inclusiv oglinzi, mese i alte suprafee dure. Cantitate: 5 l.
Cod
JD000101

Cif detergent universal pentru pardoseli


Detergent universal plcut parfumat, pentru curarea simpl i rapid
de zi cu zi a pardoselilor nelefuite, a pereilor, a suprafeelor vopsite, din
ceramic, laminate, a materialelor plastice i a tuturor celorlalte suprafee
lavabile dure. Are un efect puternic mpotriva grsimii i murdriei i nu
necesit cltire. Cantitate: 5 l.
Cod
JD000102

62,5
x8L

pn la 500 L soluie
gata de utilizat

Domestos detartrant pentru toalet


Cu formula sa care asigur o aciune de lung durat, dizolv rapid
depunerile de calcar, lsnd n urm o arom plcut. Este sigur n utilizare
pe suprafee vitrate i din porelan. Cantitate: 750 ml.
Cod
JD000200

44

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni universali

Domestos detergent dezinfectant


Detergent dezinfectant clorigen multifuncional, cu
proprieti de albire, conceput pentru igienizarea regulat a
suprafeelor lavabile i a obiectelor sanitare, precum i pentru
dezinfectarea i nlbirea la temperaturi sczute a articolelor
textile rezistente. Cantitate: 5 l.
Pin

Sortiment

JD000202

Lmie

Cif detergent de vase super concentrat cu


arom de lmie
Detergent lichid de splat vase, concentrat, pentru curarea oalelor,
tigilor, faianei, paharelor i a tuturor ustensilelor de buctrie.
Descompune grsimile i favorizeaz cltirea fr urme. Se pot obine pn
la 10.000 l de soluie gata de utilizat. Cantitate: 5 l.
Cod
JD000103

10.000 L

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
JD000201

Cif Professional
Detergent special conceput pentru curarea suprafeelor lavabile din
buctrii i bi. Se aplic pe suprafee utiliznd o lavet curat sau un
burete. Se cur i se cltete rapid dup utilizare. Cantitate: 2 l.
Cod
JD000104

Cream

Sortiment

JD000105

Cream Lemon

Cif crem pentru mobilier


Preparat aplicabil prin pulverizare pentru ntreinerea uoar i rapid
a mobilei i a suprafeelor dure laminate. Cur petele persistente,
mascheaz zgrieturile, reface luciul, creeaz un strat de protecie care
previne murdrirea i depunerile de praf pentru mult timp. Are o formul
special cu ingrediente de nalt calitate care confer un miros plcut i
proaspt. Cur, d strlucire i protejeaz ntr-un singur pas.
Cantitate: 750 ml.
Cod
JD000106

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

45

detergeni geamuri

Detergent Sano pentru geamuri


Lichid multifuncional de curat, excelent pentru curarea i lustruirea geamurilor,
parbrizelor, oglinzilor, faianei, plcilor ceramice, suprafeelor de plastic, crom, email
etc.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
SN000400

pulverizator, cantitate 1 l

Produs

SN000403

rezerv, cantitate 750 ml

CALITATE
PRE

Detergent Rivex pentru geamuri


Detergent pentru geamuri i oglinzi
Datorit formulei sale speciale, Rivex Glass cur uor i eficient suprafee din
sticl, melamin, email, aluminiu, plastic i geamuri auto, lsnd suprafeele
strlucitoare, fr urme. Cantitate: 750 ml.
Produs

Este un detergent pe baz de alcool destinat currii geamurilor, oglinzilor i altor


suprafee din sticl. Cantitate: 750 ml.

Cod
IGCR002

Cod
IV000100

Produs

pulverizator

IGCR16

rezerv

IV000101

rezerv

pulverizator

Detergent pentru geamuri i oglinzi


Lichid multifuncional de curat, excelent pentru curarea i lustruirea geamurilor,
parbrizelor, oglinzilor, faianei, plcilor ceramice, suprafeelor de plastic, crom, email
etc. Cantitate: 4 l.
Cod
SN000402

46

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

detergeni diverse suprafee

Pronto spray
Pronto Spray conine un amestec special de cear diluat i substane de ngrijire i
curare care ndeprteaz cu uurin praful i murdria. Cur praful de pe toate
tipurile de suprafee: lemn, plastic, sticl, metal.
Sortiment

Cantitate

antistatic

300 ml

IG5702

clasic

300 ml

IG5703

pentru electronice

250 ml

01

CALITATE
PRE

Rivex spray
Cur i ngrijete mobila. Poate fi folosit, de asemenea, pe suprafee ceramice,
email, crom, inox i plastic. Formula sa cremoas red strlucirea iniial a lemnului
i i menine luciul pentru mult timp.
Cantitate: 300 ml.

erveele umede universale Senza


Se utilizeaz la curarea suprafeelor din ceramic (gresie, faian, toalet), plastic,
(frigider, maina de splat, imprimant, tastatur etc.), inox (baterii, chiuvete, du),
fr a zgria suprafeele.
Unitate de vnzare: 80 buci/pachet.

Soluie pentru curarea suprafeelor din lemn


Produsul este destinat currii murdriei de pe suprafeele din lemn i suprafee
laminate. Conine un agent antistatic ce protejeaz suprafeele mpotriva depunerii
prafului. Cantitate: 750 ml.
Cod
AV000220

Cod
IGCR12

Cod
PT000901

PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
IG5701

erveele umede Expertto pentru mobil


Sunt eficiente pentru ntreinerea mobilei din lemn masiv i a suprafeelor laminate
sau lcuite. nltur murdria i formeaz un strat antistatic. Nu las urme.
Cantitate: 40 buci/pachet.

Cod
PT020140

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

47

detergeni pentru buctrie

PROTOCOL, CURENIE I ADMINISTRATIVE

01
Detergent Sano Forte Plus

Past vase Axion

Detergent spum cu un coninut de sod caustic, ce ndeprteaz grsimea de pe


aragaz, grtar, plit, oale, tigi. Putere mare de curare a arsurilor.
Cantitate: 750 ml.

Detergent pentru vase ce ndeprteaz grsimea i mirosurile persistente, lsnd


vasele curate i plcut mirositoare. Cantitate: 450 g.

Cod
SN000300

Cod
LR000030

Green

Sortiment

LR000031

Bicarbonat

Lichid vase Axion

Detergent vase Sano San


Detergent lichid cu pomp, pentru vase. Cur n profunzime, chiar i n ap
cldu sau rece. Cantitate: 1 l.
Sortiment

Cu formula sa unic, mbuntit, elimin mirosurile persistente i grsimea ntrit


de pe vase, pahare i oale. Cteva picturi asigur o spumare suficient pentru
splarea eficient a vaselor. Cantitate: 500 ml.

Cod
SN000812

Lavand

Cod
LR000044

Lemon

SN000816

Aloe Vera

LR000045

Aloe Vera

Sortiment

CALITATE
PRE

Detergent pentru vase

Tablete main de splat vase


Finish Powerball All in 1

Este un detergent de vase cu eficacitate sporit n ndeprtarea grsimilor de pe vesel


i de pe obiectele casnice. Datorit balsamului special cu arom de lmie i a PH-ului
neutru, minile vor rmne fine i catifelate, n timp ce grsimea va fi eliminat.

Tablete cu dou straturi, ce conin ingrediente care ndeprteaz eficient petele dificile,
precum i componente de soluie de cltire i sare care ofer strlucire.
Unitate de vnzare: 28 buci/cutie.

Cod
AV000400

48

Cantitate (l)
1

Cod
RK000500

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

burei

Scotch-Brite a inventat primul burete cu


sanuri laterale pentru protejarea unghiilor.
n ziua de astzi buretele protecie unghii
este alegerea numrul 1 n preferina
consumatorilor din Romnia.

01

Burete Ergonomic Confort


Confort sporit n utilizare datorit formei ergonomice: mai uor de folosit pentru rezultate mai rapide. Extrem de rezistent
datorit adezivului de nalt calitate: fibra abraziva verde nu se desprinde cu uurin de partea buretoas galben.
Datorit structurii aerisite, fibra abraziv verde reine rapid resturile de mncare i prin cltire temeinic dup fiecare
utilizare, nu se mbcsete. Particulele de minerale abrazive sunt dispersate n mod egal pe suprafaa fibrei abrazive,
sporind astfel eficiena n curare.
Cod
3M020107

Burete protecie unghii


Primul burete conceput cu caneluri laterale ce au rolul de a proteja unghiile n
timpul splrii veselei. Extrem de rezistent datorit adezivului de nalt calitate:
fibra abraziv verde nu se desprinde cu uurin de partea buretoas galben.
Datorit structurii aerisite, fibra abraziv verde reine rapid resturile de mncare i
prin cltire temeinic dup fiecare utilizare, nu se mbcsete. Gam foarte larg de
ntrebuinri, datorit celor dou fee active.
Cod
3M020130

PROTOCOL, CURENIE I ADMINISTRATIVE

TIAI C?

Burete clasic
Extrem de rezistent. Recomandat pentru splri grele. Reunete ntr-un singur
produs buretele simplu (galben), destinat splrilor uoare i nmagazinrii
detergentului i fibra abraziv (verde), foarte eficient n ndeprtarea resturilor arse
sau uscate de pe vesel.
Cod
3M020106

Burete pentru splat vase, simplu. Prevzut cu o parte abraziv pentru nlturarea
murdriei persistente. Dimensiuni: 77 x 48 x 24 mm. Unitate de vnzare: 10 buci/set.
Cod
IG9186

Burete pentru uz general

Burete vase

Burete cu protecie pentru unghii. Dimensiuni: 15 x 7 x 4.5 cm.


Unitate de vnzare: 10 buci/set.

Burete pentru vase, cu caneluri. Prin forma sa, confer protecie pentru unghii n
timpul folosirii. Dimensiuni: 87 x 62 x 40 mm. Unitate de vnzare: 5 buci/set.

Cod
OI57375

Burete vase

Cod
IG6482

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

49

lavete

PROTOCOL, CURENIE I ADMINISTRATIVE

01
Lavet microfibr anti praf
Atrage i reine praful i murdria ca un magnet,
datorit esturii de microfibre. Mare capacitate de
absorbie i de a reine lichidele n interior.
Compatibil cu toate tipurile de detergeni. Poate fi
splat la maina, pn la 400 C i refolosit cu succes.
Dimensiuni lavet: 36 x 35 cm.
Unitate de vnzare: 2 buci/set.

Lavete absorbante
Lavete umede
Compoziie celulozic. Extrem de absorbante i
rezistente. Multifuncionale: buctrie, baie,
automobil etc. Dimensiuni lavet: 18 x 20 cm.
Unitate de vnzare: 3 buci/set.
Cod
3M020102

Cod
3M020134

Putere mare de absorbie datorat celor 3 straturi ce


acioneaz mpreun. Durabilitate crescut n timp.
Rezisten la detergenii menajeri. Ideale pentru toate
tipurile de utilizare. Dimensiuni lavet: 18 x 20 cm.
Unitate de vnzare: 5 buci/set.
Cod
3M020101

Lavet geamuri
Lavet super absorbant pentru podele
Material durabil, nu las scame. Fin i flexibil, putere mare de absorbie. Rezistent la
detergeni. Red stralucire final atunci cnd este folosit uscat. Ideal pentru geamuri,
oglinzi i suprafee delicate. Poate fi splat la main, pn la 400 C i refolosit.
Dimensiuni lavet: 32 x 40 cm.

Moale i super-absorbant. Confer strlucire suprafeelor curate. Efect antistatic.


Compatibil cu toate tipurile de detergeni. Uor de curat i refolosit. Poate fi
splat la main pn la 600C. Dimensiuni lavet: 50 x 60 cm.
Cod
3M020104

Cod
3M020100

Lavete Sano Sushi Cloth


Lavet imprimat pe suport Roll Max
Lavete utile i practice. Se cur foarte uor, fiind compatibile cu toate tipurile de
detergeni. Rezistente n timp. Fibre esute cu structur flexibil.
Pachet de 13 lavete pretiate pe suport de tip rol. Dimensiuni lavet: 31 x 27 cm.
Cod
3M020113

50

Lavete uscate universale multi-funcionale, care pot fi folosite att uscate, ct


i umede. Sunt rezistente, au un grad de absorbie ridicat i pot fi splate la o
temperatur de pn la 400 C.
Dimensiuni lavet: 27 x 37 cm.
Unitate de vnzare: rol de 40 buci.
Cod
SN001001

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

lavete i articole menaj

Lavete umede
Cur i usuc repede i uor orice suprafa: faian,
mese, scaune, electrocasnice, fr a lsa urme sau
scame. Lavetele au o putere mare de absorbie.
Dimensiuni: 16 x 18 cm. Unitate de vnzare: 3 buci/set.
Cod
IG5973

Lavete universale

Lavet universal microfibr

Lavete universale pentru praf, pentru diferite


suprafee. Dimensiuni: 31 x 35 cm.
Unitate de vnzare: 3 buci/set.

Asigur o curare perfect pe orice tip de suprafa.


Dimensiuni: 30 x 30 cm.
Unitate de vnzare: 1 bucat/set.

Cod
EN2064

Cod
OI0202

Mnui unic folosin

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Realizate din polietilen, mrime universal. Unitate de vnzare: 100 buci/set.


Cod
IG011813

Mnui pentru menaj

SFATUL SPECIALISTULUI

Mnui menaj din latex, cptuite la interior cu un strat de bumbac. Disponibile n


culoarea galben.

ATENIE LA PERIOADA DE UTILIZARE


A BUREILOR I LAVETELOR!

Cod
IEL0025

Mrime

IEL0026

Este recomandat ca schimbarea buretelui de vase i


a lavetelor s se fac minim o dat pe sptamn,
pentru evitarea acumulrilor de bacterii i microbi.

IEL0027

Rol scame
oruri de unic folosin

Ideal pentru curarea hainelor. ndeprteaz prul, praful i firimiturile de pe


toate suprafeele textile. Uor de manevrat, rezerv detaabil.

Confecionate din HDPE, culoare alb.


Unitate de vnzare: 100 buci/set.
Cod
IG10960

Cod
KS32401

rol

KS32420

rezerv

Oricare ar fi meseria ta, avem produsul potrivit.

Produs

51

articole pentru menaj


Indicator avertizare
Atenie Podea Umed

Crucior curenie
Crucior cu pres mop, ideal pentru suprafee
de dimensiuni mici, uor de deplasat chiar i
pe scri. Inscripionat pe ambele laterale cu
avertizarea pericol de alunecare.
Capacitate: 2 x 7.5 litri. Prevzut cu set prindere
mop, mop i coad aluminiu de 1.2 m lungime.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Dispozitiv din plastic destinat avertizrii trectorilor


mpotriva alunecrii accidentale. Conform legislaiei
n vigoare. Inscripionat i n limba romn.
Cod
HX000909

Cod
HX000907

CALITATE
PRE
SUPER
CALITATE

mopul i mnerul oferite gratuit la achiziionarea gleii

Produse pentru curenie Scotch BriteTM


Design modern i ergonomic. Uor de manevrat i golit datorit niei de
control de pe spatele gleii. Separator de ap curat, uureaz munca,
pstrnd apa necesar curat. Storctor flexibil. Material durabil din
polipropilen. Rezisten sporit la soluiile de detergeni. Cur fr
s lase urme.

Produse economice pentru curenie


Cod
EN1678

gleat

Produs

Descriere
cu storctor, 10 litri

Cod
3M030001

Produs

Descriere

OI000100

rezerv mop

bumbac, 200 g

set podele

gleat, mop, coad

PR000900

rezerv mop

sintetic, 50 de fire

3M004824

mop bumbac

250 g

OI9111

coad mop/mtur

metal, 5 buci/set

3M020111

mner premium

metalic, 120 cm

OI000200

coad mop/mtur

lemn, 5 buci/set

tergtor geamuri
tergtor podea
Coad metalic telescopic, avnd nlime reglabil.
Mop plat, din microfibr, ce cur perfect suprafeele,
fr a lsa scame. Poate fi folosit i pentru uscarea i
curarea podelelor din lemn. Rezerva detaabil poate
fi curat i n maina de splat. Alegerea perfect
pentru: curat, uscat, lustruit, nlturat praful.

52

Cod
OI0235

tergtor

OI0237

rezerv

tergtor geamuri cu mner telescopic,


confecionat din aluminiu. Lamel confecionat
din burete i cauciuc. Dimensiuni mner: 95 cm.
Dimensiuni lamel: 25.4 cm.
Cod
GL000600

Produs

TIAI C?
Microfibra absoarbe de 3
ori mai mult ap dect
bumbacul, fcnd ca
suprafaa curat s se
usuce mult mai repede.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

95 cm

articole pentru menaj


Mtur cu mner pentru interior
Dou tipuri de peri, cu grosimi i flexibilitate diferite pentru a reine att murdria
rezistent cu particule mari, ct i praful fin. Ideal pentru suprafeele de interior.
Efect antistatic. Materiale durabile din polipropilen. Mner metalic, 120 cm
lungime.

SUPER
CALITATE

Cod
3M020116

Mtur de exterior cu coad din bambus

Mtur din lemn pentru exterior


Mtur de strad cu bosaj i cu o lungime a monturii de 40 cm. Este perfect pentru
curarea halelor industriale, grdinilor i pentru curenie stradal.

Firele mturii de strad sunt produse din PP (polipropilen) i au o lungime de


52 cm. Coada este din bambus, fiind mai uoar i mai rezistent dect cea de lemn
i avnd o lungime de 1 m. Greutatea total a produsului este de 0.5 kg.
Cod
PR000808

Cod
PR000807

CALITATE
PRE

PROTOCOL, CURENIE I ADMINISTRATIVE

01

CALITATE
PRE

Fra din plastic


Mtur cu fir lung
Fra pentru strns praf i gunoi. Se poate folosi pe suprafee din lemn sau ceramic.
Este realizat din material plastic rezistent.

Fabricat din plastic.

Cod
OI30301

Cod
OI9119

Fra cu coad lung


i mtur
Coad metalic detaabil.
Mtur i fra din plastic.
Cod
OI77101

Set toalet cu
suport din inox

Set pentru toalet cu


suport din plastic

Fabricat din inox, alctuit din perie din plastic i suport.

Fabricat din plastic, alctuit din perie i suport.

Cod
PR000809

Cod
OI22102

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

53

colectare selectiv
Europubele
Fabricate din polietilen de nalt densitate, prin sistem de injecie. Norm de
fabricare DIN-EN 840-1-5-6. Rezisten la radiaii ultraviolete i la temperaturi
foarte sczute sau foarte ridicate (-40C - +80C), precum i la coroziunea chimic i
la aciunea agenilor biologici. Capacul este prins de corpul pubelei cu dou nituri
din plastic i are un mner continuu pentru manevrare uoar.
Greutatea produsului: 10.5/14.5 kg. Greutatea nominal de ncrcare: 60/110 kg.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Colectare selectiv:
Albastru - deeuri din hrtie
Verde - deeuri din sticl
Galben - deeuri din metal

Cod
IRX011

Capacitate (l)

Culoare

120

verde

IRX017

120

albastru

IRX020

120

galben

IRX012

240

verde

IRX013

240

albastru

IRX016

240

galben

TIAI C?
Descompunerea natural a plasticului
n mediul nconjurtor necesit peste
500 de ani din cauza materialelor
care l alctuiesc. Reciclarea plasticului
reduce generarea de CO2 de 2.5 ori.

Co Ecobin pentru colectare selectiv a deeurilor


Materialul folosit la fabricarea lui este HDPE (polietilen de nalt densitate), ceea
ce i asigur o rezisten att la temperaturi sczute (-20 C), ct i la temperaturi
ridicate (35 C). Avantajul coului este acela c marginile acestuia sunt prevzute cu
un sistem de prindere ntre couri, n acest fel ocupnd mai puin spaiu i oferind o
imagine plcut i compact locului n care este aezat. Capac tip push.
Cod
PR000107

Capacitate (l)

Culoare

25

albastru

PR000108

25

galben

PR000109

25

verde

PR000110

45

albastru

PR000111

45

galben

PR000112

45

verde

margini prevzute cu sistem


de prindere ntre couri

Co Flip-Flap pentru colectare selectiv a deeurilor


Materialul folosit la fabricarea lui este HDPE (polietilen de nalt densitate), ceea
ce i asigur o rezisten att la temperaturi sczute (-20 C), ct i la temperaturi
ridicate (35 C). Este util att n spaiile nchise, ct i n cele deschise. Capac batant.

54

Cod
PR000104

Capacitate (l)

Culoare

60

albastru

PR000105

60

galben

PR000106

60

verde

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

couri pentru birou

interior detaabil

Co de gunoi din inox


Prevzut cu pedal i gleat n interior, detaabil. Capacitate: 16 litri.
Coul este prevzut la baz cu o membran de protecie din cauciuc.

Co de gunoi din inox


Fabricat din oel inoxidabil, capacul finisat satinat, corpul finisat oglind. Este
prevzut cu scrumier n partea superioar.
Cod
IG6004

Dimensiuni (H x mm)

Cod
PR000934

Dimensiuni (L x l x H cm)

Capacitate (l)

28 x 25 x 38

12

PR000937

31 x 31 x 43

20

580 x 290

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Co Europost VIVIDA pentru hrtii


Design modern i textur unic, ntr-o palet variat de culori. Face parte din gama
Esselte Europost VIVIDA. Suprafa intern neted, pentru curare uoar. Mner
integrat pentru o golire uoar. Courile se pot depozita unul ntr-altul, pentru a
economisi spaiu. Capacitate: 14 litri.

Co metalic pentru birou

Cod
SL081110

Culoare

Co pentru hrtii. Fabricat din metal.

SL081111

rou

negru

Cod
BV012191

Culoare

SL081112

verde

negru

SL081113

albastru

BV012192

argintiu

SL081114

galben

Pentru gama de
accesorii Esselte
VIVIDA consult
pagina 155!

CALITATE
PRE

Co Tami pentru birou

Co Tami perforat pentru birou

Co pentru birou, destinat colectrii deeurilor. Realizat din plastic, avnd un design
simplu, neperforat. Capacitate: 14 l.
Culoare

Fabricat din material plastic. Capacitate: 16 l.

Cod
PR000113

negru

Cod
PR000119

rou

PR000114

albastru

PR000219

negru

Culoare

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

55

saci menajeri

Saci menajeri cu nur LDPE (Low Density Polyethylene)


Saci menajeri prevzui cu nur, astfel nct s poat fi strni i legai la gur,
mpiedicnd mprtierea coninutului sau a mirosurilor neplcute. Sunt foarte
utili i mult mai uor de mnuit, datorit nurului care poate fi folosit drept mner,
dup strngere. Suport o cantitate de resturi i deeuri conform specificaiilor din
tabel. Culoare: albastru.

SUPER
CALITATE

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
GL000400

Capacitate (l)
35

Buci/rol
15

GL000402

60

10

GL000401

120

10

Saci menajeri HDPE (High Density Polyethylene)


Saci menajeri rezisteni, din plastic color. Suport o cantitate de resturi i deeuri
conform specificaiilor din tabel.
Cod
GL000920

Descriere

Buci/rol

18 l, roii

20

GL000921

30 l, verzi

20

GL000922

60 l, galbeni

20

Saci menajeri HDPE (High Density Polyethylene)


Saci confecionai din plastic. Sunt rezisteni, impermeabili i igienici. Suport o
cantitate de resturi i deeuri conform specificaiilor din tabel. Culoare: negru.

CALITATE
PRE

56

Cod
OI4411

Capacitate

Buci rol

18 l

50

OI4421

30 l

50

OI4431

35 l

50

OI4441

60 l

50

OI4001

120 l

10

OI4002

240 l

10

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

aspiratoare

ASPIRATOARELE PROFESIONALE DSU


URLGHPDULGLPHQVLXQL FP QSDUWHDGLQVSDWHLURL
mobile n partea din fa pentru o manevrare ct mai uoar
GHVLJQHOHJDQWLPRGHUQ
IRDUWHVLOHQLRV
XRUGHXWLOL]DW
SHULHSHQWUXDVSLUDUHDWDSLHULLORU
SHULHFRPELQDWSHQWUXDVSLUDUHDFRYRDUHORULDSDUGRVHOLORU

DE CE VIPER?

Caracteristici
Clasa de eficien energetic
Consumul anual de curent (kWh/an)
Aspirare praf pe covoare
Aspirare praf pe pardoseli
Clasa de eficien a filtrrii
Nivel de zgomot
Putere (W)
Nivel de vacuum (mmH20)
Debit de aer (l/min)
Lungimea cablului electric (m)
Culoare cablu alimentare
Capacitate container (l)
Puterea absorbit (Amp)
Greutate net (kg)
Dimensiuni ( l x L X h )
Cod

DSU 10

DSU 15

Model: DSU 10
B
33,9
B
F
71,5
1000
2200
1834
8
portocaliu
10
4,4
5,2
35.8 x 34.2 x 47.5
EL200001

Model: DSU 15
C
37
D
B
G
72,4
1200
2300/1600 (eco mode)
1834/1267 (eco mode)
10
portocaliu
15
5,4
5,65
38.8 x 37.4 x 47.5
EL200002

PROTOCOL, CURENIE I ADMINISTRATIVE

01

PDUFD9LSHUHVWHSDUWHLQWHJUDQWD*UXSXOXL1LOVNXQXOGLQSULQFLSDOLLIXUQL]RULGHHFKLSDPHQWHGH
curenie la nivel global
9LSHURIHURJDPFRPSOHWGHHFKLSDPHQWHSHQWUXFXUHQLHGHVWLQDWHVSDLLORUGHELURXULFHQWUHORU
comerciale, zonelor publice, instituiilor i altor spaii similare
HFKLSDPHQWHOHVXQWGHVWLQDWHFXUHQLHLSURIHVLRQDOHRSLRQDOSRWGRWDWHFXOWUH+(3$SHQWUXXQplus de
sntate i confort la locul de munc
www.vipercleaning.ro

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

57

electrocasnice
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Aspirator cu sac

SXWHUH:
SXWHUHGHDEVRUELH:
DFFHVRULLSHQWUXVSDLLQJXVWHLSHULHGHSUDI
WLMWHOHVFRSLFGLQPHWDO
YLWH]DYDULDELO
FDEOXDOLPHQWDUHP

Cod
EL000500

Cod
EL000502

Culoare

rou

EL000501

negru

EL000503

orange

Culoare

rou

Frigider HF-100A+

Frigider mini-bar HMB-42

FODVDHQHUJHWLF$
FDSDFLWDWHQHWO QHW O EUXW
FRQWUROPHFDQLFWHUPRVWDWDMXVWDELO
UDGLQVWLFOFRPSDUWLPHQWIUXFWHLOHJXPH
FRQVXP.ZKDQ
QLYHOGH]JRPRWG%
FODVDFOLPDW167
GLPHQVLXQLQHWH /[:[+ [[FP
OXQJLPHFDEOXGHDOLPHQWDUHFP
FXORDUHDOE

FODVDHQHUJHWLF$
FDSDFLWDWHQHWO QHW O EUXW
FRQWUROPHFDQLFWHUPRVWDWDMXVWDELO
FRPSDUWLPHQWIUXFWHLOHJXPH
FRQVXP.ZKDQ
QLYHOGH]JRPRWG%
FODVDFOLPDW167
GLPHQVLXQLQHWH /[:[+ [[FP
OXQJLPHFDEOXGHDOLPHQWDUHFP
FXORDUHDOE

Cod
EL000511

58

Aspirator cu sac

SXWHUH:
SXWHUHGHDEVRUELH:
OWUX+(3$
VDFWH[WLOODYDELO/
DFFHVRULXQSHQWUXVSDLLQJXVWH
WLMWHOHVFRSLFGLQPHWDO
YLWH]YDULDELO
FDEOXDOLPHQWDUHP

Cod
EL000510

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

electrocasnice
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

Espressor HEM-1050XMC
Opiuni preparare: cafea, cappuccino. Funcie auto-oprire, protecie supranclzire i
supra-presiune i sistem anti-picurare. Prevzut cu dispozitiv detaabil de spumare
a laptelui. Rezervorul de ap este transparent, detaabil i prevzut cu indicator de
nivel. Tav de scurgere detaabil.
SXWHUH:
SUHVLXQHEDUL
FDSDFLWDWHO
Cod
EL000504

Cafetier digital Savory 1100D


Control electronic, timer programabil i afiare ceas.
Prevzut cu filtru lavabil detaabil i mecanism anti-picurare. Funcie meninere
cafea cald i oprire automat n cazul n care nu este folosit.
SXWHUH:
FDSDFLWDWHO
Cod
EL000508

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Prjitor de pine HTP-1600XMC


Fierbtor PF-70
Fierbtor din inox cu baz rotativ 360 grade i filtru anti-calcar detaabil i lavabil.
Prevzut cu funcie de auto-oprire i buton ON/OFF. Rezisten acoperit.
SXWHUH:
FDSDFLWDWHO

Realizat din inox, prevzut cu tav pentru firimituri i spaiu de stocare a cablului de
alimentare. Funcii: oprire, decongelare, renclzire, auto-centrare.
SXWHUH:
FDSDFLWDWHIHOLL
QLYHOXULGHUXPHQLUH
Cod
EL000509

Cod
EL000507

Sandwich maker SM-800


Sandwich maker Delice 300
Prevzut cu plci detaabile andiadezive, de 3 tipuri: grill, sandwich, waffle.
Led gata de folosire i indicator alimentare. Mner rece.
SXWHUH:
FDSDFLWDWHVDQGZLFKXUL
Cod
EL000506

Plci antiadezive, tip sandwich. Led gata de folosire i indicator alimentare.


SXWHUH:
FDSDFLWDWHVDQGZLFKXUL
Cod
EL000505

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

59

echipamente de protecie personal

Echipamente pentru domeniul industrial

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Ochelari de protecie cu aerisire indirect


Ochelari tip goggle, cu ventilaie indirect. Prevzui cu ram din plastic moale i
lentil din policarbonat transparent.
Se pot purta inclusiv peste ochelarii de vedere. Asigur protecie mpotriva stropilor
de lichide.
Cod
RE002661

Ochelari Panoramic
Ram confecionat din policarbonat. Lentil confecionat din policarbonat
transparent. Particulariti: protecie lateral. Pot fi purtai peste ochelarii de vedere.
Cod
RE024011

Ochelari de protecie Ferro


Lentil policarbonat transparent, tratat antizgriere. Protecie lateral, greutate
sczut. Tratament antizgriere.
Cod
RE816000

60

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal


Semimasc
Semimtile BLS ofer protecie respiratorie eficient i confort. Au o greutate redus,
fiind recomandate pentru mediile industriale cu particule solide i/sau lichide (praf,
cea, fum). Sistemul de prindere este format din 2 benzi elastice i clem nazal
ajustabil. Disponibile n varianta cu sau fr supap de expiraie. Supapa asigur o
rezisten sczut la expirare, scderea umiditii i temperaturii din interiorul mtii,
oferind o respiraie mai uoar. Sunt potrivite pentru locurile de munc umede i
calde.
RE102010 - model cu supap de expiraie; clasificare: FFP2 NR D; protecie la pulberi i
aerosoli; nivel maxim de filtrare pentru particule solide i lichide pn la 10 x VLM*
RE020010 - clasificare: FFP1 NR D; protecie la pulberi de substane solide netoxice/
aerosoli; nivel maxim de filtrare: pn la 4 x VLM*
RE120000 - clasificare: FFP1 NR D; protecie la pulberi de substane solide
netoxice/aerosoli; nivel maxim de filtrare: pn la 4 x VLM*
*VLM=valoarea limit maxim
Tip

Caracteristici

FFP2

cu supap

RE020010

FFP1

cu supap

RE120000

FFP1

fr supap

COMAND
SPECIAL

RE020010

RE120000

RE102010

Semimasc de unic folosin

Casc de protecie

Semimasc de protecie de unic folosin, cu band metalic n zona nasului i


elastic, pentru o fixare ct mai bun pe fa. Material: neesut, din polipropilen,
densitate 200 g/mp.
Unitate de vnzare: 50 buci/cutie.

Calot din HDPE (High Density Polyethylene). Suspensie din polietilen, cu fixare
n 6 puncte. Band antitranspiraie din burete. Greutate calot: cca. 220 g. Sloturi
accesorii: 30 mm. Rezisten la temperatur: -10... +50C.
Rezisten dielectric: 440 V. Mrimi: 53-63.

Cod
RE000403

PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
RE102010

01

Cod
RE025010

Antifoane interne
Antifoane interne
Din material moale, hipoalergic. Cu suport din plastic flexibil. Pernie protectoare din
poliuretan.
Cod
RE263300

Antifoane interne cu nur i caset. Material: monopren, pentru adaptare optim n


canalul auditiv. Cutiu cu clem de prindere la centur, pentru pstrare igienic i n
siguran. Cordon din poliester.
Cod
RE021011

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

61

echipamente de protecie personal


Mnu Special Grip
Mnu pentru mediul
uleios

Mnu tricotat din fibre mixte,


imersat parial n latex, textur ridat
pentru o priz mai bun, manet
elastic.

Mnu excelent, cu dou straturi de


nitril, pe suport textil ce ofer aderen
i protecie a pielii n medii uleioase.
Risc mecanic 4121. Mrimi: 7-11.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
RE500000

COMAND
SPECIAL

Mrime

RE023021

RE023022

10

Mnu Senzor Black


Mnu tricotat din nailon, cu strat
subire de poliuretan n palm i pe
degete, manet elastic.
Cod
RE023023

Mrime

RE023024

RE023025

RE023026

RE023027

10

Mnu de protecie pentru


sudur
Mnu pentru sudur, integral din
piele palt bovin, cptueal bumbac,
lungime 35 cm. Culoare: rou.
Mrime: 10.5. Risc mecanic: 2134.
Risc termic: 312x3x.

Cod
RE180100

Mnu de protecie Forte


Mnu din piele groas palt bovin,
dublur n palm, pe degetul mare
i degetul arttor, spate bumbac,
manet cauciucat.
Cod
RE023011

COMAND
SPECIAL

Mnu de protecie Top


Mnu confecionat integral din piele
box bovin, cptueal bumbac n palm.
Mrime: 10.5. Risc mecanic: 2131.
Cod
RE155600

Mnu de protecie palt


88 CBSA
Mnu din piele palt bovin, spate i
manet din bumbac. Mrime: 10.5.
Cod
RE155100

Mnu cu aplicaii PVC

Mnua fr degete
Mnu tricotat din fibre para-aramidice,
fr degete. Prezint aplicaii punctiforme
PVC n palm.
Cod
RE010508

Mrime

RE010509

Mnu tricot gros

Mnu tricotat din fibre mixte,


aplicaii PVC punctiforme pe ambele
fee, manet elastic. Mrime: 10.
Cod
RE023013

62

Cod
RE023020

Mnu tricotat, din fibre mixte cu


manet elastic.
Culoare: natur. Mrimea 9.
Cod
RE101009

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal

Echipamente pentru domeniul industrial

Bocanc Hunan S1P


Fee: piele natural de bovin.
Cptueal textil. Bombeu metalic,
rezistent la 200 Joule. Lamel
antiperforaie din oel. Talp poliuretan
dubl densitate, injectat direct pe fee.
Protecie eficace, model economic.

Cod
RE211300

Mrime

RE211301

39

RE211302

40

RE211303

41

RE211304

42

RE211305

43

RE211306

44

38

COMAND
SPECIAL

Bocanc Parma S1
Fee: piele natural de bovin.
Cptueal textil. Bombeu metalic,
rezistent la 200 Joule. Talp confecionat
din poliuretan cu dubl densitate,
injectat direct pe fee. Protecie eficace.

Cod
RE042200
RE042201
RE042202
RE042203

Mrime
41
42
43
44

PROTOCOL, CURENIE I ADMINISTRATIVE

01

COMAND
SPECIAL

Pantof Hubey S1P


Fee: piele natural de bovin.
Cptueal textila. Bombeu metalic,
rezistent la 200 Joule. Lamel
antiperforaie din oel. Talp poliuretan
dubl densitate, injectat direct pe fee.
Protecie eficace.

Cizm de lucru
Partea superioar este confecionat
din PVC. Cptueal textil. Protecie la:
ap, noroi, uleiuri, acizi, baze, produse
petroliere. Talp confecionat din PVC.
nlime: 38 cm.

Cod
RE211200

Mrime

RE211201

39

RE211202

40

RE211203

41

RE211204

42

RE211205

43

RE211206

44

Cod
RE044130
RE044131
RE044132
RE044133
RE044134

Pantof Varese S1

38

Mrime
41
42
43
44
45

Fee: piele natural de bovin.


Cptueal textil. Bombeu metalic,
rezistent la 200 Joule.
Talp confecionat din poliuretan cu
dubl densitate, injectat direct pe fee.
Protecie eficace.

Cod
RE041200
RE041201
RE041202
RE041203

Mrime
41
42
43
44

COMAND
SPECIAL

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

63

echipamente de protecie personal

Echipamente pentru domeniul industrial

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Scurt impermeabil Sweden


Jachet extern. estur 100% PES Oxford.
Membran PVC. Cptueal 100% PES plas
(+ PES taffeta n mneci). Jachet intern cu
mneci detaabile. estur 100% PES Oxford,
membran PVC. Cptueal: 100% bumbac.
Cptueal termic: 100% PES 220 g/mp.
Culoare: galben fluorescent/bleumarin.
Cod
RE919900

Scurt impermeabil
Scurt de ploaie cu guler nalt i glug
cu nur. Testur: 100% PES Oxford/
membran PVC. Mrimea L.
Cod
Culoare
RE009184 portocaliu fluorescent
RE009185 galben fluorescent

COMAND
SPECIAL

Pelerin impermeabil

Scurt impermeabil din poliester

Pelerin impermeabil, cu glug


ascuns n guler.
Lungime: 120-130 cm.

Confecionat din poliester.


Lungime: 75-80 cm.

Cod
RE043000

Mrime

Cod
RE305001

Mrime

RE043001

RE305002

RE043002

XL

RE305003

XL

RE043003

XXL

RE305004

XXL

Vest vtuit Ramsay


Vest vtuit de iarn. estur
exterioar: microfibr, 100% poliester.
Cptueal: 100% poliester. Cptueal
termic: 100% poliester, 300 g/mp.
Mrime

Vest de semnalizare
estur: 100% poliester. Benzi
reflectorizante: 5 cm lime.
Mrimea L.

Cod
RE042005

S
M

Cod
RE026010

Culoare

RE042000
RE042001

RE026011

galben

portocaliu

COMAND
SPECIAL

64

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal

Salopet de lucru Mex


cu pieptar

Salopet de lucru Beni

Costum salopet cu pieptar.


estur 100% bumbac.
Greutate: 270 g/mp.

Costum salopet standard.


estur 100% bumbac.
Greutate: 270 g/mp.

Cod
RE031000

Mrime

Cod
RE035000

Mrime

RE031001

RE035001

RE031002

XL

RE035002

XL

RE031003

XXL

RE035003

XXL

01
PROTOCOL, CURENIE I ADMINISTRATIVE

COMAND
SPECIAL

Pantalon standard Fiji

Pantalon Ted
cu pieptar
Combinezon Jack
estur 100% bumbac sanforizat. Greutate: 250 g/mp.
Culoare: bleumarin.

Pantalon de lucru cu bretele ajustabile. Prevzut cu


buzunar exterior i nchidere cu fermoar.
estur: 100% bumbac sanforizat, 270 g/mp.

Pantalon de lucru cu buzunare n zona genunchilor.


Prevzut cu buzunar pentru telefon i buzunar lateral
pe piciorul drept, nchidere cu nasture.
estur: 65% poliester / 35% bumbac, 235 g/mp.
Culoare: bleumarin/albastru royal.

44

Cod
RE908422

Mrime

Mrime

Cod
RE908116

Mrime

Cod
RE908900

RE908117

46

RE908423

46

RE908901

RE908118

48

RE908424

48

RE908902

XL

RE908119

50

RE908420

50

RE908903

XXL

RE908120

52

RE908425

52

COMAND
SPECIAL

44

COMAND
SPECIAL

Tricou la
baza gtului

Tricou polo

Bumbac 100%, unisex,


gam variat de culori i
dimensiuni.

Bumbac 100%, gam variat


de culori i dimensiuni.
Bumbac, 220 g/mp.
Cod
FT4002x

Cod
FT1009x
x-culoare: 01- rou, 02- galben, 03- albastru, 06- albastru nchis,
08- verde, 11- alb, 14- gri, 16- bleumarin, 12- negru, 20- portocaliu

x-culoare: 01- rou, 02- galben, 03- albastru, 04- bleu, 05- albastru
deschis, 06- bleumarin, 09- verde nchis, 11- alb, 12- negru, 14- gri,
20- portocaliu, 28- burgundy, 30- maro

Gama complet de echipamente de protecie pentru domeniul industrial este


disponibil pe comand special.

Oricare ar fi meseria ta, avem produsul potrivit.

COMAND
SPECIAL

65

echipamente de protecie personal

Echipamente pentru domeniul HORECA-alimentar

PROTOCOL, CURENIE I ADMINISTRATIVE

01

COMAND
SPECIAL

Halat din bumbac


Halat Harry
din bumbac

Halat de lucru,
100% bumbac sanforizat.
Greutate: 250 g/mp.

estur: 100% bumbac.


Greutate: 150 g/mp.
Culoare: alb.
Mrimi: S-XXXL.
Cod
RE909201

Cod
RE041000

Mrime

RE041001

RE041002

XL

RE041003

XXL

COMAND
SPECIAL

Halat din tercot


pentru femei
estur: 35% bumbac i 65%
poliester. Greutate: 150 g/mp.
Cod
RE909220
RE909221
RE909222
RE909223
RE909224

66

Costum alb din tercot

Mrime
S
M
L
XL
XXL

estur: 65% poliester, 35%


bumbac, 195 g/mp. Bluz cu capse i
pantalon. Mrimi: S - XXXL.
Cod
RE908321

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal

Vest vtuit Blanca


Vest vtuit de iarn, cu guler nalt
i nchidere cu capse. Prevzut cu
buzunare n zona taliei i buzunar pentru
telefon.
estur exterioar: 35% bumbac / 65%
poliester.
Cptueal: polar fleece 100% poliester.
Cptueal termic: 100% poliester.
Cod
RE907401

Mrime

RE907402

RE907403

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Halat din
polipropilen
Halat de unic
folosin

Material: polipropilen,
neesut. Asigur protecie
mpotriva prafului grosier.
Cod
RE407901
RE407902
RE407903
RE407904

Confecionat din polietilen,


culoare alb. Mrime
universal.
Ambalare: 10 buci/set.

Mrime
M
L
XL
XXL

Cod
RE022012

Tricou polo

Tricou la baza gtului


Bumbac 100%, unisex, gam variat de culori i dimensiuni.

COMAND
SPECIAL

Cod
FT1009x
x-culoare: 01- rou, 02- galben, 03- albastru, 06- albastru nchis,
08- verde, 11- alb, 14- gri, 16- bleumarin, 12- negru, 20- portocaliu

Bumbac 100%, gam variat de culori i dimensiuni. Bumbac, 220 g/mp.


Cod
FT4002x

COMAND
SPECIAL

x-culoare: 01- rou, 02- galben, 03- albastru, 04- bleu, 05- albastru
deschis, 06- bleumarin, 09- verde nchis, 11- alb, 12- negru, 14- gri,
20- portocaliu, 28- burgundy, 30- maro

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

67

echipamente de protecie personal

Echipamente pentru domeniul HORECA-alimentar

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Mnui latex pudrate


Mnui unic folosin din latex, pudrate. Unitate de vnzare: 100 buci/cutie.
Cod
RE023010

Mrime

RE123010

RE223010

Mnui unic folosin


Realizate din polietilen, mrime universal. Unitate de vnzare: 100 buci/set.
Cod
IG011813

Mnu Senzor Black


Mnu Special Grip
Mnu tricotat din nailon, cu strat
subire de poliuretan n palm i pe
degete, manet elastic.
Cod
RE023023

Mrime

RE023024

RE023025

RE023026

RE023027

10

Cod
RE023020

Mrime

RE023021

RE023022

10

or de unic folosin

Mnu cu aplicaii PVC


Mnu tricotat din fibre mixte,
aplicaii PVC punctiforme pe ambele
fee, manet elastic. Mrime: 10.

Confecionat din polietilen, culoare


alb. Dimensiuni: 90 x 70 cm.
Ambalare: 100 buci/set.
Cod
RE022011

Cod
RE023013

68

Mnu tricotat din fibre mixte,


imersat parial n latex, textur ridat
pentru o priz mai bun, manet
elastic.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal

Echipamente pentru domeniul HORECA-alimentar

COMAND
SPECIAL

Sabot Adria
nclminte comod i uoar, destinat
industriei alimentare, farmaceutice sau
spitalelor. Fee perforate pentru o mai
bun aerisire a piciorului. Fee din piele
natural de bovin. Cptueal din
piele. Talp din poliuretan, cu form
ergonomic.

Cod
RE043105
RE043106
RE043107
RE043108
RE043100
RE043101
RE043102

Mrime
37
38
39
40
41
42
43

Sabot cu bombeu metalic


Roslyn
Fee din microfibr, material
semipermeabil antibacterian ce permite
respiraia piciorului. Bombeu metalic,
rezistent la 200 Joule. Talp: poliuretan
alb, injectat direct pe fee.

Cod
RE290337
RE290338
RE290339
RE290340
RE290341

Mrime
37
38
39
40
41

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Capelin tip plas


Capelin tip plas, de unic folosin.
Material: plasa din nylon. Mrime universal.
Unitate de vnzare: 100 buci/set.
Cod
RE001319

Capion de unic folosin


Confecionat din polietilen. Mrime universal.
Ambalare: 100 buci/set.
Cod
RE022013

Gama complet de echipamente de protecie


pentru domeniul HORECA-alimentar este
disponibil pe comand special.

Masc chirurgical 3 straturi


Material: neesut, 3 straturi. Mrime: 17 x 9.5 cm.
Unitate de vnzare: 50 buci/cutie.
Cod
RE020012

COMAND
SPECIAL

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

69

echipamente de protecie personal

Echipamente pentru domeniul medical

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Mnui latex
nepudrat

Mnui latex pudrate


Mnui de unic folosin din latex, pudrate. Unitate de vnzare: 100 buci/cutie.
Cod
RE023010

Mrime

Cod
RE030004

Mrime

RE123010

RE030014

RE223010

RE030024

Masc chirurgical 3 straturi

Mnui de unic folosin


Realizate din polietilen, mrime universal.
Cod
IG011813

Material: neesut, 3 straturi. Mrime: 17 x 9.5 cm.


Unitate de vnzare: 50 buci/cutie.
Cod
RE020012

Capion de unic folosin

Botoei de unic folosin

Confecionat din polietilen. Mrime universal.


Ambalare: 100 buci/set.

Confecionai din polietilen, culoare albastr.


Mrime universal. Ambalare: 100 buci/set.

Cod
RE022013

70

Mnu ambidextr, din latex. Nepudrat, lungime 240 mm.


Ambalare: 100 buci/cutie.

Cod
RE022014

Culoare
albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

echipamente de protecie personal

COMAND
SPECIAL

COMAND
SPECIAL

01

Halat Harry
din bumbac

PROTOCOL, CURENIE I ADMINISTRATIVE

Costum alb din tercot


estur: 100% bumbac.
Greutate: 150 g/mp.
Culoare: alb.
Mrimi: S-XXXL.

estur: 65% poliester, 35%


bumbac, 195 g/mp. Bluz cu capse i
pantalon. Mrimi: S - XXXL.

Cod
RE909201

Cod
RE908321

Halat din bumbac


Halat de unic folosin

Halat de lucru 100%, bumbac


sanforizat. Greutate: 250 g/mp.
Cod
RE041000

Mrime

RE041001

RE041002

XL

RE041003

XXL

Confecionat din polietilen,


culoare alb. Mrime universal.
Ambalare: 10 buci/set.

Cod
RE022012

COMAND
SPECIAL

Sabot Adria
nclminte comod i uoar destinat
industriei alimentare, farmaceutice sau
spitalelor. Fee perforate pentru o mai
bun aerisire a piciorului. Fee din piele
natural de bovin. Cptueal din
piele. Talp din poliuretan, cu form
ergonomic.

Cod
RE043105
RE043106
RE043107
RE043108
RE043100
RE043101
RE043102

Mrime
37
38
39
40
41
42
43

Sandale de protecie Sibari


Fa microfibr, bombeu metalic, rezistent la 200 Joule. Talp
poliuretan alb, injectat direct pe fee. nclminte destinat
industriei alimentare i farmaceutice. Permite respiraia piciorului.
Cptueal textil. Mrimi: 36-47.
Cod
RE311600

Gama complet de echipamente de protecie pentru


domeniul medical este disponibil pe comand special.
COMAND
SPECIAL

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

71

truse sanitare, stingtoare i triunghiuri


Trus sanitar de perete

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Kit de nlocuire trus sanitar de perete


Produs
batiste din hrtie cu soluie dezinfectant
vat hidrofil steril, 50 g
leucoplast, 5 cm x 3 m
leucoplast, 2.5 cm x 2.5 cm
alcool sanitar, 200 ml
comprese sterile, 10 cm x 8 cm
pansament individual, 2 cm x 6 cm
pansament cu rivanol, 6 cm x 10 cm
plasture, 6 cm x 50 cm
rivanol soluie 1%, 200 ml
ap oxigenat sau perogen
alcool iodat, 200 ml

Cantitate
10 buci
2 pachete
1 bucat
1 bucat
1 sticl
10 buci
10 buci
5 buci
1 buci
1 sticl
1 sticl
1 sticl

Cod
VD000101

Trusa sanitar de prim-ajutor este


prevzut cu suport de prindere
detaabil, ceea ce permite transportarea
acesteia la locul acordrii primului ajutor.

COMAND
SPECIAL

Produs
ace de siguran
alcool iodat, 200 ml
alcool sanitar, 200 ml
ap oxigenat sau perogen
atele din material plastic
bandaj triunghiular, I = 80 mm
batiste din hrtie cu soluie dezinfectant
brour cu instruciuni de prim ajutor
caiet, 50 pagini
comprese sterile, 10 cm x 8 cm
creion
cutie din material plastic
deschiztor de gur, din material plastic
dispozitiv de respiraie gur la gur
fa din tifon, 10 cm x 5 m
fa din tifon, 5 cm x 4 m
foarfece cu vrfuri boante
garou, 50 cm
leucoplast, 2.5 cm x 2.5 cm
leucoplast, 5 cm x 3 m
mnui de examinare
pahare de unic folosin
pansament cu rivanol, 6 cm x 10 cm
pansament individual, 2 cm x 6 cm
pip Guedel, mrimea 4
pip Guedel, mrimea 10
plasture, 6 cm x 50 cm
rivanol soluie 1%, 200 ml
vat hidrofil steril, 50 g

Cantitate
12 buci
1 sticl
1 sticl
1 sticl
2 buci
2 buci
10 buci
1 bucat
1 bucat
10 buci
1 bucat
1 bucat
1 bucat
1 bucat
3 buci
5 buci
1 bucat
1 bucat
1 bucat
1 bucat
4 perechi
5 buci
5 buci
10 buci
1 bucat
1 bucat
1 bucat
1 sticl
2 pachete

Cod
VD000100

La comand special putem oferi orice


model de truse sanitare auto.
Pentru mai multe detalii contacteaz
consultantul de vnzri.

Stingtor pulbere
DOMENIUL DE UTILIZARE
Pentru stingerea nceputurilor de incendii pe focare din clasele A, B, C. Utilizare
n spaii nchise sau deschise, n mijloace de transport auto, staii alimentare cu
carburani, magazine, depozite, magazii, centrale termice, nave, vagoane tren etc.
Se poate folosi asupra echipamentelor electrice cu tensiuni de pn la 1000 V.
AGENTUL DE STINGERE
Pulbere universal ABC sau pulbere BC. Ambele tipuri de pulbere sunt certificate
de organisme i laboratoare acreditate, condiie obligatorie pentru introducerea pe
pia a stingtoarelor.
Cod
PR000200

1 kg

Capacitate

PR000203

4 kg

PR000202

6 kg

Triunghi reflectorizant
Destinat semnalizrii autovehiculelor accidentate sau care staioneaz pe drumurile
publice din cauza defeciunilor tehnice. Are suprafaa fluorescent - reflectorizant,
putnd fi observat de ctre participanii la trafic n orice condiii de vizibilitate.
Produsul este omologat internaional conform R27.03 ECE-ONU.
Cod
RE100100

72

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

cutii pentru chei i accesorii

Cutie pentru chei


Prevzut cu sistem de montare pe perete. ncuietoare cu dou chei,
se livreaz mpreun cu 6 suporturi pentru etichet (culori asortate).
Culoare: gri.
Dimensiuni (mm)

Capacitate

302 x 208 x 118

36 chei

DB195323

302 x 280 x 118

54 chei

01

SUPER
CALITATE

Durable i ofer soluia modern


pentru pstrarea n siguran a
cheilor. Cutia din aluminiu este proiectat
pentru a fi folosit mpreun cu noul
suport pentru etichet. Datorit acestui
sistem, eticheta va fi ntotdeauna vizibil,
cheia fiind situat n spatele acesteia.

PROTOCOL, CURENIE I ADMINISTRATIVE

Cod
DB195223

La comand se pot livra panouri cu o


capacitate de pn la 3.000 de chei.

Cutie Point pentru chei

Cutie pentru chei

Fabricat din metal. U prevzut cu ncuietoare (dou chei) i magnet, orificii


pentru montarea pe perete sau n interiorul mobilierului. Se livreaz mpreun cu
suporturi de etichet pentru chei (cte una pentru fiecare crlig).

Realizat din tabl de oel. U prevzut cu ncuietoare (dou chei).


Culoare: gri deschis.

Cod
AC9141

Dimensiuni (mm)

Capacitate

Capacitate

48 chei

Cod
AC102000

Dimensiuni (mm)

560 x 280 x 60

200 x 160 x 50

20 chei

AC9144

710 x 380 x 60

120 chei

AC102001

250 x 200 x 75

48 chei

SUPER
CALITATE

Suport etichet pentru cheie


Fabricat din plastic, uor de utilizat. Unitate de vnzare: 6 buci/set.
Cod
DB195701

Culoare

DB195703

rou

DB195704

galben

DB195707

albastru

Suport etichet pentru cheie

negru
Fabricat din plastic, diverse culori: negru, rou, gri, albastru.
Unitate de vnzare: 10 buci/cutie.
Cod
AC1852

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

73

baterii i acumulatori

PROTOCOL, CURENIE I ADMINISTRATIVE

01
3

GARANIE

GARANIE

ncrctor acumulatori Pocket

ncrctor acumulatori Mini

Este soluia perfect atunci cnd ai nevoie de portabilitate i putere. Vine echipat cu
cu 4 acumulatori, doi de tip AA de 2100 mAh i 2 tip AAA de 800 mAh, prencrcai.

E uor de utilizat, mic i portabil. Este solia ideal pentru deplasri. Vine echipat cu
2 acumulatori AAA de 800 mAh, prencrcai.

Cod
VR310001

Cod
VR332001

Acumulatorii Varta folosesc tehnologia ready to use - pot fi folosii imediat, fr a necesita o prim ncrcare.

Acumulatori
Acumulatori Ready to use, beneficiaz de o tehnologie nou, calitate superioar,
pstreaz capacitatea de ncrcare cu peste 100% fa de acumulatorii obinuii.
Rezist la temperaturi negative i i pstreaz tensiunea i amperajul.
Unitate de vnzare: 4 buci/set.

Sunt soluia ideal pentru aplicaii ce necesit energie de precizie, oferind un nivel
ridicat de energie i fiabilitate. Unitate de vnzare: 4 buci/blister.

Cod
VR211001

Tip

Caracteristici

HR6

AA, 2100 mAh

Cod
VR110001

LR6

AA, alcaline, 1.5 V

VR221002

HR03

AAA, 800 mAh

VR110002

LR03

AAA, alcaline, 1.5 V

Tip

Caracteristici

TIAI C?

?
74

Baterii Max Tech

Bateriile uzuale folosite n fiecare gospodrie sau la locul de munc pot conine substane toxice precum plumb,
mercur, nichel, cadmiu, zinc sau litiu. O singur baterie uzat, aruncat i apoi ajuns la rampa de gunoi, poate polua
un metru de pmnt i 10 litri de ap.
Bateriile-butoni, folosite la ceasuri i calculatoare, sunt cele mai periculoase din cauz c au n componena lor peste
30% mercur. O baterie-buton poate contamina 600.000 de litri de ap.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

baterii i acumulatori

SFATUL SPECIALISTULUI
SELECTEAZ CORECT TIPUL DE BATERIE!
Gama de baterii Varta Max Tech a fost proiectat pentru dispozitive care necesit un consum mare de energie: aparate foto, lanterne
cu halogen, jucrii, dispozitive audio portabile etc.
Gama de baterii Varta High Energy ofer performan imbatabil pentru aparatele care necesit energie intensiv. Energie puternic
pentru aparate cu consum crescut, ca de exemplu dispozitive pentru calculator, echipamente audio, jucrii etc.
Alte avantaje ale produselor Varta:
- comunicare clar a utilizrii recomandate prin pictograme
- calitate garantat, produse de fabricaie german
- tehnologia Single Press Out permite deschiderea cu uurin a pachetului i depozitarea n condiii sigure a bateriilor nefolosite

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Baterii High Energy


Baterii High Energy 9 V
Fac parte din cea mai puternic gam realizat de Varta, realizat special pentru
aparatele ce au un consum crescut de energie. Unitate de vnzare: 4 buci/blister.
Cod
VR120001

Tip

Caracteristici

LR6

AA, alcaline, 1.5 V

VR120002

LR03

AAA, alcaline, 1.5 V

Fac parte din cea mai puternic gam realizat de Varta, realizat special pentru
aparatele ce au un consum crescut de energie. Unitate de vnzare: 1 bucat/blister.
Cod
VR120005

Caracteristici
9V

Baterii Basic

Baterii Turbo
Bateriile Turbo Duracell dureaz cu 70% mai mult fa de bateriile alcaline obinuite.
Ele sunt cea mai bun alegere pentru dispozitive cu un consum ridicat, cum ar fi
camerele foto sau jucriile. Unitate de vnzare: 4 buci/blister.

Duracell v ofer baterii fiabile i puternice. Alimentai-v dispozitivele electronice


cu baterii care rezist de pn la 10 ori mai mult dect bateriile obinuite! Sunt
ideale pentru camere foto, camere video, calculatoare, jocuri portabile i jucrii.
Unitate de vnzare: 4 buci/blister.

Cod
PG000600

Tip

Caracteristici

Caracteristici

AA, alcaline, 1.5 V

Cod
PG000602

Tip

LR6

LR6

AA, alcaline, 1.5 V

PG000601

LR03

AAA, alcaline, 1.5 V

PG000603

LR03

AAA, alcaline, 1.5 V

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

75

electrice
Becuri LED SMD
Generaia nou de becuri cu LED nlocuiete cu succes chiar i cele mai puternice
becuri economice, acestea avnd un design ergonomic care le permite un unghi de
iluminare de 360 grade. Becurile cu LED se pot folosi la iluminatul interior pentru,
hoteluri, coli, bnci, birouri, ateliere etc.

01

AJ900100

AJ900200

AJ900300

PROTOCOL, CURENIE I ADMINISTRATIVE

economie de energie

Putere (W) Soclu

Luminozitate Echivalent

4.5

GU10

320 lumeni

AJ900100

10

E27

806 lumeni

bec clasic 75 W

AJ900200

E27

600 lumeni

bec clasic 60 W

bec clasic 25-40 W

AJ900300

E14

450 lumeni

bec clasic 40 W

AJ900400

E27

450 lumeni

bec clasic 40 W

AJ900500

E14

450 lumen

bec clasic 40 W

SFATUL SPECIALISTULUI
AVANTAJELE BECURILOR CU LED

AJ900000

AJ900400

Economie de energie pn la 80% fa de becurile economice i de 4


ori mai eficiente dect becurile incandescente datorit raportului lm/W,
durata de via de minim 50.000 h, rezistent la ocuri i vibraii, fr
mercur, plumb sau emisii de radiaie UV, nu se nclzesc.
Culoare: alb cald. Tensiune: AC220V.
AJ900500

AJ900700

AJ900701

AJ900703

AJ900702

Clasa energetic: A. Tensiune de intrare: 230-240 V AC ~


50-60 Hz. Form spiral.
Cod
Putere
AJ900700 20 W
AJ900701 20 W
AJ900702 32 W
AJ900703 45 W

Tub fluorescent T8
Becuri cu halogen

Becuri economice

Dulie

Echivalent

E14

bec clasic 100 W

E27

bec clasic 100 W

E27
E27

Bec cu halogen, form de glob, lumin cald


(temperatura culorii 2700K). Clasa energetic: B.
Se preteaz la reglaje sau ntreruptoare electronice.
Tensiune de intrare: 230-240 V AC ~ 50-60 Hz.

Destinat iluminrii interioare (birouri, sli de sport,


magazine, coli, holuri, candelabre, lustre, diverse
spoturi aplicate sau incastrate, aplice) n funcie de
corpul de iluminat.
Tensiune alimentare: 230V, frecvena: 50 Hz,
temperatura culoare: 6500K, durat de via: 8000 h,
temperatura de lucru: 0C +40C.

Dulie

Echivalent

E27

bec clasic 60 W

Soclu

E27

bec clasic 100 W

Cod
AJ900900

Putere

bec clasic 160 W

Cod
Putere
AJ900800 42 W
AJ900801 70 W

18 W

G13

bec clasic 225 W

AJ900802 100 W

E27

bec clasic 130 W

AJ900901

36 W

G13

Becuri economice

Tub fluorescent

Caracteristici: pornire aproape instantanee, fr flicker (< 1 s). Luminozitate dup un


minut: 80%. Avantaje: calitatea i distribuia luminii este similar cu cea a lmpilor
incandescente. Utilizare: destinate pentru nlocuirea lmpilor incandescente n
aplicaiile profesionale (hoteluri, restaurante, magazine, birouri). Lumin: alb cald.
Alimentare direct.

Flux luminos iniial ridicat. Cantitate redus de mercur. Tehnologie complet


reciclabil, toate componentele pot fi folosite n fabricarea unor noi lmpi.
Potrivite pentru utilizare ntr-o gam larg de corpuri de iluminat pentru lmpi
fluorescente. Spaii de utilizare: coli, birouri, magazine, hale de producie etc.

Cod
IPH271969

76

Cod
AJ900000

Soclu

Cod
IPH702678

Putere (W)

Putere (W)
20

E27

IPH702715

36

18

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

electrice

Lamp Domi
Lamp cu led pentru birou, cu bra flexibil, este potrivit pentru cititul documentelor,
vizualizarea tastaturii pe timp de noapte la birou, acas, hotel etc. Clipsul v ajut s o
mutai n locul dorit i s o prindei de diferite suprafee. Alimentare la priz, led 5 W,
luminozitate 140 lumeni i poate oferi pn la 30000 h de funcionare.
Cod
AJ901000
AJ901001
AJ901002
AJ901003
AJ901004

Culoare
roz
alb
verde
albastru
gri

Lamp Rainbow
Lamp cu bra flexibil, este potrivit pentru cititul documentelor, vizualizarea tastaturii
pe timp de noapte la birou, acas, hotel etc.
Suportul este portabil i se poate transforma ntr-o lamp de veghe cu lumin colorat
n nuane diverse. Datorit braului flexibil aceasta direcioneaz lumina n funcie de
nevoi. Lampa funcioneaz conectat la priz, lumina furnizat provine de la un led cu
putere de 6 W, luminozitate 230 lumeni, poate oferi pn la 30000 h de funcionare.
Cod
AJ902000

PROTOCOL, CURENIE I ADMINISTRATIVE

01

lamp de veghe

Prelungitor Conectus
Prize schuko, protecie la tensiune. Profil argintiu rezistent la foc. Rezisten
mecanic bun. Capetele laterale permit montajul att vertical, ct i orizontal,
n regim de fixare sigur cu uruburi. Protecie pentru copii, indicatori optici de
funcionare/avarie.
Cod
FMK65013

Caracteristici
2 m lungime, 6 prize

Prelungitor derulator
Prize schuko, tambur cu termosiguran ce asigur o utilizare sigur.
Prevzut cu mner pentru transport.
Cod
FMK65014

Caracteristici
25 m lungime, 4 prize

Prelungitor cu ntreruptor
Prelungitor schuko, culoare alb, destinat conectrii aparatelor individuale din
domeniul multimedia i nu numai. Prevzut cu ntreruptor.

Prelungitor Smart
Prize schuko, protecie la scurtcircuit. Polipropilen rezistent la topire pn la
temperaturi de 8500. Protecie pentru copii. Indicatori optici de funcionare/avarie.
Cod
FMK65012

Cod
FMK5300

3 m lungime, 5 prize

Caracteristici

FMK5500

5 m lungime, 6 prize

Caracteristici

FMK3300

3 m lungime, 3 prize

1.5 m lungime, 6 prize

FMK3500

5 m lungime, 3 prize

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

77

marcare
www.leitz.com/icon
LEITZ ICON - UN SISTEM PENTRU TOATE NEVOILE TALE DE ETICHETARE

PROTOCOL, CURENIE I ADMINISTRATIVE

01

FR EFORT
Schimbi cartuele uor datorit sistemului
Snap-on, iar banda se ncarc automat n
feeder.

3 N 1
nlocuiete aparatul
de etichetat mobil,
imprimanta pentru etichete
conectat la computer i
colile A4 de etichete.

MULTIFUNCIONAL
Etichete din hrtie, carton i plastic.
Limea etichetei variaz ntre 12 i
88 mm i pn la 2 m lungime.

Imprimant inteligent pentru


etichetare Leitz Icon
WLSUHWHGHSH3&0DFL3DGVDXL3KRQHL$QGURLG
FRQH[LXQHSULQFDEOX86%VDX:L)L
DSOLFDLHPRELOJUDWXLWVXSRUW$SSOH$LU3ULQW
WDLHDXWRPDWHWLFKHWDODGLPHQVLXQH
WLSUHWHSQODGHHWLFKHWHSHPLQXW
NLWGHVWDUWFXFDUWXGHPP[P

2+1**ANI

MOBIL

GARANIE

Ataezi bateria i poi s o foloseti n birou, n


depozit, n parcare, n magazin etc.
Autonomie 12 ore sau pn la 1.200 de etichete.

* prin nregistrare

winner

Cod
SL700100

DIGITAL
Se conecteaz prin Mobile App, prin reeaua WiFi,
n mod SoftAP/Access Point i prin cablu USB.
Compatibil cu PC, Mac, tablet PC i smartphone.

Acumulator Leitz Icon

RAPID
Tiprete pn la 200 de etichete pe minut (etichete
de adres, scriere la 4 rnduri).

FRQHFWHD]EDWHULDH[WHUQSHQWUXXWLOL]DUHPRELO
DXWRQRPLHRUHQDWHSWDUHVDXSQODGH
etichete tiprite
UHQFUFDELO
Cod
SL700200

78

COMAND
SPECIAL

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

marcare
www.leitz.com/icon
cartuul indic ce band de
etichete este ncrcat n aparat
i cte etichete au mai rmas

LEITZ ICON CARTUE INTELIGENTE

sistem de prindere
Snap-on, pentru
schimbare uoar i rapid
fabricat din pulp
de hrtie reciclat

Etichete continue

Etichete continue
din plastic

Taie eticheta la dimensiunea dorit, pentru


a eticheta colete, bibliorafturi i orice altceva
doreti - poi imprima aproape orice, chiar
i bannere. Se poate tia la lungimea dorit,
ntre 28 mm i 910 mm. Hrtie alb cu adeziv
permanent. Lungime rol: 22 m.
Cod
SL700300

Lime (mm)

SL700400
SL700600
SL700700

O soluie permanent - band continu de etichete,


dur i rezistent la umiditate i raze UV. Se poate tia
la lungimea dorit, ntre 28 mm i 910 mm.
Lungime rol: 10 m.
Cod

Lime Culoare
(mm)

61

SL701500

12

alb

50

SL701501

12

galben

39

SL701502

12

rou

SL700900

25

SL701600

88

alb

SL701000

19

SL701601

88

galben

SL701100

12

SL701602

88

rou

88

Etichete din carton

Etichete pretiate

Etichete speciale pentru pentru


bibliorafturi, ecusoane, cri de
vizit, toate folosind un singur cartu.
Gramaj: 157 g/mp.
Carton alb, non-adeziv.
Lungime rol: 22 m.

Etichete de coresponden mici i mari.


Extrem de rapide n folosin, imprim pn
la 200 de etichete/minut. Adeziv permanent.
Cod
SL701200

Dimensiuni
88 x 36

600

SL701700

88 x 28

690

59 x 102

225

Cod
SL701900

Lime (mm)

SL701300

435

SL700500

57

SL700800

32

SL701800

50 x 88

COMAND
SPECIAL

Numr etichete

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Un cartu de etichete ce vorbete cu tableta,


smartphone-ul sau calculatorul tu inteligent, nu?

COMAND
SPECIAL

91

LabelWriter LW450
Imprimant profesional de etichete pentru PC, pentru tiprire text, coduri de bare,
grafic. Vitez tiprire: 51 de etichete pe minut (etichet de adrese cu 4 rnduri).
Tehnologie tiprire termic, nu necesit cerneal sau toner. Tiprire n mod grafic,
la rezoluie 600 x 300 dpi. Include software DYMO Label v.8, ce conine peste 100
de stiluri i machete de etichete, agend cu adrese. Funcie auto power off pentru
economisirea energiei. Dimensiune compact.
Cod
SL5100

Consumabile pentru LabelWritter LW450


Cod
SL5102

Denumire

Dimensiuni

Etichete

Role

etichete tip adres

54 x 25 mm

500

SL5104

etichete albe

57 x 32 mm

1000

SL5108

etichete tip adres

89 x 28 mm

130

COMAND
SPECIAL

Oricare ar fi meseria ta, avem produsul potrivit.

79

marcare
Marcator Label manager 280P
DYMO LM280 se conecteaz la PC i astfel putei personaliza cu uurin etichetele,
folosind fonturi sau grafice din PC. Tiprii rapid textul, chiar uor i confortabil,
folosind tastatura QWERTY specific fiecrei ri. Editai rapid textul cu ajutorul
tastelor rapide de personalizare. Evitai costuri sau pierderi folosind bateriile
rencrcabile care vin mpreun cu aparatul de etichetat Label Manager 280. Avei la
dispoziie 6 mrimi de font, 7 stiluri de text, 8 casete de rencrcare, subliniere i 220
de simboluri i imagini clip-art. Folosii etichete cu dimensiuni de 6 mm, 9 mm sau
12 mm dintr-o gam larg de culori.
Compatibil cu Windows Vista, Windows 7, Windows 8, Windows XP, Mac OS X
10.5 sau variante mai recente - doar Intel.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
SL968960

Consumabile pentru Label Manager


COMAND
SPECIAL

Gam larg de consumabile, pentru nevoi de printare diverse.


Cod
SL3006
SL3011
SL5129

Gam variat de
culori disponibil
la comand special!

Tip band
D1
D1
D1

Dimensiuni
9 mm x 7 m
12 mm x 7 m
19 mm x 7 m

Culoare
negru/alb
negru/alb
negru/alb

marcatorul funcioneaz
doar cu etichete Apli!

COMAND
SPECIAL

Marcator Letratag LT-100H


Marcator economic, portabil, uor de folosit pretutindeni. Tip de scriere: 5 fonturi.
Numr de rnduri tiprite: 2. Etichete folosite: plastic, hrtie, lime: 12 mm. Tipuri
de etichet: 6 stiluri, 8 tipuri chenar, imprimare dat. Alimentare: 6 baterii AA sau
alimentator AC extern (nu sunt incluse).
Cod
SL3003

Consumabile pentru Letratag LT-100H


Cod
SL3016

Tip band

Dimensiuni

Culoare

hrtie

12 mm x 4 m

alb

SL3017

plastic

12 mm x 4 m

alb

SL3018

plastic

12 mm x 4 m

galben

Marcator
Marcator cu imprimare manual, care poate printa pe etichete autoadezive
caractere alfanumerice pe una sau dou linii. Ideal pentru etichetare preuri sau
coduri de bare.
Cod
AL101418

Nr. caractere

Nr. linii

Dimensiuni etichete

22 x 12 mm

AL101419

10

26 x 16 mm

Etichete pentru marcator


Culoare: alb.
Unitate de vnzare: 1.000 buci/rol.

Cod
AL100910
AL100917

Dimensiuni etichete

21 x 12 mm
26 x 16 mm

Ribon rezerv
Se poate utiliza la toate tipurile de marcatoare.
Cod
DO9306

Etichete autoadezive pentru marcatoare


Albe sau fluorescente, etichetele sunt prezentate n role.

Uor de utilizat, aceste etichete autoadezive pot fi imprimate i


aplicate simplu, cu orice tip de marcator. Aspectul fluorescent al
etichetelor atrage atenia i evideniaz.

80

Cod

Culoare

Dimensiuni (mm)

Etichete/rol

DO261202

alb

26 x 12

1.500

DO261216

galben

26 x 12

1.500

DO221202

alb

22 x 12

1.000

DO221216

galben

22 x 12

1.000

DO261602

alb

26 x 16

1.000

DO261616

galben

26 x 16

1.000

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ambalare

Pungi din polietilen Ziplock


Pungi din polietilen, cu sistem de nchidere de siguran pentru mpachetarea
obiectelor mici. Unitate de vnzare: 100 buci/set.
Cod
IG2001

40 x 60

IG2002

60 x 80

IG2000

70 x 100

Dimenisuni (L x l)

IG2003

100 x 150

100 x 1 m

IG2004

180 x 250

Folie cu bule
Folie special din polietilen, pentru protecia obiectelor fragile. Diametrul bulei de
aer: 10 mm.
Cod
ST1700

Dimensiuni (mm)

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Elastice
Elastice
Unitate de vnzare: 100 g/cutie.

Cod
WI3040

Diametru

Unitate de vnzare

40 mm

1.000 g/pung

WI20050

50 mm

200 g/pung

WI3050

50 mm

1.000 g/pung
1.000 g/pung

Cod
AL13360

Dimensiuni (mm)

WI3060

60 mm

diametru 80 mm, lime 5 mm

WI20070

70 mm

200 g/pung

AL13361

diametru 100 mm, lime 5 mm

WI3070

70 mm

1.000 g/pung

AL13362

diametru 120 mm, lime 5 mm

WI3080

80 mm

1.000 g/pung

AL13363

diametru 160 mm, lime 5 mm

WI200100

100 mm

200 g/pung

AL13364

diametru 200 mm, lime 10 mm

WI3099

100 mm

1.000 g/pung

Sfoar
Sfoar iut: diametrul firului 1.5 mm, iut 100%, biodegrababil, higroscopic.
Numr metric 2/3, lungime 600 m/kg, sarcina de rupere 13 kg/for.
Sfoar bumbac: diametrul firului 2 mm, bumbac 100%, biodegradabil.
Cod
SF001

Material

Greutate (g)

iut

200

SF0011

iut

500

SF004

bumbac

100

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

81

ambalare

Cutii cu mnere
Cutii speciale, pliate, tanate, cu decupaj, netiprite.
Carton n 5 straturi.
Recomandate pentru depozitare i arhivare.
Unitate de vnzare: 10 buci/set.
Cod
IAMB999

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Dimensiuni (L x l x h mm)
550 x 320 x 350

Cutii pliate din carton


Realizate din carton ondulat, n 3 straturi. Prin proprietile sale: greutate redus,
rezisten mecanic mare, bun protecie a mrfurilor mpotriva aciunilor mecanice,
cartonul ondulat satisface cerinele diverselor ramuri industriale.
Unitate de vnzare: 10 buci/set.
Cod
AIT350

350 x 260 x 200

Dimensiuni (L x l x h mm)

AIT450

450 x 320 x 300

AIT600

600 x 400 x 400

AIT710

800 x 400 x 400

SFATUL SPECIALISTULUI
AVANTAJELE CUTIILOR DIN CARTON ONDULAT
COMAND
SPECIAL

Alte formate i dimensiuni sunt


disponibile la comand special.
Comand minim: 2.500 buci.

Cutiile de ambalare sunt fabricate din carton ondulat, acesta fiind


preferat ca material de mpachetat, deoarece: poate fi imprimat sau
personalizat, este bun protector, este avantajos ca i costuri i este
ecologic. Fiind realizat din materiale naturale, are o rat de reciclare
mai mare comparativ cu alte materiale de mpachetat.

Folie stretch
Soliditate i alungire excelente. Reduce considerabil costurile energetice.
Protejeaz mpotriva loviturilor, a impactului direct, a pierderilor la transportare.
Se poate utiliza pentru legare i rigidizare palei. Lime: 500 mm.
Cod
ST16023

Tip

Culoare

manual

transparent

2.2 kg

ST16024

manual

neagr

2.4 kg

COMAND
SPECIAL

82

Greutate

Alte culori sau grosimi la comand special. Pentru informaii


suplimentare contacteaz consultantul tu de vnzri.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ambalare

povestea unei mrci


Banda Tesafilm a aprut avnd la baz eecul producerii altui articol. Cnd farmacistul Dr.
Oscar Troplowitz a preluat laboratorul colegului su Beiersdorf, la sfritul secolului al 19-lea,
Troplowitz lucra la un leucoplast care trebuia s se fixeze puternic i s fie n acelai timp
blnd cu pielea.
Rezultatul muncii sale a fost un adeziv care adera excelent, dar irita pielea i n consecin
era nepotrivit pentru ngrijirea rnilor. Troplowitz a numit produsul Citoplast i l-a lansat
drept prima band adeziv de uz tehnic disponibil pe piaa german pentru vulcanizarea
cauciucurilor deteriorate de la biciclete.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Band adeziv STRONG


Band adeziv de bun calitate, pentru nchiderea coletelor i pachetelor de
greutate medie i mare. Din polipropilen de calitate cu rezisten mare n timp.
Desfurare uniform, fr zgomot. Adeziv fr diluani.
Cod
Dimensiuni
TS057167 50 mm x 66 m
TS057168 50 mm x 66 m

Culoare

Unitate de vnzare

transparent

rol

maro

rol

COMAND
SPECIAL

aplicare fr zgomot

Band adeziv
Band adeziv pentru ambalare cu rezisten i aderen ridicate, se deruleaz uor,
oferind excelente rezultate n ambalare.
Cod
TS01966

Dimensiuni

Culoare

Unitate de vnzare

19 mm x 66 m

transparent

rol

TS04866

48 mm x 66 m

transparent

rol

TS14866

48 mm x 66 m

maro

rol
adeziv din cauciuc natural

SUPER
CALITATE

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

83

ambalare
grosime 46 microni

Band adeziv
Band de sigilare a cartonului, de uz general, compus dintr-un suport din folie de
polipropilen de 28 microni, cu adeziv din cauciuc natural.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
Dimensiuni
TS004090 48 mm x 66 m
TS004089 48 mm x 66 m

COMAND
SPECIAL

Culoare

Unitate de vnzare

transparent

rol

maro

rol

adeziv din cauciuc natural

Band adeziv
Band TESA pentru operaiuni de baz, pentru nchiderea coletelor i pachetelor
uoare i de greutate medie. Cu rezisten i aderen ridicate.
Cod
TS02566

COMAND
SPECIAL

Dimensiuni

Culoare

Unitate de vnzare

25 mm x 66 m

transparent

rol

TS004281 48 mm x 66 m
TS004280 48 mm x 66 m

transparent

rol

maro

rol

adeziv din cauciuc sintetic

Band adeziv economic


Band standard pentru ambalare, cu adeziv acrilic. Poate fi utilizat la birou i n industrie.

CALITATE
PRE

Cod
LW00106

Dimensiuni

Culoare

Unitate de vnzare

19 mm x 66 m

transparent

rol

LW00105

25 mm x 66 m

transparent

rol

LW00101S

48 mm x 66 m

transparent

rol

LW00102S

48 mm x 66 m

maro

rol

Band de ambalare din hrtie


Are un suport de hrtie cu o folie de protecie ce nu conine silicon i un sistem
aderent ce nu conine solveni. Poate fi utilizat cu o gam larg de tipuri de carton
de diverse caliti. Rezist ocurilor scurte, dat fiind faptul c gradul de alungire
al hrtiei este foarte mare - dublu fa de benzile de hrtie convenionale. Banda
prezint durabilitate, deoarece produsul combin puterea aderent mare cu
rezistena bun la tensionare. Produsul este uor de derulat i este compatibil cu
aplicatoarele manuale sau cu echipamentele de ambalat.
Hrtia din material brut, natural, se adapteaz n mod armonios pe cutia de carton
i adaug ambalajului un aspect de finisare superioar. Este o band ecologic de
sigilare a cartonului, iar suportul este fabricat dintr-un material natural, din hrtie.
Deoarece produsul nu conine clor, ci numai numai derivate ale uleiurilor minerale,
arderea materialului nu duneaz mediului.
Cod
TS431300

84

Dimensiuni
50 mm x 50 m

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ambalare

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Dispenser band adeziv


Aparat pentru aplicarea benzii adezive de 50 mm. Uureaz munca de lipire
a cutiilor de carton, eliminnd irosirea benzii. Fiind uor de utilizat, crete
productivitatea mpachetrii. Include o band 48 mm x 50 m.
Cod
SC550066

rol inclus

TIAI C?

n ultima perioad s-a dezvoltat tot mai mult o gam de benzi i folii adezive i dublu
adezive pentru orice domenii industriale: tipografii offset - flexo - serigrafie - folio, producia
de hrtie i cartoane, producia de ambalaje din hrtie - carton sau flexibile, electronic electrotehnic, protecia suprafeelor la prelucrare - depozitare - transport, paletizare.
Benzile adezive pot avea suport din material textil, burete, aluminiu, PP, PVC, PE, PET, hrtie,
cerneal rzuibil.
Toate aceste tipuri de benzi adezive uureaz munca operatorilor din industria de ambalaje,
ct i din alte industrii n care sunt folosite.

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

85

benzi adezive speciale


Band adeziv de marcare
Band de marcare din PVC, rezistent i cu o bun vizibilitate, indic zonele de
risc. Dublur groas i rezistent, din vinil. Bun aderen pe mai multe suprafee.
Rezistent la substanele chimice i diluanii slabi. Utilizare: pentru marcarea
obiectelor mobile i statice; pentru marcarea obstacolelor i zonelor periculoase.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
TS60765

Dimensiuni (l x L)

Culori

50 mm x 33 m

negru/galben

TS60766

50 mm x 33 m

alb/rou

SUPER
CALITATE

Band delimitare
Confecionat din polipropilen.
Cod
MT100703

Dimensiuni (l x L)

Culori

70 mm x 200 m

alb/rou

MT100704

70 mm x 200 m

negru/galben

SUPER
CALITATE

Band adeziv
pentru mascare

fr solveni

Band adeziv de mascare din hrtie fin creponat, cu adeziv din cauciuc
natural. Pentru aplicaii universale, vopsit, zugrveli, sigilare, fixare i
ambalare produse uoare. Poate fi aplicat pe diverse suprafee: lemn, metal,
plastic. Rezist pn la 60 C. Se ndeprteaz fr urme.
Cod
TS43236

Dimensiuni (l x L)

TS43239

30 mm x 50 m

TS43233

50 mm x 50 m

19 mm x 50 m

Band adeziv pentru mascare


Band de hrtie uor creponat, de uz general, cu un adeziv din cauciuc
natural. Este potrivit aplicaiilor de uz general: mascare, sigilare, fixare,
mpachetri uoare etc.
COMAND
SPECIAL

86

Cod
NP434900

Dimensiuni (l x L)

NP434901

25 mm x 50 m

NP434902

30 mm x 50 m

NP434903

38 mm x 50 m

NP434904

50 mm x 50 m

19 mm x 50 m

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

benzi adezive speciale


Band dublu adeziv

fr solveni

Este utilizat la lipirea de metal, hrtie i plastic. Are rezisten crescut la


temperaturi ridicate. Ideal pentru fixarea covoarelor pe diverse suprafee,
pentru artizanat sau decorare. Se rupe cu mna.
Cod
TS56170

50 mm x 5 m

Dimensiuni (l x L)

TS56171

50 mm x 10 m

TS6462150*

50 mm x 50 m

01
SUPER
CALITATE

Band dublu adeziv


Recomandat pentru lipirea diverselor materiale: hrtie, carton, metal, cauciuc
etc. Utilizat preponderent n industria electronic sau de mobilier. Rezistent la
temperaturi ntre -10C i + 60C.
Cod
LW825033

Dimensiuni (l x L)

LW850033

50 mm x 33 m

25 mm x 33 m

Band dublu adeziv


buretat pentru interior

PROTOCOL, CURENIE I ADMINISTRATIVE

*suport PP, aplicaii industriale

Band de montare de mare rezisten, dublu adeziv, pentru o gam larg


de utilizri casnice, mai ales pentru fixarea obiectelor mici n amenajrile
interioare. Rezisten foarte mare, pn la 5 kg /10 cm de band. Poate fi
folosit pe plci de faian, tencuial, lemn i plastic.
Cod
TS557400

Dimensiuni (l x L)
1.5 m x 19 mm

Band dublu adeziv


buretat
Band de montaj dublu adeziv, cu aderen sporit, pentru fixarea n
siguran i rapid a oglinzilor i altor obiecte plate n ncperi umede.
Rezistent la umiditate, susine oglinzi cu dimensiuni maxime de 70 x 70 cm i
pn la 4 mm grosime. Potrivit pentru zonele umede, cum ar fi bile.
Cod
TS557320

Dimensiuni (l x L)
1.5 m x 19 mm

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

87

benzi adezive speciale

Band dublu adeziv


de montaj
Band dublu adeziv pentru fixarea sigur i rapid a obiectelor plate i uoare
pe majoritatea suprafeelor netede. Ideal pentru uz interior. Uor de aplicat.

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Cod
TS085650

SUPER
CALITATE

Dimensiuni (l x L)
19 mm x 1.5 m

COMAND
SPECIAL

Band autoadeziv
antialunecare
Este soluia perfect mpotriva alunecrii. Reprezint protecia ideal mpotriva
accidentelor pe trepte, rampe, scri, punile brcilor i alte suprafee alunecoase.
Poate fi utilizat la interior i n aer liber. Band extrem de rezistent i durabil,
disponibil i n culoare fluorescent. Aderen foarte bun, se rupe manual,
rezistent la ap, temperatur, UV i substanele de curat.
Cod
TS555870
SUPER
CALITATE

Dimensiuni (l x L)
25 mm x 5 m

COMAND
SPECIAL

rezistent la 10.000 de
deschideri i nchideri

Band autoadeziv arici


On & Off
Modul versatil de a organiza i fixa obiecte uoare din material textil. Utilizare:
pentru mbrcminte, textile de uz casnic i decoraiuni. Desprindei i reataai
obiectele dorite. Fermitate i rezisten pentru obiectele uoare.
Cod
TS55224

Dimensiuni (l x L)
20 mm x 100 cm

SUPER
CALITATE

rezisten sporit la umiditate

Band adeziv Duct Tape


Band adeziv compus dintr-un suport mpletit din estur PET/bumbac,
acoperit cu un adeziv din cauciuc natural. Este o band autoadeziv potrivit
unei game largi de aplicaii.
Caracteristici: aderen bun, chiar i pe suprafee aspre, uor de rupt cu mna,
rezistent la ap, flexibil.
Aplicaii principale: izolarea evilor, lipirea foliilor de protecie, sigilarea sacilor
de gunoi, lipire, nchidere, ambalare.
Cod
TS461348

Dimensiuni (l x L)

Culoare

48 mm x 50 m

argintiu

SUPER
CALITATE

88

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

benzi adezive speciale


Crlige adezive
Powerstrips Small
Classic

Cod
TS57530

SUPER
CALITATE

Dimensiuni (l x L)
3 crlige i 4 fii Powerstrips mici

COMAND
SPECIAL

uor de montat, fr
guri, uruburi sau cuie

Fii dublu adezive


Powerstrips Large
Alternativa la gurire, ciocan i cuie. Susinere puternic a obiectelor cu o
greutate de pn la 2 kg, pe majoritatea suprafeelor netede. ndeprtare fr
urme, datorit tehnologiei unice Powerstrips.
Cod
TS58000

Unitate de vnzare
10 fii/set

01
PROTOCOL, CURENIE I ADMINISTRATIVE

Asigur susinerea obiectelor de pn la 1 kg. Fabricate din plastic de nalt


calitate. Sunt ideale pentru fixarea obiectelor din buctrie, baie sau atunci
cnd cltorii. Pot fi utilizate pe gresie, sticl, lemn, plastic i o gam larg de
alte suprafee netede. Uor de montat, fr guri, uruburi sau cuie.
Culoare: alb.

SUPER
CALITATE

COMAND
SPECIAL

Crlige permanente ovale


Asigur o fixare permanent fiabil pentru obiectele uoare. Gam larg de
utilizri domestice la diferite suprafee. Fabricate din oel inoxidabil lefuit, placate
cu crom sau plastic alb lucios de calitate superioar.
Utilizabile pe sticl, lemn, plastic, dar i alte suprafee netede. Uor de montat,
fr gurire, uruburi sau cuie. Uor de manipulat.
Cod
TS660030

Tip

TS660050

oel, crom

plastic, alb

COMAND
SPECIAL

SUPER
CALITATE

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

89

benzi adezive speciale

Band electroizolatoare

Cod
TS53947

SUPER
CALITATE

Dimensiuni (l x L)
19 mm x 20 m

protecie electric
de pn la 6.000 V

PROTOCOL, CURENIE I ADMINISTRATIVE

01

Band adeziv fiabil, protectoare, pentru izolarea, nfurarea i legarea firelor


i cablurilor electrice. Protejeaz nveliurile cablurilor. Este ignifug i uor de
nfurat i modelat n jurul suprafeelor neregulate. Asigur protecie electric
de pn la 6.000 V. Atestat conform normei IEC 454-3-1. Culoare: negru.

Band arici Cable Manager


Util pentru legarea cablurilor i a altor obiecte. Poate fi tiat la dimensiunea
dorit. Ideal pentru utilizare casnic sau la birou, pentru aranjare, legare i
transport. Rezist la 1.000 de nchideri i deschideri. Culoare: negru.
Cod
TS552390

Dimensiuni (l x L)
10 mm x 5 m

Spray adeziv permanent


Adezivul Spray Permanent tesa este un adeziv versatil pentru lipirea
permanent a materialelor precum hrtia, cartonul, psla, folia, pielea i
diverse materiale plastice.
SHQWUXOLSLUHDFXUDWHFRQRPLFVLJXULUDSLGDVXSUDIHHORUPDUL
SRWULYLWSHQWUXPDWHULDOHGHJUHXWDWHPLFLPHGLHFXVXSUDIHHXRUQHUHJXODWH
GLVSHUVLHQLXQLIRUPDDGH]LYXOXL
XVFDUHUDSLG
UH]LVWHQODXPH]HDOLWHPSHUDWXULQWUHr&Lr&
IUVLOLFRQ

SUPER
CALITATE

Cod
TS600210

COMAND
SPECIAL

Cantitate
500 ml

Spray pentru ndeprtarea


adezivului
Este proiectat pentru ndeprtarea reziduurilor de adeziv de pe componentele
din plastic, sticl i suprafeele metalice.
QGHSUWHD]VLJXUUH]LGXXULOHSURYHQLWHGHODPDMRULWDWHDEHQ]LORUDGH]LYH
adezivilor i etichetelor
VHHYDSRUIUDOVDUH]LGXXUL
SXOYHUL]DWRUXODMXQJHFKLDULQFHOHPDLGLFLOHLDVFXQVHORFXUL
IUVLOLFRQ

SUPER
CALITATE

Cod
TS60042

90

Cantitate
200 ml

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

2. Organizare i arhivare
bibliorafturi

92

clasificatoare metalice

120

accesorii pentru arhivare

100

dosare din carton

121

caiete mecanice

101

dosare din plastic

124

separatoare

102

serviete i mape

126

indeci

104

mape din carton

127

file din plastic

107

clipboarduri

128

cutii de arhivare

114

clasoare pentru cri de vizit

129

dosare suspendabile

118

bibliorafturi

02
documentele cu volum mare
pot fi arhivate toate odat

ORGANIZARE I ARHIVARE

arhivare cu 20% mai rapid i mai facil

permite arhivarea pe ambele


pri ale mecanismului

Biblioraft Leitz 180


Biblioraft de o calitate deosebit, plastifiat la exterior cu folie din polipropilen (PP)
i interior din carton. Prevzut cu mecanism din metal, cu deschidere 180.
Capacitate de pn la 600 de coli (80 mm), respectiv 350 coli (52 mm).
Cod
SL151x

Lime (mm)

SL150x

80

52

x-culoare: 1- rou, 2- albastru, 3- negru, 4- galben, 5- verde

cel mai vndut


biblioraft din Europa

SUPER
CALITATE

GARANIE

pentru
mecanism

capacitate: 600 coli

garanteaz o bun aliniere a inelelor de pe cotor

92

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

bibliorafturi
CALITATE GERMAN - GARANIE 10 ANI
capacitate
sporit
80 mm

Biblioraft Chromocolor

02

Cod
FA0265x
FA0268x

Lime (mm)

Unitate de vnzare

50

bucat

50

cutie (10 buci)

80

bucat

80

cutie (10 buci)

ORGANIZARE I ARHIVARE

Biblioraft de o calitate superioar, plastifiat cu folie din polipropilen (PP)


interior i exterior ntr-un strat subire, caracteristic ce ofer durabilitate
foarte mare produsului. Colurile inferioare protejate cu metal asigur o
utilizare ndelungat, iar finisajul acestora nu permite zgrierea rafturilor.
Prevzut cu mecanism metalic nichelat, de nalt fiabilitate, inel de prindere
pe cotor i buzunar din plastic pentru etichete interschimbabile.
Capacitate de pn la 600 de coli (80 mm), respectiv 350 coli (50 mm).

x-culoare: 01- negru, 02- alb, 03- verde, 04- rou, 05- albastru,
06- galben, 07- albastru deschis, 08- portocaliu, 09- verde deschis,
10- gri, 11- fucsia

mecansim rezistent

10 ani garanie pentru mecanism

10
GARANIE

in metalic

SUPER
CALITATE

ndosariere pn la 600 coli

nuane atrgtoare, ce aduc


un plus de culoare biroului tu

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

93

bibliorafturi

PERFECT
STABIL

3 ANI

02

TESTAT!
Garantat pentru
10000 de utilizri
fr eroare.

Biblioraft Standard

ORGANIZARE I ARHIVARE

GARANIE

Produs de o calitate deosebit, plastifiat cu folie din polipropilen (PP)


exterior i interior. Buzunar transparent pentru etichete, margini
metalice pentru protejarea colurilor. Palet foarte larg de culori.
Capacitate de pn la 500 de coli (75 mm), respectiv 350 coli (50 mm).
Cod
SL12x
SL11x

Lime (mm)

Unitate de vnzare

50

bucat

50

cutie (10 buci)

75

bucat

75

cutie (10 buci)

x-culoare: 01- alb, 02- galben, 03- rou, 04- portocaliu,


05- albastru, 06- verde, 07- negru, 08- gri, 09- viiniu,
10- violet, 11- turcoaz, 16- albastru deschis, 17- piersic,
18- albastru VIVIDA, 19- rou VIVIDA, 20- verde VIVIDA,
21- galben VIVIDA

SUPER
CALITATE

Oricare ar fi meseria ta, avem produsul potrivit.

95

bibliorafturi

Biblioraft plastifiat color


Biblioraft foarte rezistent, cu o finisare deosebit, plastifiat exterior
cu folie din polipropilen (PP), lavabil. Colurile inferioare protejate la
exterior cu metal permit o utilizare ndelungat. Prevzut cu mecanism
metalic nichelat, de nalt fiabilitate, inel de prindere i buzunar din
plastic pe cotor pentru etichete interschimbabile. Capacitate de pn la
600 de coli (80 mm), respectiv 350 coli (50 mm).

02

Cod

ORGANIZARE I ARHIVARE

FA0295x
FA0298x

Lime (mm)

Unitate de vnzare

50

bucat

50

cutie (25 buci)

80

bucat

80

cutie (20 buci)

x-culoare: 01- negru, 02- alb, 03- rou, 04- albastru, 05- verde,
06- galben, 10- gri, 11- roz, 12- bleu, 13- portocaliu,
14- verde deschis

10

mecansim rezistent

GARANIE

ndosariere pn la 600 coli

in metalic

Biblioraft marmorat
Confecionat din carton rigid, mecanism metalic nichelat, coluri inferioare
protejate cu metal. Cotorul este acoperit cu polipropilen n diverse culori
i dispune de inel de prindere. Capacitate de pn la 600 de coli (80 mm),
respectiv 350 coli (50 mm). Culoare: negru marmorat. Produs realizat din
carton reciclat.
Cod
FA02850x
organizare pe
coduri de culori

10

FA02880x

Lime (mm)

Unitate de vnzare

50

bucat

50

25 buci/cutie

80

bucat

80

20 buci/cutie

x-culoare cotor: 1- negru, 2- rou, 3- albastru, 4- verde, 5- galben

GARANIE

SUPER
CALITATE

Biblioraft
cu 2 mecanisme
Biblioraft A3
Biblioraft destinat clasrii formularelor bancare, extraselor, etc. Fabricat din
carton rigid. Prevzut cu 2 mecanisme metalice nichelate, de nalt calitate i
inel de prindere. Dimensiuni: 318 x 285 mm. Culoare: negru marmorat.
Cod
FA000101

96

Lime (mm)
70

Biblioraft cu margine metalic, confecionat din carton rigid, cu mecanism


metalic nichelat pentru prinderea documentelor. Culoare: negru.
Cod
FA000100

Lime (mm)
75

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

povestea unei mrci


De peste 100 de ani numele Falken este cunoscut n Europa i mai ales n Germania ca lider pe piaa produselor de organizare i arhivare. Pe lng
sortimentul generos de produse din carton i plastic, Falken este cunoscut mai ales ca productor de bibliorafturi de nalt calitate, deinnd una
dintre cele mai mari fabrici de bibliorafturi din lume.
Calitatea german a produselor, experiena n conceperea i producia de articole pentru birou destinate clasificrii i atenia sporit pentru mediu,
fac din produsele Falken articole indispensabile oricrui birou.

bibliorafturi

povestea unei mrci


Rdcinile Esselte dateaz nc din 1913 i de peste 100 de ani Esselte este inovator n organizare. Pasiunea
pentru arhivare i organizare se afl n centrul preocuprilor Esselte. De mai bine de 100 de ani compania a
dezvoltat produse funcionale, moderne i de calitate nalt, pentru organizarea optim a biroului tu.
n viziunea Esselte, organizarea corect ajut utilizatorii s lucreze mai eficient, iar produsele Esselte te ajut
s-i faci treaba mai bine, mai uor i mai repede. Esselte From To Do To Done.

ORGANIZARE I ARHIVARE

02
Biblioraft Economy
Biblioraft de calitate, plastifiat la exterior cu folie din polipropilen (PP).
Prevzut cu buzunar pentru etichete, muchie metalic pentru protejarea
colurilor i inel de prindere metalic pe cotor. Disponibil ntr-o gam vast
de nuane, ceea ce confer utilizatorilor posibilitatea de a-i organiza
documentele pe coduri de culori. Capacitate de pn la 500 de coli (75 mm),
respectiv 350 coli (50 mm).
Cod
SL13x
CALITATE
PRE

SL14x

Lime (mm)

Unitate de vnzare

50

bucat

50

cutie (25 buci)

75

bucat

75

cutie (20 buci)

x-culoare: 01- galben, 02- portocaliu, 03- alb, 04- rou,


05- albastru, 06- verde, 07- negru, 08- gri, 09- viiniu,
10- violet, 11- turcoaz

in metalic

buzunar pentru etichet

inel metalic de prindere

Etichete din carton pentru bibliorafturi


Pentru bibliorafturile Standard i Economy.
Culoare: alb. Unitate de vnzare: 10 buci/set.
Cod
SL1413

50 x 158

Dimensiuni (mm)

SL1412

30 x 158

Etichete autoadezive
pentru bibliorafturi
Pentru biblioraftul marmorat Falken. Diverse culori.
Unitate de vnzare: 10 buci/set.
Cod
FA066x

Dimensiuni (mm)

FA067x

36 x 190

60 x 190

x-culoare : 2- rou, 3- galben, 4- albastru, 5- verde

Etichete autoadezive
pentru bibliorafturi
Pentru biblioraftul marmorat Falken. Culoare: alb.
Unitate de vnzare: 10 buci/set.

98

Cod
FA0661

Dimensiuni (mm)

FA0671

36 x 190

60 x 190

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

bibliorafturi

Biblioraft Extra
Biblioraft din carton, plastifiat interior i exterior, prevzut cu mecanism metalic
nichelat i margine metalic pentru protejarea colurilor. Dispune de buzunar din
plastic pentru etichete interschimbabile i inel de prindere metalic pe cotor.
Cod
HS0165x

50

Lime (mm)

HS0185x

75

02

CALITATE
PRE

Biblioraft Esenial

ORGANIZARE I ARHIVARE

x-culoare: 1- negru, 3- verde, 4- albastru, 5- bleu, 7- rou, 8- galben

Biblioraft din carton, plastifiat exterior, prevzut cu mecanism metalic nichelat i


margine metalic pentru protejarea colurilor. Dispune de buzunar din plastic pentru
etichete interschimbabile i inel de prindere metalic pe cotor.
Cod
HS0212x

50

Lime (mm)

HS0211x

75

x-culoare: 1- negru, 3- verde, 4- bleu, 5- albastru, 6- rou, 8- galben

CALITATE
PRE

Biblioraft Simplu
Confecionat din carton rigid embosat, mecanism metalic nichelat, coluri inferioare
protejate cu metal, inel de prindere pe cotor. Culoare: negru marmorat.
Cod
LO00500
LO00800

Lime (mm)

Unitate de vnzare

50

bucat

50

cutie (10 buci)

75

bucat

75

cutie (10 buci)

Etichete din carton pentru bibliorafturi


Pentru biblioraftul RTC Extra i Esenial. Culoare: alb.
Unitate de vnzare: 20 buci/set.
Cod
FA0681

Dimensiuni (mm)

HS0176

25 x 142

45 x 142

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

CALITATE
PRE

99

accesorii pentru arhivare

Alonje autoadezive cu
sistem de ndosariere
Fabricate din metal acoperit cu plastic alb, cu suprafa puternic adeziv.
Dotate cu marcaj pentru o poziionare corect. Folosite pentru ndosarierea
documentelor n bibliorafturi, caiete mecanice i dosare suspendabile.
Unitate de vnzare: 100 buci/set.

ORGANIZARE I ARHIVARE

02

Cod
DB690802

SUPER
CALITATE

Dimensiuni (mm)
20 x 150

Alege alonjele din material plastic ca alternativ pentru ndosariere!


Aceste accesorii de arhivare sunt rezistente la rupere i se pot folosi cu succes la ndosarierea revistelor, ziarelor sau brourilor.

Alonje cu sistem
de ndosariere
Fabricate din material plastic foarte rezistent, cu perforaii standard la 60 mm i
80 mm pentru ndosarierea n bibliorafturi sau caiete mecanice.
Dimensiuni: 40 x 150 mm.
Cod
VF2005020

Culoare

Unitate de vnzare

rou

25 buci/set
25 buci/set

VF2005050

albastru

VF2005080

negru

25 buci/set

VF2005090

alb

25 buci/set

FA041

diverse culori

250 buci/set

Buzunare autoadezive
Pocketfix
Buzunare autoadezive fabricate din PVC transparent pentru inserie de
documente, notie etc, fr a necesita perforarea acestora. Se pot aplica pe
dosare, mape, bibliorafturi, caiete mecanice.
Format: dreptunghiular.

100

Cod
DB809519

Dimensiuni (mm)
297 x 210

3 buci/set

DB809419

148 x 210

5 buci/set

DB807919

62 x 93

10 buci/set

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Unitate de vnzare

caiete mecanice
Caiet mecanic Panorama
Caiet mecanic confecionat din polipropilen de cea mai bun calitate, att n
interior, ct i n exterior. n buzunarul transparent de pe copert se pot insera
printuri A4. Buzunarul pentru etichete de pe cotor faciliteaz identificarea cu
uurin a produsului. Format: A4, 4 inele.
Culoare: alb.
Cod
SL030201

Diametru inele (mm)


16

form rotund

SL030202

25

form D

SL030203

30

form D

SUPER
CALITATE

Tip inele

40

form D

60

form D

ORGANIZARE I ARHIVARE

SL030204
SL030206

02

personalizeaz etichete pentru


caietele mecanice Panorama

insereaz eticheta printat n


buzunarul transparent de pe cotor

insereaz eticheta printat n


buzunarul transparent de pe copert

ideal pentru ntlniri de afaceri


sau pentru utilizarea frecvent

Caiet mecanic
Caiet mecanic premium, plastifiat pe exterior cu folie din polipropilen.
Format: A4.
Cod
FA00022x

Nr. inele

Diametru inele (mm)

25

FA00024x

25

x-culoare: 1- negru, 2- rou, 3- albastru,


4- verde, 5- galben, 6- alb, 7- gri
gam variat de culori

TIAI C?
Primele caiete mecanice erau confecionate din
carton, spre deosebire de cele din zilele noastre,
care sunt fabricate de cele mai multe ori din PVC sau
polipropilen. La sfritul anilor 1800 mecanismele
erau fabricate din oel laminat la rece. Metalul era, de
asemenea, placat cu nichel i lustruit. n ziua de azi,
mecanismele sunt confecionate din oel.

Caiet mecanic
Caiet mecanic plastifiat exterior cu folie din polipropilen. Prevzut cu inel de
prindere pe cotor. Format: A4.
Cod
HS2553x

Nr. inele

Diametru inele (mm)

25

HS2583x

25

x-culoare: 0- negru, 3- rou, 4- albastru

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

101

separatoare
Separatoare din plastic cu index
Fabricate din material de calitate, durabil, sunt destinate organizrii i cutrii mai
eficiente a documentelor arhivate. Prevzute cu 11 perforaii. Indexul este mai lat n
comparaie cu foliile de protecie, astfel nct colile arhivate pot fi organizate cu o
mai mare eficien. Format: A4. Culoare: gri.

ORGANIZARE I ARHIVARE

02

Cod
SL4001

1-5

Tip index

SL4002

1-10

SL4003

1-12

SL4004

1-31

SL4008

1-20

SL4005

A-Z

SL4006

IAN-DEC

Utilizai separatoarele pentru ordonarea documentelor


arhivate n bibliorafturi sau caiete mecanice.

Separatoare Mylar cu index laminat


Fabricate din carton, recomandate organizrii documentelor n bibliorafturi i caiete
mecanice. Separatoarele Mylar au indexul laminat, lucru ce le confer o bun
durabilitate n timp. Prevzute cu 11 perforaii plastifiate pentru arhivare.
Format: A4.
Cod
SL4021

1-10

Tip index

SL4022

1-12

SL4023

1-31

SL4024

A-Z

SL4025

IAN-DEC

multiperforaii din plastic, ranforsate


pentru o durat de via mai ndelungat

index laminat printat


fa-verso

Separatoare color numerotate


Realizate din carton reciclat de 180 g/mp. Sunt prevzute cu perforaii pentru
ndosariere. Format: A4. Unitate de vnzare: 10 buci/set.
Cod
FA0361

Tip index

Culoare

1-10

chamois

FA0362

1-10

albastru

FA0363

1-10

rou

FA03641

1-10

verde

multiperforaii ntrite

colile pot fi personalizate prin


decuparea marginilor

102

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

separatoare

SFATUL SPECIALISTULUI
SEPARATOARE DIN PLASTIC SAU CARTON
Avantajul principal al separatoarelor din carton este personalizarea facil, ele putnd fi inscripionate chiar i cu pixul. Nuanele variate
transform separatoarele color n instrumente utile pentru organizarea i arhivarea documentelor. Uor de folosit, separatoarele din plastic
sunt instrumentele ideale pentru o organizare i indexare mai eficient. Structura plastifiat garanteaz rezisten sporit la rupere sau ptare,
asigurnd o utilizare ndelungat a produsului.

02
ORGANIZARE I ARHIVARE

Separatoare cu index color


File de culoare identic pe toat suprafaa i perforaii pentru o utilizare ct mai
eficient. Gramaj carton: 160 g/mp. Format: A4. Diverse culori.
Cod
VF4347

Unitate de vnzare

VF4348

10 buci/set

VF4349

12 buci/set

6 buci/set

Index color pentru o mai bun vizibilitate.

Separatoare din plastic cu index color


File de culoare identic pe toat suprafaa, realizate din polipropilen flexibil.
11 perforaii pentru ndosarierea standard. Format: A4. Diverse culori.
Cod
DY000351

5 buci/set

Unitate de vnzare

DY000361

10 buci/set

CALITATE
PRE

Separatoare din plastic


Separatoare cu index numerotat, realizate din polipropilen flexibil. 11 perforaii
pentru ndosarierea standard. Format: A4. Culoare: gri.
Cod
DY00036

1-10

Tip index

DY00037

1-12

DY00038

1-20

DY00039

1-31

DY00040

A-Z

Separatoare color
Confecionate din carton colorat n mas. Utile pentru organizarea i arhivarea
documentelor n bibliorafturi. Gramaj carton: 160 g/mp.
Dimensiuni: 105 x 240 mm. Unitate de vnzare: 100 buci/set.
Cod
FA05121

Culoare

FA05221

rou

FA05321

galben

FA05421

verde

albastru

SUPER
CALITATE

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

103

indeci
Ideali pentru semnalizare n rapoarte, analize, manuale de instructaj sau diverse prezentri, indecii multicolori ajut la o mai bun
localizare a informaiilor n documente cu un numr mare de pagini.

Index Post-it Clasic


Ideal pentru marcarea i evidenierea informaiilor, se ndeprteaz cu uurin,
fiind repoziionabil. Informaiile pot fi notate direct pe index.
Dimensiuni: 25.4 x 43.2 mm. Unitate de vnzare: 50 indeci/set.

ORGANIZARE I ARHIVARE

02

Cod
3M6801

Tip

Culoare

index clasic, 1 set

galben

3M6802

index clasic, 1 set

rou

3M6803

index clasic, 1 set

verde

3M6804

index clasic, 1 set

albastru

3M6814

index clasic duo, 2 seturi

galben/rou

SUPER
CALITATE

Index Post-it Mini


Formatul mic este soluia ideal pentru codificare! Indexul Post-it Mini este
repoziionabil, permite organizarea informaiei, se ndeprteaz fr a distruge
suprafeele, se poate scrie pe el. Dimensiuni: 11.9 x 43.2 mm.
Unitate de vnzare: 4 culori/set, 35 file/culoare.
Cod
3M6807

SUPER
CALITATE

Dispenser Post-it Index


Dispenserul Post-it Index te ajut s lucrezi mai bine i mai eficient, s
economiseti timp, s fii mai organizat la birou, avnd un mixt de indeci mereu
la ndemn, pe biroul tu: conine 4 culori Post-it index mini, rou, galben,
albastru, verde 50 file fiecare i 1 bucat x 50 file de Post-it index clasic rou.
Dispenserul este prevzut cu ventuz glisant pentru a fi utilizat cu uurin cu o
singur mn.
LQGHFLLVXQWGLVSXLQIRUPGH]VXQWUHSR]LLRQDELOLIUDDIHFWDVXSUDIDDSH
care ader, au jumtate din suprafa colorat i jumtate transparent pentru a
nu acoperi informaiile importante
VXQWXWLOL]DLSHQWUXPDUFDUHHYLGHQLHUHDLQIRUPDLLORULPSRUWDQWHGLQ
documente, facturi, contracte, nsemnri din timpul cursurilor, conferinelor
DQWLVWDWLFGXUDELOQXVHQJOEHQHWHODGHSR]LWDUHQXDEVRDUEHFHUQHDODPDUNHUXO
ED]HD]WHSHGLVSHQVHUXO3RVWLW Index pentru sarcinile importante de la birou!
SUPER
CALITATE

104

Cod
3M680002

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

indeci

CALITATE
PRE

Index autoadeziv zig-zag


Indexul adeziv zig-zag v ajut s v organizai biroul mult mai eficient.
Minidispenser cu nveli protector semitransparent i capt colorat.
Dimensiuni: 24 x 45 mm. Unitate de vnzare: 50 indeci/set.
Cod
AL012610

Culoare

AL012611

albastru

AL012612

verde

AL012613

rou

02
ORGANIZARE I ARHIVARE

galben

Index autoadeziv zig-zag 4 culori


Indexul zig-zag v ajut n organizarea mai eficient a muncii. Cele 4 culori diferite
ofer un efect de evideniere ideal pentru marcarea informaiilor.
Dimensiuni: 12 x 45 mm.
Cod
Descriere
AL012482 culori fluorescente, 40 file/culoare (verde, galben, portocaliu, roz)
AL012483 culori mate, 35 file/culoare (rou, galben, verde, albastru)

CALITATE
PRE

Index autoadeziv
Ideal pentru evidenierea, clasificarea i organizarea documentelor.
Cod
Descriere
AL011912 plastic, 12 x 45 mm, 5 culori x 25 file (albastru, verde, galben
orange i roz)
AL011286 hrtie, 20 x 50 mm, 4 culori x 40 file (roz, orange, verde i
galben)

CALITATE
PRE

TIAI C?
La nceputul anilor 70, n timp ce era la
biseric, Art Fry a observat ca semnele lui de
carte cdeau mereu. Dup ce s-a consultat
cu Spence Silver, colegul su care a dezvoltat
un adeziv puternic, dar care se ndeprta cu
uurin, a aprut ideea de semn de carte
repoziionabil. Mai trziu, acest produs va
deveni cunoscut sub numele de index.

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

105

indeci

Index autoadeziv
Index color din plastic, repoziionabil. Se pot face nsemnri pe el.
Dimensiuni: 12 x 45 mm, 25 file/culoare.
Cod
KS00010

5 culori, 25 file/culoare

KS00011

8 culori, 25 file/culoare, rigl din plastic, de 12 cm

KS00012

8 culori, transparent neon, 15 file/culoare, rigl din


plastic, de 12 cm

KS00011

ORGANIZARE I ARHIVARE

02

KS00010

Descriere

KS00012

Index autoadeziv
Index color, se ndeprteaz cu uurin, permind repoziionarea.

AY000808

Cod
AY000807

Caracteristici

AY000808

hrtie, dimensiuni 20 x 50 mm, 4 culori/set, 40 file/culoare

plastic, dimensiuni 12 x 44 mm, 5 culori/set, 25 file/culoare

AY000807

Index autoadeziv
Index color, se ndeprteaz cu uurin, permind repoziionarea.
BV031111

Caracteristici

BV031211

plastic, form sgeat, dimensiuni 12 x 45 mm,


5 culori/set, 25 file/culoare

BV031212

plastic, dimensiuni 12 x 45 mm, 5 culori/set, 25 file/culoare

hrtie, dimensiuni 19 x 76 mm, 4 culori/set, 100 file/culoare

BV031211

BV031212

106

Cod
BV031111

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

file din plastic


File de protecie Proiect
File rezistente, din polipropilen orange peel, destinate organizrii i depozitrii att
de documente printate, ct i n format electronic. 2 CD-uri/fil.
Grosime: 120 microni. Format: A4, cu deschidere n partea superioar.
Cod
SL2035

Unitate de vnzare
5 buci/set

File de protecie cu fermoar


Pentru documente i alte accesorii de birou. Fabricate din polipropilen foarte
rezistent. Sistemul de nchidere cu fermoar asigur o pstrare mai sigur a
documentelor sau obiectelor stocate, diminund astfel riscul pierderii acestora.
Suprafa cristal, deschidere n partea lateral. Grosime: 200 microni. Format: A4
(mpreun cu marginea cu perforaii).
Cod
RP00511

Unitate de vnzare
5 buci/set

ORGANIZARE I ARHIVARE

02

utile pentru depozitarea accesoriilor


de dimensiuni reduse, precum pixuri,
calculatoare de birou, rigle, radiere etc

File de protecie cu fermoar


Folie de protecie transparent, cu perforaii pentru ndosariere. Deschidere pe
partea lateral dreapta, prevzut cu fermoar de plastic. Format: A4.
Cod
DY200303

Unitate de vnzare
5 buci/set

File de protecie cu clap lateral


Prevzute cu perforaii standard pentru ndosariere. Se pot utiliza att pentru
depozitarea de documente, ct i pentru mici accesorii pentru birou. Format: A4.
Cod
DY200301

Unitate de vnzare
25 buci/set

File de protecie cu burduf


Fabricate din polipropilen transparent, deschidere n partea superioar
Prevzute cu 4 perforaii pentru ndosariere. Format: A4.
Cod
DY200302

Unitate de vnzare
25 buci/set

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

107

file din plastic

02

documentele forate n folii de protecie standard sunt


deformate i ocup mai mult spaiu n bibliorafturi/caiete
mecanice

documentele de dimensiuni mari pot fi depozitate n folii de


protecie speciale pentru a nu fi deformate

foliile de protecie Jumbo pot depozita pn la 200 de coli


de 80 g/mp

ORGANIZARE I ARHIVARE

Filele Jumbo se folosesc pentru pstrarea n siguran a cataloagelor, crilor de telefon,


desenelor tehnice i a altor documente de dimensiuni mari.

ranforsare cu metal

File de protecie Jumbo Extra


Destinate depozitrii n siguran a crilor de telefon, cataloagelor, desenelor tehnice
mari i a altor documente de dimensiuni mari. Datorit muchiei metalice, foliile nu
se deplaseaz n biblioraft sau n caietul mecanic nici dac numrul acestora este
foarte mare. Dotate cu burduf de 20 mm, sunt realizate dintr-un material foarte
rezistent. Deschidere n partea superioar.
Capacitate: 200 coli. Grosime: 170 microni.

SUPER
CALITATE

Cod
SL000161

Unitate de vnzare
3 buci/set

File de protecie Jumbo cu clap


Fabricate din polipropilen rezistent, nchidere cu clap flexibil n partea
superioar. Format: A4, burduf de 20 mm. Capacitate: 200 coli.
Grosime: 170 microni.
Cod
SL2034

Unitate de vnzare
5 buci/set

pentru cataloage

Documentele se pot transporta n siguran, fr a fi


deteriorate, datorit clapei superioare pliabile.

File de protecie Jumbo


Fabricate din material rezistent, suprafa orange peel. Deschidere n partea
superioar. Format: A4, burduf de 20 mm. Capacitate: 200 coli.
Grosime: 170 microni.

fr documente deformate

Cod
SL000153

Unitate de vnzare
10 buci/set

Filele Jumbo se folosesc pentru pstrarea n siguran


a crilor de telefon, cataloagelor, desenelor tehnice i
altor documente de dimensiuni mari.

108

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

file din plastic


Mapa ce se transform n folie de protecie
sistemul unic de pliere a marginii perforate
pentru arhivare permite flexibilitate n
utilizare. CombiFile poate fi folosit att ca
folie de protecie, ct i ca map.

sistem unic de nchidere


pentru sigurana
documentelor.

ORGANIZARE I ARHIVARE

02
etichet interschimbabil
pentru o sistematizare
eficient i acces uor la
documente

3 separatoare

File CombiFile cu separatoare


Hibrid de map i folie de protecie cu 3 separatoare. Sistemul de pliere al
perforaiilor permite o flexibilitate mai mare n organizarea documentelor. Etichet
de mari dimensiuni. Buzunarul poziionat pe col asigur o mai bun protecie a
documentelor. Format: A4, grosime 200 microni, capacitate: 3 x 20 coli.
Culoare: transparent.
Cod
SL20521

etichet pentru
identificarea uoar
a documentelor.

Unitate de vnzare
3 buci/set

nchiderea pe 1/6 din


marginea dreapt previne
pierderea documentelor.

File CombiFile Jumbo cu clap


Hibrid de map i folie de protecie cu burduf de 20 mm. Sistemul unic de pliere al
perforaiilor permite o flexibilitate mai mare n organizarea documentelor. Etichet
pentru o sistematizare eficient. Format: A4, grosime 200 microni, capacitate: 150 coli.
Culoare: transparent.
Cod
SL20511

Unitate de vnzare
3 buci/set

pentru 150 coli


Sunt extrem de utile n cazul n care ai nevoie de
transportul organizat al documentelor.

Sistem de nchidere cu clap


pentru sigurana documentelor.

File CombiFile cu etichet


Hibrid de map i folie de protecie. Sistemul unic de pliere al perforailor permite
o flexibilitate mai mare n organizarea documentelor. Etichet n partea inferioar,
pentru o sistematizare eficient. Buzunarul poziionat pe col asigur o mai bun
protecie a documentelor. Format: A4, grosime 200 microni, capacitate: 40 coli.
Culoare: transparent.
Cod
SL20501

Unitate de vnzare
5 buci/set

sistem unic de pliere a marginii perforate

Polipropilen flexibil de cea mai


bun calitate. Design elegant.

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

109

file din plastic

File cu deschidere special


File realizate din polipropilen tip orange peel, cu 11 perforaii standard pentru
ndosariere. Prevzute cu deschidere n partea superioar i partea stng. Faciliteaz
accesul la documente fr a mai fi extrase din biblioraft. Format: A4 portrait.
Cod
RP00230

ORGANIZARE I ARHIVARE

02

Unitate de vnzare
100 buci/set

File de protecie cu margine color


Filele de protecie cu margini colorate asigur o cutare i organizare mai bun
a documentelor. Suprafa de tip cristal, deschidere pe latura superioar. Un set
conine 5 buci din fiecare culoare (rou, verde, galben, albastru, alb).
Grosime: 105 microni.

CALITATE
PRE

Cod
DY000300

Unitate de vnzare
25 buci/set

File de protecie pentru


cri de vizit
Fabricate din polipropilen de tip cristal. Format: A4, cu deschidere n partea lateral
i cu o capacitate de 8 cri de vizit/pagin sau 16 cri de vizit/coal. Prevzute cu
11 perforaii pentru ndosariere standard. Grosime: 105 microni.
Cod
SL000159

Utilizate mpreun cu un
caiet mecanic i index
A-Z, alctuiesc soluia ideal de
sistematizare a crilor de vizit.

Unitate de vnzare
10 buci/set

Pentru caiete mecanice


i separatoare consult
paginile 101-103 !

File de protecie
pentru cri de vizit
File de protecie realizate din polipropilen, utilizate pentru protejarea i
sistematizarea crilor de vizit. Prevzute cu deschidere n partea lateral i 11
perforaii standard pentru ndosariere. Format: A4. Capacitate: 20 cri de vizit,
fa-verso. Grosime: 120 microni.

SUPER
CALITATE

Cod
FA100210

Unitate de vnzare
10 buci/set

File pentru CD-uri


clap lateral
Deschidere n partea lateral i perforaii standard pentru ndosariere. Prevzute cu
o clap lateral pentru a evita pierderea CD-urilor.
Unitate de vnzare: 10 buci/set.

110

Cod
VF4366000

Capacitate

VF4356000

2 CD-uri

1 CD

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

file din plastic

FILELE NU SE MPRTIE PE BIROU - sistem de


ambalare asemntor cutiilor de erveele ce
permite eliberarea filelor una cte una

ORGANIZARE I ARHIVARE

DISPENSER FILE
DE PROTECIE

02

NU OCUP SPAIU - poate fi aezat


oriunde: pe birou, ntr-un sertar,
deasupra imprimantei

PRACTIC - poate fi poziionat att


vertical ct i orizontal

Mereu la ndemn

File de protecie
n dispenser
Fabricate din polipropilen tip cristal. Sistem de ambalare din carton ce faciliteaz
folosirea filelor eficient, evitnd mprtierea acestora pe birou. Format: A4 portrait,
cu deschidere n partea superioar. 11 perforaii pentru ndosariere standard.
Cod
SL2042

Tip

Grosime

Unitate de vnzare

orange peel

46 microni

50 file/cutie

SL2049

cristal

55 microni

40 file/cutie

Oricare ar fi meseria ta, avem produsul potrivit.

111

file din plastic


File de protecie Cristal
File de protecie realizate din polipropilen tip cristal, utilizate pentru protejarea i
sistematizarea documentelor, fr a fi necesar perforarea acestora. Format: A4
portrait, cu deschidere n partea superioar, 11 perforaii pentru ndosariere
standard. Ambalare: cutie.
Cod
SL080932

02

Grosime

Unitate de vnzare

55 microni

100 buci/cutie

SL080930

75 microni

100 buci/cutie

SL080931

105 microni

100 buci/cutie

ORGANIZARE I ARHIVARE

cutia se transform n dispenser

File de protecie Cristal


File de protecie realizate din polipropilen tip cristal, utilizate pentru protejarea
i sistematizarea documentelor, fr a fi necesar perforarea acestora. Format: A4
portrait, cu deschidere n partea superioar, 11 perforaii pentru ndosariere
standard.
Cod
FA200101

Grosime

Unitate de vnzare

50 microni

100 buci/set

FA200102

60 microni

100 buci/set

FA200103

80 microni

100 buci/set

FA200104

120 microni

10 buci/set

File de protecie Cristal


File fabricate din polipropilen tip cristal, cu perforaii standard pentru ndosariere.
Format: A4 portrait, cu deschidere n partea superioar.
Cod
RP00222

Grosime

Unitate de vnzare

50 microni

100 buci/set

RP00221

75 microni

100 buci/set

File de protecie orange peel


Realizate din polipropilen tip orange peel. Prevzute cu 11 perforaii pentru
ndosariere standard, deschidere n partea superioar.
Cod
FA200111

Grosime

Unitate de vnzare

45 microni

100 buci/set

FA200112

60 microni

100 buci/set

File de protecie Standard


File fabricate din polipropilen tip orange peel, cu perforaii standard pentru
ndosariere. Format: A4 portrait, cu deschidere n partea superioar.
CALITATE
PRE

112

Cod
RP0020

Tip

Unitate de vnzare

standard

25 buci/set

RP00200

standard

100 buci/set

RP00201

Ecomax

100 buci/set

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

file din plastic

File de protecie cu dimensiuni speciale


File tip orange peel, cu deschidere n partea superioar. Protejarea documentelor cu
formate atipice nu mai este o problem.
Descriere
A5 portrait

Unitate de vnzare
100 buci/set

RP00401

A3 portrait

25 buci/set

RP00501

A3 landscape

25 buci/set

02
ORGANIZARE I ARHIVARE

Cod
RP0030

Mape transparente
Fabricate din polipropilen tip orange peel. Format: A4 portrait, cu deschidere n
partea de sus i lateral dreapta.
Cod
RP0011

Unitate de vnzare
100 buci/set

Coperi pentru ine


de prindere
Fabricate din PVC, rezistente la ndoituri repetate i la ntindere.
Capacitate: 100 coli A4.
Cod
DB291906

Culoare

DB291919

transparent

albastru

SUPER
CALITATE

ine de prindere
pentru documente
Sistem deosebit de practic pentru protejarea i pstrarea documentelor.
Nu este necesar perforarea hrtiei. Uor de folosit datorit colurilor rotunjite.
Lungime: 297 mm, pentru format A4.
Cod
DB290001

Culoare
negru

Capacitate*
30 coli

DB290003

rou

30 coli

DB290006

albastru

30 coli
30 coli

DB290019

transparent

DB290101

negru

60 coli

DB290103

rou

60 coli

DB290106

albastru

60 coli

DB290119

transparent

60 coli

SUPER
CALITATE

*capacitatea reprezint numrul maxim de coli, gramaj: 80 g/mp

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

113

cutii de arhivare
NOU: Asamblare rapid

Esselte Speedbox - economisete timpul!


Cu Esselte Speedbox economiseti timp i efort. Se asambleaz
uor i intuitiv, nefiind nevoie de instruciuni. n numai 5 secunde
cutia este gata asamblat. Este att de simplu!

02

RECYCLED
RECYCLABLE

Apas

ORGANIZARE I ARHIVARE

Cutii Speedbox pentru arhivarea documentelor

Asamblare n 5 secunde

Containere Speedbox pentru depozitare


i transport
 asamblare automat, rapid i fr efort, datorit sistemului
inteligent de pliere a pereilor
 baz i margini ranforsate pentru o rezisten maxim
 cu capac integrat
 ideale pentru transportul teancurilor mari de documente sau a
altor obiecte i accesorii necesare pentru edine sau prezentri
 fabricate din carton 100% reciclat
 produs 100% reciclabil, certificat FSC

 asamblare automat, rapid i fr efort, datorit sistemului inteligent de pliere a


pereilor
 capacul din carton dublu previne deschiderea cutiei i ntrete orificiile de prindere
 pentru documente A4 i foolscap i pentru dosare A4
 ideale pentru arhivarea pe etajere. Cutia poate fi poziionat vertical sau orizontal
 fabricate din carton 100% reciclat
 produs 100% reciclabil, certificat FSC
Cod
SL200303

Lime (mm)

Unitate de vnzare

80

25 buci/set

SL200304

100

25 buci/set

SL200305

150

25 buci/set

SL200306

80, orizontal

20 buci/set

Cod
SL200300

Caracteristici

Unitate de vnzare

medie, capacitate: 3 cutii x 100 mm sau 2 cutii x


150 mm, dimensiuni: 367 x 325 x 263 mm

15 buci/set

SL200301

mare, capacitate: 5 cutii x 80 mm sau 4 cutii x


100 mm, dimensiuni: 433 x 364 x 263 mm

15 buci/set

SL200302

pentru bibliorafturi, capacitate: 5 bibliorafturi x


75 mm, dimensiuni: 392 x 334 x 301 mm

15 buci/set

Gseti o gam
complet de bibliorafturi
la paginile 92-99!
Apas

114

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

cutii de arhivare
Cutie de arhivare Boxy
O modalitate simpl i eficient pentru arhivare. Cutiile de diferite dimensiuni
asigur arhivarea mai multor sute de documente, fr a fi necesar prinderea
acestora. Perforaie pe cotor pentru o extragere uoar.
Dimensiuni: 345 x 245 mm. Culoare: alb. Unitate de vnzare: 25 buci/set.
80

Lime (mm)

SL2007B

100

SL2008B

150

SL2009B

200

02
ORGANIZARE I ARHIVARE

Cod
SL2006B

SUPER
CALITATE

Cutiile Boxy sunt prevzute cu spaii largi destinate


inscripionrii arhivelor, pe 3 laterale.

Container de arhivare pentru bibliorafturi


Container de arhivare cu deschidere frontal. Poate asigura depozitarea a 6
bibliorafturi de 75 mm sau 9 bibliorafturi de 50 mm. Este dotat cu o ranforsare
special pentru a permite suprapunerea containerelor fr a mpiedica accesul la
bibliorafturi. Se pot suprapune pn la 3 astfel de containere. Containerul este
prevzut cu mnere ntrite pentru facilitarea transportrii.
Unitate de vnzare: 10 buci/set.
Cod
SL2025

Dimensiuni (mm)
525 x 338 x 306
SUPER
CALITATE

Container de arhivare
cu capac
Destinat depozitrii cutiilor de arhivare. Se pot suprapune 4 astfel de containere.
Containerul este prevzut cu mnere ntrite pentru facilitarea transportrii.
Unitate de vnzare: 10 buci/set.
Cod
SL2018B

Dimensiuni (mm)
560 x 275 x 370

Container de arhivare
cu deschidere frontal
Container de arhivare destinat depozitrii cutiilor de arhivare Boxy. Se pot
suprapune 3 astfel de containere. Este dotat cu o ranforsare special pentru a
permite suprapunerea containerelor fr a mpiedica accesul la cutiile de arhivare.
Unitate de vnzare: 10 buci/set.
Cod
SL20181B

Dimensiuni (mm)
510 x 275 x 365

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

115

cutii de arhivare
Cutii i containere Esselte Eco - create pentru protecia mediului!
Cutiile Esselte Eco reprezint o soluie eficient i economic pentru arhivarea documentelor pe termen mediu i lung,
contribuind totodat la protejarea mediului nconjurtor.
ideale pentru documente A4
fabricate din carton 100% reciclat i 100% reciclabil
n procesul de fabricaie s-a folosit hrtie natural, nealbit cu substane chimice
beneficiaz de un design atractiv, realizat cu cerneal ecologic, obinut pe baz de ap
RECYCLED
RECYCLABLE
produse certificate FSC

02
Cutie de arhivare Eco

ORGANIZARE I ARHIVARE

Pentru o arhivare pe termen mediu i lung, ecologic. Fabricate din carton 100%
reciclat i 100% reciclabil. Beneficiaz de un design atractiv, realizat cu cerneal
ecologic, obinut pe baz de ap. Certificate cu etichet FSC.
Dimeniuni: 327 x 233 mm. Culoare: natur. Unitate de vnzare: 25 buci/set.
Cod
SL080920B

80

Lime (mm)

SL080921B

100

n procesul de fabricaie s-a folosit hrtie natural,


nealbit cu substane chimice.

Container de arhivare Eco


pentru bibliorafturi
Deschidere frontal, capacitate 5 bibliorafturi cu cotor de 75 mm. Culoare: natur. Este
dotat cu o ranforsare special pentru a permite suprapunerea containerelor fr a
mpiedica accesul la bibliorafturi. Se pot suprapune pn la 3 astfel de containere.
Containerul este prevzut cu mnere ntrite pentru facilitarea transportrii.
Unitate de vnzare: 10 buci/set.
Cod
SL080924B

Dimensiuni (mm)
427 x 305 x 343

Container de arhivare Eco


cu capac
Destinat depozitrii cutiilor de arhivare Eco, capacitate 5 cutii de 80 mm sau 4 cutii
de 100 mm. Se pot suprapune 4 astfel de containere. Containerul este prevzut cu
mnere ntrite pentru facilitarea transportrii. Culoare: natur.
Unitate de vnzare: 10 buci/set.
Cod
SL080923B

Dimensiuni (mm)
439 x 345 x 242

Container de arhivare Eco


cu deschidere frontal
Destinat depozitrii cutiilor de arhivare Eco, deschidere frontal, capacitate 5 cutii de
80 mm sau 4 cutii de 100 mm. Se pot suprapune 3 astfel de containere. Este dotat cu
o ranforsare special pentru a permite suprapunerea containerelor fr a mpiedica
accesul la cutiile de arhivare. Culoare: natur.
Unitate de vnzare: 10 buci/set.
Cod
SL080925B

116

Dimensiuni (mm)
439 x 340 x 259

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

cutii de arhivare

SFATUL SPECIALISTULUI
O SOLUIE DE ARHIVARE ECONOMIC I EFICIENT
Cutiile pentru arhivare reprezint soluia ideal att pentru arhivarea documentelor importante, ct i a celor mai rar utilizate,
ntruct ofer eficiena dorit la un cost accesibil. Cu ajutorul acestora putei arhiva sute de documente fr a fi necesar prinderea
lor. Principalele tipuri de cutii utilizate pentru arhivarea documentelor sunt cele fabricate din carton ondulat de diferite dimensiuni.
Toate cutiile de arhivare ofer posibilitatea inscripionrii pe cotor, pentru o mai bun eviden a coninutului de documente.

02
Destinat clasrii documentelor. Fabricat din carton ondulat alb. Prevzut cu o
perforaie pe cotor pentru o extragere uoar. Culoare: alb.
Dimensiuni: 330 x 255 mm. Unitate de vnzare: 10 buci/set.
Cod
AB07128

80

AB07127

100

AB07126

160

CALITATE
PRE

Lime (mm)

ORGANIZARE I ARHIVARE

Cutie de arhivare

Cutie colectoare
Fabricat din carton ondulat natur. Capacitate: 4 cutii de arhivare, cu dimensiuni
maxime: 330 x 100 x 255 mm. Unitate de vnzare: 5 buci/set.
Cod
AB01

Dimensiuni (mm)
460 x 270 x 350

Containerele de arhivare sunt ideale pentru


depozitarea cutiilor de arhivare. Ele pot fi uor
suprapuse i stocate, permind o mai bun organizare
i implicit economie de spaiu.

Alonje de mare capacitate


Alonjele de arhivare sunt utile pentru legarea documentelor ce urmeaz a fi
transferate din bibliorafturi n cutii de arhivare. Culoare: incolor. Capacitate: 800 coli.
Mnerul de transfer se folosete pentru mutarea documentelor din biblioraft pe alonja
de arhivare, pstrnd astfel aceeai ordine a colilor. Culoare: mov. Capacitate: 800 coli.
Cod
SL080110

Produs

Unitate de vnzare

alonje de arhivare

50 buci/cutie

SL080111

mner de transfer

bucat

SUPER
CALITATE

Alonje pentru cutii de arhivare


Sistem rapid de arhivare, confecionate din plastic rezistent. Capacitate de
ndosariere: maxim 1000 coli. Culoare: negru.
Cod
FA0723

Unitate de vnzare
50 buci/set

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

117

dosare suspendabile
Dosar cu in i separatoare
Confecionat din carton reciclat kraft, 230 g/mp, ideal pentru separarea documentelor
din dosarele suspendabile. Documentele se pot sistematiza n fiecare din cele
3 compartimente prevzute cu in de prindere. Dosarul este prevzut i cu un
buzunar destinat pstrrii actelor cu o durat de arhivare mai mic sau anexelor
documentelor arhivate prin sistem de ndosariere. Format: A4.
Cod
FA09600

02
ORGANIZARE I ARHIVARE

Dosarul suspendabil cu separatoare este util de folosit atunci


cnd ai nevoie de o arhivare mai complex. Arhivarea se face
n compartimente individuale.

Dosar cu in
Realizate din carton reciclat kraft sau colorat n mas, de 230 g/mp. Baghet
metalic, etichet cu dimensiunea de 6 cm, care se translateaz uor de-a
lungul dosarului, in de prindere. Format: A4.
Cod
FA0972
FA0973
FA0975
FA0976
FA097

Culoare

Unitate de vnzare

rou
rou
albastru
albastru
galben

bucat
cutie (25 buci)
bucat
cutie (25 buci)
bucat

galben
verde
verde
kraft

cutie (25 buci)


bucat
cutie (25 buci)
bucat
cutie (25 buci)

kraft

Dosar plic
Realizate din carton reciclat kraft sau colorat n mas, de 230 g/mp. Baghet
metalic, etichet cu dimensiunea de 6 cm, care se translateaz uor de-a
lungul dosarului, in de prindere. Format: A4.
Cod
FA0962
FA0963
FA0964
FA0965
FA096

Culoare

Unitate de vnzare

rou
rou
albastru
albastru
verde

bucat
cutie (25 buci)
bucat
cutie (25 buci)
bucat

verde
galben
galben
kraft
kraft

cutie (25 buci)


bucat
cutie (25 buci)
bucat
cutie (25 buci)

Dosar color
Confecionat din carton reciclat colorat n mas, de 230 g/mp. Baghet metalic
i etichet cu dimensiunea de 6 cm, care se translateaz uor de-a lungul
dosarului. Format: A4.
Cod
FA0952
FA0953
FA0954
FA0955
FA0956

118

Culoare

Unitate de vnzare

rou
rou
albastru
albastru
verde

bucat
cutie (25 buci)
bucat
cutie (25 buci)
bucat

verde

cutie (25 buci)

galben

bucat

galben
maro
maro

cutie (25 buci)


bucat
cutie (25 buci)

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

dosare suspendabile

Dosar Basic
Confecionat din carton reciclat kraft, de 210 g/mp. Baghet metalic, etichet cu
dimensiunea de 6 cm, care se translateaz uor de-a lungul dosarului.
Format: A4.
Unitate de vnzare

FA095

bucat
cutie (50 buci)

Suport plastic
pentru etichete
Folosit la dosarele suspendabile, ca suport pentru eticheta de carton.
Cod
FA0981

Unitate de vnzare
50 buci/set

02
ORGANIZARE I ARHIVARE

Cod

Etichete din carton


Folosite n suportul de plastic pentru dosare suspendabile.
Dimensiuni: 60 x 20 mm. Culoare: alb.
Cod
FA099

Unitate de vnzare
100 buci/set

Suport pentru
dosare suspendabile
Suport metalic pentru dosare suspendabile, prevzut cu rotile pentru o
manevrare uoar. Culoare: gri. Dimensiuni: 592 x 655 x 368 mm.
Capacitate: 80 dosare suspendabile A4. Se livreaz fr dosare.
Cod
DB309510

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

119

clasificatoare metalice

protecie sertar anti-rsturnare

Clasificator metalic

ORGANIZARE I ARHIVARE

02

Sistem de organizare i arhivare a dosarelor suspendabile format A4. Ofer acces


rapid la documentele arhivate, ce pot fi uor identificate cu ajutorul etichetei de
pe fiecare dosar. Este realizat din metal. Sistem de nchidere central cu cheie blocheaz toate sertarele. Sertarele pot fi deschise fr efort deoarece sunt dotate cu
in pe roi. Dotat cu protecie anti-rsturnare la fiecare sertar.
Capacitate sertar: 65 dosare. Greutate: 58 kg. Culoare: gri.

GARANIE

SUPER
CALITATE

Cod
SL094912

Dimensiuni (L x A x H mm)

Numr sertare

414 x 630 x 1320

capacitate: 65 dosare/sertar

capacitate: 100 dosare/sertar

sistem*
anti-tilt

GARANIE

SUPER
CALITATE

Clasificator metalic dublu


Fabricat din tabl sudat, de grosime 0.7 mm. Capacitate de ncrcare
sertar: 100 dosare. Sistem de amortizare a zgomotului.
Vopsit n cmp electrostatic, cu vopsea rezistent la coroziune.
Rezisten crescut la uzur. Culoare: gri.
Cod
CH110010

840 x 620 x 1020

Dimensiuni (L x A x H mm)

Numr sertare
3

CH110011

840 x 620 x 1330

*nu permite deschiderea simultan a dou sau mai multor sertare

Clasificator metalic
Fabricat din tabl sudat, de grosime 0.7 mm. Capacitate de ncrcare pe sertar:
45-50 dosare suspendabile. Sistem de amortizare a zgomotului. Vopsit n cmp
electrostatic, cu vopsea rezistent la coroziune. Culoare: gri.
Cod
CH306

Dimensiuni (L x A x H mm)

Numr sertare

463 x 620 x 1022

CH305

463 x 620 x 1328

GARANIE

sistem anti-tilt*
SUPER
CALITATE

*nu permite deschiderea simultan a dou sau mai multor sertare

120

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

dosare din carton


Dosare plic Lux
Fabricate din carton reciclat Manilla de cea mai bun calitate, de 320 g/mp.
Liniatur de organizare pe coperta fa. Format: A4.
Cod

Unitate de vnzare

FA0940x

bucat
cutie (25 buci)

SUPER
CALITATE

x-culoare: 2- rou, 3- albastru, 4- verde, 5- galben, 6- portocaliu

02

Fabricate din carton reciclat Manilla de cea mai bun calitate, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor. Format: A4.
Cod

Unitate de vnzare

FA0950x

bucat
cutie (100 buci)

SUPER
CALITATE

x-culoare: 3- rou, 2- albastru, 4- verde, 5- galben, 6- portocaliu

Dosare de ncopciat 1/1 Lux

ORGANIZARE I ARHIVARE

Dosare cu in Lux

Utile pentru arhivarea n bibliorafturi, liniatur de organizare pe coperta fa.


Fabricate din carton reciclat Manilla, de 250 g/mp. Format: A4.
Cod

Unitate de vnzare

FA090x

bucat
cutie (50 buci)

SUPER
CALITATE

x-culoare: 2- rou, 3- albastru, 4- verde, 5- galben, 6- portocaliu

Dosare de ncopciat 1/2 Lux


Utile pentru arhivarea n bibliorafturi, liniatur de organizare pe coperta fa.
Fabricate din carton reciclat Manilla, de 250 g/mp. Format: A4.
Cod

Unitate de vnzare

FA091x

bucat
cutie (50 buci)

SUPER
CALITATE

x-culoare: 2- rou, 3- albastru, 4- verde, 5- galben, 6- portocaliu

Dosare cu guri 1/1 Lux


Utile pentru arhivarea n bibliorafturi. Fabricate din carton reciclat Manilla, de
250 g/mp. Format: A4.
Cod

Unitate de vnzare

FA092x

bucat
cutie (50 buci)

SUPER
CALITATE

x-culoare: 2- rou, 3- albastru, 4- verde, 5- galben, 6- portocaliu

Dosare cu guri 1/2 Lux


Utile pentru arhivarea n bibliorafturi. Fabricate din carton reciclat Manilla, de
250 g/mp. Format: A4.
Cod

Unitate de vnzare

FA093x

bucat
cutie (50 buci)

SUPER
CALITATE

x-culoare: 2- rou, 3- albastru, 4- verde, 5- galben, 6- portocaliu

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

121

dosare din carton


Dosare 1/1 cu guri
Fabricate din carton colorat n mas, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.

CALITATE
PRE

Cod
DS43xS

10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

02
ORGANIZARE I ARHIVARE

Unitate de vnzare

Dosare 1/2 cu guri


Fabricate din carton colorat n mas, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.

CALITATE
PRE

Cod
DS42xS

Unitate de vnzare
10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

Dosare 1/1 de ncopciat


Fabricate din carton colorat n mas, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.

CALITATE
PRE

Cod
DS41xS

Unitate de vnzare

DS41xC

100 buci/set

10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

Dosare 1/2 de ncopciat


Fabricate din carton colorat n mas, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.

CALITATE
PRE

Cod
DS40xS

Unitate de vnzare

DS40xC

100 buci/set

10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

Dosare cu in
Fabricate din carton colorat n mas, de 250 g/mp.
Alonj metalic pentru ndosarierea documentelor.

CALITATE
PRE

Cod
DS10xS

Unitate de vnzare

DS10xC

100 buci/set

10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

Dosare plic
Fabricate din carton colorat n mas, de 250 g/mp.
Clape interioare pentru stabilitatea documentelor.

CALITATE
PRE

Cod
DS20xS

Unitate de vnzare
10 buci/set

x-culoare: 3- albastru, 4- vernil, 5- galben, 6- rou

122

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

dosare din carton


Toate dosarele de carton au liniatur dubl, lucru care permite scrierea informaiilor att pe vertical, ct i pe orizontal, n
vederea asigurrii citirii acestora att cnd dosarul este aezat pe birou, ct i cnd acesta este aezat n suport pentru documente.

Dosare 1/1 de ncopciat


Fabricate din carton duplex standard, alb.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.
Unitate de vnzare

DL70031

50 buci/set

DL3041R

100 buci/set

10 buci/set

Dosare 1/2 de ncopciat


Fabricate din carton duplex standard, alb.
Alonj metalic pentru ndosarierea documentelor.
Utile pentru arhivarea n bibliorafturi.
Cod
DL304M

Unitate de vnzare

DL70030

50 buci/set

DL304R

100 buci/set

10 buci/set

02
ORGANIZARE I ARHIVARE

Cod
DL3041M

Dosare cu in
Fabricate din carton duplex standard, alb.
Alonj metalic pentru ndosarierea documentelor.
Cod
DL301M

Unitate de vnzare

DL301N

50 buci/set

DL301R

100 buci/set

10 buci/set

Dosare plic
Fabricate din carton duplex standard, alb.
Clape interioare pentru stabilitatea documentelor.
Cod
DL302M

10 buci/set

Unitate de vnzare

DL302N

50 buci/set

DL302R

100 buci/set

Dosare simple
Fabricate din carton duplex standard, alb.

Cod
DL303M

10 buci/set

Unitate de vnzare

DL303N

50 buci/set

DL303R

100 buci/set

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

123

dosare din plastic


Dosare cu multiperforaii
Dosare format A4, cu in i perforaii multiple, ce permit arhivarea n orice tip de
biblioraft sau caiet mecanic. Sunt prevzute cu buzunar pentru etichet i sistem de
ndosariere metalic. Material: polipropilen. Capacitate: 160 coli, 80 g/mp.
Unitate de vnzare: 10 buci/set.

ORGANIZARE I ARHIVARE

02

Cod
SL000129

albastru

Culoare

SL000130

negru

SL000131

alb

SL000132

galben

SL000133

rou

SL000134

verde

margine ranforsat,
11 perforaii

in din metal rezistent

copert cristal

Dosare cu burduf
Dosar din plastic cu in i dou perforaii realizat din polipropilen rezistent.
Extra capacitate datorit burdufului i a inei metalice mai lungi: pn la 200 file.
Buzunar interior pe coperta 3. Unitate de vnzare: 25 buci/set.
Cod
DY200101

Culoare

DY200102

rou

DY200103

negru

albastru

extra capacitate
burduf ce permite
ndosarierea
a pn la 200 file

CALITATE
PRE

Dosare cu in i perforaii
Fabricate din polipropilen, format: A4. Copert fa transparent, copert spate
color mat. Etichet interschimbabil pe cotor. Perforaii pentru arhivare.
Cod
LM0x

Unitate de vnzare
set (25 buci)

x-culoare: 10- rou,11- albastru, 12- verde, 13- negru, 14- gri, 16- galben,
18- bleumarin, 19- portocaliu, 21- alb, 22- vernil, 23- roz, 24- lila

124

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

dosare din plastic


Dosar de prezentare Duraclip
Dosarul ideal pentru un birou modern: practic, uor de folosit, cu durat mare
de utilizare. Excelent pentru prezentare de oferte, documente sau rapoarte
pentru conferine i seminarii. Fabricat din folie PVC. Coperta fa transparent,
coperta spate disponibil n mai multe culori. Clem din oel special.
Documentele nu necesit perforare.
Cod

Capacitate

DB22000x

30 coli

DB22090x

60 coli

02

TIAI C?
n 1959 Durable a inventat
dosarul patentat cu clip,
DURACLIP, soluia pentru
arhivarea documentelor fr a fi
nevoie s fie perforate.

SUPER
CALITATE

deplaseaz clema n
lateral

introdu colile n dosar,


fr a le perfora

finalizeaz arhivarea prin


repoziionarea clemei

ORGANIZARE I ARHIVARE

x-culoare: 1- negru, 6- albastru, 7- albastru nchis

Clemele sunt special confecionate pentru a asigura o utilizare


repetat i ndelungat.

Dosar de prezentare Swingclip


Noul tip de dosar cu clem se adreseaz tinerei generaii, oamenilor creativi
- designeri, arhiteci. Aspect atractiv al clemei. Fabricat din polipropilen
semitransparent. Capacitate: maxim 30 coli.
Cod
DB226001
DB226003
DB226005
DB226007

Culoare
negru
rou
verde
albastru

soluie ideal pentru arhivarea documentelor fr


perforare, cu ajutorul clipului din plastic

SUPER
CALITATE

Dosar cu clip Duraquick


Coperta fa transparent, coperta spate disponibil n mai multe culori. Clema
rezistent permite ndosarierea a pn la 20 de coli, fr a fi nevoie de perforarea
acestora.
Cod
DB227001
DB227003
DB227007

Culoare
negru
rou
albastru nchis

Oricare ar fi meseria ta, avem produsul potrivit.

125

serviete i mape
Serviet VIVIDA cu separatoare
Fabricat din plastic, calitate deosebit, design VIVIDA. Ideal pentru organizarea
proiectelor, conine 12 compartimente extensibile prevzute cu index care te ajut
s identifici uor coninutul. Prevzut cu mner din plastic i sistem de nchidere
cu clem, pentru a facilita transportul n siguran al documentelor. Format: A4.
Capacitate: 350 coli. Dimensiuni: 291 x 420 x 388 mm.
Cod
SL080903
SL080904

02

Culoare
albastru
negru

ORGANIZARE I ARHIVARE

Pentru gama de
accesorii VIVIDA
consult pagina
155!

Map din plastic cu elastic

Map cu caps

Fabricat din polipropilen, prevzut cu elastic pe coluri. Util pentru


transportarea documentelor. Format: A4.

Fabricat din polipropilen, transparent, diverse culori, nchidere cu caps.


Format: A4.

Cod
DY200201
DY200202
DY200203

Culoare
albastru
negru
rou

Cod
DY001201
DY001203
DY001204

Culoare
transparent
rou
albastru

Map Economy
cu elastic
Map din carton colorat n mas, cu elastic, util pentru transportul
documentelor. Face posibil arhivarea fr perforare. Capacitate: 150 coli.
Format A4.

126

Cod
SL000177
SL0001771
SL000178

Culoare
albastru deschis
albastru
negru

SL000179
SL000180
SL0001801

rou
verde
galben

Map cu elastic
Fabricat din carton plastifiat n exterior. 3 clape interioare pentru protecia
documentelor. Grosime carton: 350 g/mp. Dimensiuni: 260 x 336 mm.
Cod
BZ1001

Culoare

BZ1003

albastru

rou

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

mape din carton


Att coperile din carton plastifiat, ct i filele interioare, au o rezisten sporit la
rupere. Aceste mape asigur pstrarea n condiii optime a documentelor tale.

Map cu index
pentru semnturi
Map din carton, exterior negru, interior gri nchis. Ideal pentru sistematizarea
documentelor n vederea clasrii sau semnrii. Index din plastic.
Dimensiuni: 262 x 342 mm.
Cod
FA000250

Index

FA000251

1-31

02
SUPER
CALITATE

ORGANIZARE I ARHIVARE

A-Z

Map cu separatoare
pentru semnturi
Map cu separatoare, fabricat din carton. Util pentru pstrarea n condiii
excelente a documentelor oficiale n vederea clasrii sau semnrii.
Format: A4, 20 separatoare. Dimensiuni: 240 x 28 x 340 mm.
Cod
SL40611

Culoare

SL40612

albastru

copert laminat cu polipropilen

negru

suport pentru etichet

Map pentru coresponden


Ajut la pstrarea ordonat i n condiii bune a corespondenei. Coperi din
carton rigid, file interioare rezistente, index de la 1-12. nchidere cu elastic.
Format: A4. Numr separatoare: 12.
Cod
FA100111

Culoare

FA100112

rou

FA100113

verde

FA100114

galben

albastru

SUPER
CALITATE

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

127

clipboarduri

Clipboard simplu
Clipboarduri solide, cu un clip rezistent ce ine documentele fixe. Ambele au coluri
rotunjite pentru a evita accidentele. Sunt concepute pentru hrtie format A4.
Clipboardul transparent este fabricat din PVC, iar cel metalic este realizat din
aluminiu.

plastic

Cod
AL013780

Material

AL013782

aluminiu

plastic transparent

aluminiu

ORGANIZARE I ARHIVARE

02

Clipboard Jumbo Maxi


Din carton plastifiat, format: A4. Destinat utilizrii la birou sau n depozit deoarece
asigur o suprafa dur de scris, putnd fi agat de perete. Dispune de o clem de
prindere de mari dimensiuni i deosebit de rezistent.
Capacitate: 300 coli.
Cod
SL27353

Culoare

SL27355

albastru

rou

garantat fr bule de aer

Clipboard dublu
Din carton plastifiat, format: A4. Partea interioar este prevzut cu un buzunar
pentru documente de dimensiuni atipice. Dispune de o clem de prindere i de
suport pentru instrumente de scris. Capacitate: 200 coli.
Cod
SL56043

Culoare

SL56045

albastru

SL56047

negru

rou

garantat fr bule de aer

Clipboard simplu
Clipboard din carton plastifiat, format: A4. Destinat utilizrii la birou, coal sau
acas. Prevzut cu o clem de dimensiuni reduse. Capacitate: 200 coli.

garantat fr bule de aer

128

Cod
SL000080

Culoare

SL000081

albastru

SL000082

negru

rou

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

clasoare pentru cri de vizit

02
ORGANIZARE I ARHIVARE

Suporturile rotative Flip de la Durable combin un design de excepie


cu materiale de nalt calitate, pentru a asigura o eficien maxim.
Forma curbat unic le confer elegan i stabilitate. Mnerele rotative
ergonomice asigur o utilizare simpl i fr efort, prin rotirea uoar i
prin posibilitatea de blocare.

Visifix Flip Duo


Suport rotativ cu index pentru cri de vizit. Prevzut cu 300 de buzunare
pentru 600 cri de vizit format 104 x 72 mm, 25 de separatoare de la A la Z
din polipropilen. Include 40 cartonae tiprite pe ambele fee pentru notarea
datelor de contact. Dimensiuni: 330 x 120 x 185 mm.
Cod
DB244301

negru

Culoare

DB244323

argintiu

Seturi de completare:
Cod: DB241819, 40 buzunare/set.
Cod: DB241902, 100 cartoane/set.

Suportul poate fi extins prin adugarea


de seturi de completare.

SUPER
CALITATE

Visifix Flip
Sistem rapid de detaare i reintroducere a buzunarelor. Crile de vizit se
introduc prin deschiderea lateral a buzunarelor. Capacitate: 200 de buzunare
pentru 400 de cri de vizit format 104 x 72 mm. 25 de separatoare de la A la Z,
din polipropilen.
Dimensiuni: 215 x 120 x 185 mm.
Cod
DB241701

negru

Culoare

DB241723

argintiu

SUPER
CALITATE

Set de completare:
Cod: DB241819, 40 buzunare/set.

Suportul poate fi extins prin adugarea


de seturi de completare.

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

129

clasoare pentru cri de vizit

povestea unei mrci


Fondat n 1920 de Karl Hunke i Wilhelm Jochheim, compania Durable se remarc prin dezvoltarea
produselor de organizare arhivare i a sistemelor de prezentare care ofer utilizatorilor soluii inovatoare
prin folosirea produselor performante i de un nalt nivel calitativ. Cu un portofoliu vast de premii ce a
debutat cu cel pentru patentul
Duraclip (primul sistem de ndosariere fr perforarea documentelor), compania Durable s-a adaptat
permanent la nevoile contemporane ale utilizatorilor.

02
ORGANIZARE I ARHIVARE

Sistemul Sherpa i Vario sunt doar dou exemple de articole inovatoare premiate cu titlul de Produsul
Anului de ctre Asociaia Internaional de Papetrie. Brandul Durable este cunoscut pe plan mondial
att pentru succesul nregistrat n aproape un secol de activitate, ct i pentru implicarea n campanii
umanitare i de protejare a mediului.

Visifix Desk
Sistem rapid de detaare i reintroducere a buzunarelor. Index de la A la Z din
polipropilen, 100 buzunare pentru cri de vizit. Dimensiuni: 245 x 131 x 67 mm.
Cod
DB241301

negru

Culoare

DB241323

argintiu

Set de completare:
Cod: DB241819, 40 buzunare/set.

Suportul poate fi extins prin adugarea


de seturi de completare.

Visifix 2388
Clasor cri de vizit cu coperi din PVC. Index de la A la Z din polipropilen.
Format: A4. Mecanism cu 4 inele, 20 de file transparente pentru 400 cri de
vizit. Format 57 x 90 mm. Dimensiuni: 255 x 315 mm.
Cod
DB238807

albastru

Culoare

DB238858

antracit

Set de completare:
Cod: DB238919, 10 file transparente pentru 200 cri de vizit, perforaii
universale pentru arhivare n bibliorafturi.

SUPER
CALITATE

130

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

clasoare pentru cri de vizit

Visifix 2385
Clasor cri de vizit cu coperi din PVC, index alfabetic negru, din polipropilen.
Mecanism cu 4 inele, 25 file transparente pentru 200 cri de vizit, de format
57 x 90 mm. Dimensiuni: 255 x 145 mm.
Cod
DB238507

albastru

Culoare

DB238558

antracit

02

SUPER
CALITATE

ORGANIZARE I ARHIVARE

Seturi de completare:
Cod: DB244910, 10 file/set, pentru 60 poziii.
Cod: DB238719, 10 file/set, pentru 80 poziii.

Clasor pentru cri de vizit


Clasor realizat din polipropilen flexibil, 100% reciclabil. Capacitate: 160 cri de
vizit. Dimensiuni: 275 x 120 mm. Diverse culori.
Cod
AL12114
AL12115

Culoare
negru
rou

SUPER
CALITATE

Clasor pentru cri de vizit


Coperi din PVC, mecanism cu 4 inele, 12 file pentru 96 de cri de vizit.
Culoare: negru.
Cod
FL00037
Set de completare:
Cod: FL000371, 10 file/set pentru 80 cri de vizit.

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

131

clasoare pentru cri de vizit

TIAI C?

Crile de vizit, les Biletes Visite, erau de dimensiunea unui pachet de cri de joc, doar puin
mai mici dect dimensiunea palmei unui brbat. Cele mai vechi forme de cri de vizit au fost,
ntr-adevr, cri de joc. Cei care efectuau o vizit i puneau semntura pe aceste cri, scriau bilete
la ordin i alte mesaje. Primele cri de vizit au aprut n Frana, n timpul domniei lui Ludovic
al XIV-lea, Regele Soare. Prin aceste cri de vizit, trimise nainte, prin intermediul servitorilor,
proprietarii crilor de vizit (aristocraii) i anunau cu solemnitate vizita.

ORGANIZARE I ARHIVARE

02

Clasor pentru cri de vizit


Coperi din PVC. Capacitate: 80 cri de vizit, format: 57 x 90 cm. Culoare: negru.
Cod
FL3001

Suport pentru cri de vizit


Fabricat din plastic transparent.
Capacitate maxim: 50 cri de vizit.
Cod
DB241419

Port cri de vizit


Fabricat din aluminiu.
Dimensiuni: 95 x 60 x 6 mm.
Culoare: argintiu.
Cod
OL150380100

132

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

3. Accesorii pentru birou


capsatoare i perforatoare

135

dispensere pentru benzi adezive

160

capsatoare

143

benzi adezive

161

capsatoare i tackere

147

adezivi

167

perforatoare

148

foarfeci

170

capse

151

cuttere

171

seturi pentru birou

152

accesorii prindere

172

tvie pentru documente

157

hrtie autocopiativ, tu i tuiere

174

suporturi pentru accesorii

158

tampile i tu

175

ACCESORII PENTRU BIROU

03

Tipuri
de capsare
capsare
nchis

capsare
bypass

Capsare bypass
Avantaj suplimentar al sistemului de Bypass:
capetele capselor nu se suprapun la nchidere, fiind
poziionate lateral. Pentru cantiti mici de hrtie se pot
folosi capse lungi.

Capsare nchis
Capsare clasic, permanent, pentru a pstra
documentele bine organizate.

capsare
deschis

capsare
plat

Capsare plat

Capsare deschis

Capsarea plat garanteaz 30% mai mult spaiu n


biblioraft, optimiznd astfel capacitatea acestuia.

Ideal pentru a pstra documentele ataate perioade


scurte de timp. Pot fi ndeprtate rapid i uor.

capsare
tip cui

134

Capsare automat

Capsare tip cui

Doar cu o strngere uoar a mnerului, se efectueaz o


capsare perfect a hrtiei.

Notie adezive sau fotografii se pot fixa pe o tabl de


plut - uor, rapid i sigur.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

capsatoare i perforatoare
Colecia NOVUS Evolution o schimbare cu adevrat impresionant. &DSVDWRDUHOHLSHUIRUDWRDUHOHGLQFROHFLD12986(YROXWLRQDGXFR
QRWGHVWLOHFUXLELURX$VSHFWXOORUH[WUDRUGLQDUHVWHUH]XOWDWXOFRPELQULLDUPRQLRDVHDGRXFXORULH[SUHVLYHFXMRFXOLPSUHVLRQDQWGLQWUH
VXSUDIHHOHVWUOXFLWRDUHLFHOHPDWH$WWRSWLFFWLWHKQLFQRXDFROHFLH(YROXWLRQQVHDPQRGH]YROWDUHPDLPXOWGHFWUHXLWGHFDSVDWRUXO
LQWHJUDWQFDSVDWRUDVLJXUXWLOL]DUHDIRDUWHFRQIRUWDELOGLVWDQLHUXOSHUIRUDWRDUHORUJDUDQWHD]SHUIRUDUHDH[DFWDFROLORUGHGLYHUVHIRUPDWH

Capsator Evolution E25


&DSVDWRUXWLOQRULFHWLSGHELURX)DEULFDWGLQPHWDOFDUFDVFXGRXFRPSRQHQWH
din plastic. Baz antialunecare i decapsator din plastic inclus. Prevzut cu
QLFRYDOPRELOSHUPLQGDVWIHODWWFDSVDUHDQFKLVGHVFKLVGDULWLSFXL
ncrcarea capselor se efectueaz pe partea superioar.
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Culoare
negru
rou
albastru

decapsator inclus

10
GARANIE

25

100 x 24/6,
150 x 26/6

capsare
tip cui

capsare
deschis

10

25

capsare
nchis

Perforator Evolution E225


3HUIRUDWRUGHPDUHFDSDFLWDWHGXUDELO)DEULFDWGLQPHWDOFODSDFRSHULWFX
SODVWLFUH]LVWHQW%D]DQWLDOXQHFDUHFHVHSRDWHGHVFKLGHSQODMXPWDWH
SHQWUXJROLUHDGHFRQIHWWLLDSRLQFKLVODORF*KLGGHSHUIRUDUHDKUWLHLFX
LQGLFDWRUDOGLPHQVLXQLORUKUWLHL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV022500
NV022501
NV022502

Culoare
negru
rou
albastru

ACCESORII PENTRU BIROU

Cod
NV002500
NV002501
NV002502

03

GARANIE

Capsator Evolution E15


De dimensiune mic, prevzut cu mecanism din metal i carcas din plastic.
ncrcarea capselor se efectueaz pe partea superioar.
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHQU
LQFOXGHFDSVHQU
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP

poate fi folosit pentru capsare vertical

Cod
NV400040
NV400041
NV400042

Culoare
negru
rou
albastru

decapsator inclus

10
GARANIE

15

100 x nr.10

capsare
tip cui

10

capsare
nchis

Perforator Evolution E210


Baz din metal i clap din plastic transparent. Baz antiderapant.
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV400060
NV400061
NV400062

Culoare
negru
rou
albastru

GARANIE

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

135

capsatoare i perforatoare

povestea unei mrci


/HLW]OLGHUXOPRQGLDOQSURGXVHSUHPLXPSHQWUX
ELURXLLQYHQWDWRUXOELEOLRUDXOXLLDOSHUIRUDWRUXOXL
DUHQVSDWHRWUDGLLHQGHOXQJDWQSHUIRUPDQL
FDOLWDWHJHUPDQ5HQXPLWQLQGXVWULHFDRPDUF
FHGH]YROWLLQRYHD]FRQWLQXX/HLW]FRQGXFH

WUDQ]LLDVSUHYLLWRUXOPXQFLLODELURXLVSUHPXQFDPRELO
7HKQRORJLLOHHYROXHD]GDUSULQFLSLXOUPQHDFHODL
RULFHVDUFLQPHULWVHUHDOL]DWELQH
/HLW]-RE:HOO'RQH

03
Capsator 5502

Cod
SL801000
SL801001
SL801003
SL801002
SL801005
SL801006
SL801007
SL801008
SL801009
SL801010
SL801011

Culoare
gri
negru
rou
albastru
alb perlat
albastru metalizat
portocaliu metalizat
verde metalizat
roz metalizat
turcoaz metalizat
mov metalizat

10
GARANIE

SUPER
CALITATE

30

100 x 24/6,
140 x 26/6

capsare
tip cui
nchis

capsare
deschis

ACCESORII PENTRU BIROU

&DSVDWRUGLQPHWDOSHQWUXX]]LOQLF3XWHUQLFLODQGHPQ5HDOL]DWGLQ
PHWDOFXVLVWHPQRQDOXQHFDUHSHED]SHQWUXDSUHYHQLDOXQHFDUHDVDX
]JULHUHDELURXOXL1LFRYDODURWDWLYSHUPLWHFDSVDUHQFKLVLGHVFKLVL
GHVFKLGHUHrFHSHUPLWHFDSVDUHDWLSFXL
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP

capsare
nchis
tip cui

gama
WOW Colors
decapsator inclus

deschidere 1800

Perforator 5008
3HUIRUDWRUGLQPHWDOSHQWUXX]]LOQLF3XWHUQLFLODQGHPQ5HDOL]DWGLQPHWDO
FXED]GXEODWFXSODVWLFDGHUHQWSHQWUXDSUHYHQL]JULHUHDPRELOLHUXOXL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
SL802000
SL802001
SL802003
SL802002
SL802005
SL802006
SL802007
SL802008
SL802009
SL802010
SL802011

Culoare
gri
negru
rou
albastru
alb perlat
albastru metalizat
portocaliu metalizat
verde metalizat
roz metalizat
turcoaz metalizat
mov metalizat

10
GARANIE

SUPER
CALITATE

30

prevzut cu distanier gradat

Oricare ar fi meseria ta, avem produsul potrivit.

137

capsatoare i perforatoare
Capsator 5501
6SHFLDOFUHDWSHQWUXXWLOL]DUHDQELURXULDFDVVDXQFOWRULL5HDOL]DWGLQ
PHWDOFXFDUFDVGHSODVWLFED]GXEODWFXSODVWLFDGHUHQWFHSUHYLQH]JULHUHD
ELURXOXL1LFRYDODURWDWLYSHUPLWHFDSVDUHQFKLVLGHVFKLVLGHVFKLGHUHr
ce permite capsarea tip cui.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP

ACCESORII PENTRU BIROU

03

Cod
SL801301
SL801303
SL801302
deschidere 1800

capsare
tip cui

Culoare
negru
rou
albastru

GARANIE

capsare
nchis

capsare
deschis

25

80 x 24/6,
110 x 26/6

decapsator inclus

Perforator 5005
3XWHUQLFLVLJXUQXWLOL]DUHHVWHUHFRPDQGDWSHQWUXPXQFD]LOQLFODELURX
%D]GLQPHWDOGXEODWFXSODVWLFDGHUHQWFHSUHYLQH]JULHUHDELURXOXL
Clapa este realizat din plastic ranforsat cu metal.
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
SL802301
SL802303
SL802302

Culoare
negru
rou
albastru

10

25

GARANIE

Capsator 5504
&DSVDWRUGLQPHWDODELOLUREXVW(VWHLGHDOSHQWUXGRFXPHQWHGHGLPHQVLXQLPDUL
5HDOL]DWGLQPHWDOFXVLVWHPQRQDOXQHFDUHSHED]SHQWUXDSUHYHQLDOXQHFDUHDVDX
]JULHUHDELURXOXL3UHY]XWFXPDJD]LHGHFDSVHGHGLPHQVLXQLPDUL1LFRYDODURWDWLY
SHUPLWHFDSVDUHQFKLVLGHVFKLVLGHVFKLGHUHrFHSHUPLWHFDSVDUHDWLSFXL
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[LVDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
SL801200
SL801201
SL801203
SL801202

Culoare
gri
negru
rou
albastru

capsare
tip cui

10
GARANIE

deschidere 1800

capsare
deschis

capsare
nchis

40

150 x 24/6,
24/8
210 x 26/6

decapsator inclus

Perforator 5138
Perforator rezistent, realizat din metal, recomandat
pentru perforarea documentelor voluminoase. 5HDOL]DW
GLQPHWDOFXED]GXEODWFXSODVWLFDGHUHQWSHQWUXD
SUHYHQL]JULHUHDPRELOLHUXOXL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
VLVWHPGHEORFDUHDFODSHL
Cod
SL802200
SL802201
SL802203
SL802202

mecanism de blocare pentru


o depozitare mai uoar

138

Culoare
gri
negru
rou
albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

40

10
GARANIE

capsatoare i perforatoare

SFATUL SPECIALISTULUI
ALEGEREA CAPSATORULUI I A PERFORATORULUI

Capsator B4
8QFDSVDWRUFRQVDFUDWSHQWUXXWLOL]DUH]LOQLF)DEULFDWGLQPHWDOFXRFDUFDV
GLQSODVWLFGHRFDOLWDWHGHRVHELW6LVWHPGXEOXGHJKLGDMDOFDSVHORU3UHY]XW
FXQLFRYDOPRELOSHUPLQGDVWIHODWWFDSVDUHDQFKLVGHVFKLVGDULWLS
cui. ncrcarea capselor se efectueaz pe partea frontal.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[

VDX[
100 x 24/6, 24/8
DGQFLPHGHSWUXQGHUHQSDJLQPP
40
GARANIE
150 x 26/6

25

Cod
NV1245
NV1242

Culoare
negru
albastru

capsare
tip cui

capsare
deschis

capsare
nchis

03
ACCESORII PENTRU BIROU

&DSDFLWDWHDGHFDSVDUHVDXSHUIRUDUHLQGLFDWGHSURGXFWRUHVWHFHDPD[LP3HQWUXD
SUHOXQJLGXUDWDGHYLDDFDSVDWRDUHORULSHUIRUDWRDUHORUYUHFRPDQGPVDOHJHL
SURGXVHFXFDSDFLWDWHPD[LPPDLPDUHGHFWFHDGHFDUHDYHLQHYRLHQPRGX]XDO
3HQWUXUH]XOWDWHRSWLPHIRORVLLDFHHDLPDUFGHFDSVHLFDSVDWRU3HQWUXRLPDJLQH
XQLWDUUHFRPDQGPDFKL]LLRQDUHDVHWXULORUGHFDSVDWRULSHUIRUDWRU

siguran n utilizare

Perforator B225
%D]GLQPHWDOFODSGLQPHWDODFRSHULWFXSODVWLFGHRIRDUWHEXQFDOLWDWH
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
VLVWHPGHEORFDUHDFODSHL
GARANIE

10

Cod
NV32255
NV32252

Culoare
negru
albastru

25

Capsator C1
&DSVDWRUXO1RYXV&HVWHUHFRPDQGDWXWLOL]ULLPDLSXLQLQWHQVH&XXQDVSHFW
SOFXWLGHVLJQHUJRQRPLFHVWHSUHY]XWFXQLFRYDOPRELOSHUPLQGDVWIHO
DWWFDSVDUHDQFKLVGHVFKLVGDULWLSFXLQFUFDUHDFDSVHORUVHHIHFWXHD]
pe partea superioar.
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[VDX[
100 x 24/6,
DGQFLPHGHSWUXQGHUHQSDJLQPP
15
GARANIE
150 x 26/6

Cod
NV1025
NV1022

Culoare
negru
albastru

capsare
tip cui

capsare
deschis

capsare
nchis

Perforator C216
%D]GLQPHWDOGXEODWFXSODVWLFDGHUHQWFHSUHYLQH]JULHUHDELURXOXL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV321605
NV321601

Culoare
negru
albastru

16

GARANIE

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

139

capsatoare i perforatoare

povestea unei mrci


QFGHODQLQDUH1RYXVLDSURSXVVWUDQVIRUPHSLDDFDSVDWRDUHORULSHUIRUDWRDUHORU
SULQLQRYDLHFDOLWDWHLGHVLJQGHH[FHSLH
$FXPGXSPDLELQHGHGHDQL1RYXVUPQHOLGHUGHSLDLXQH[HPSOXSHUIHFWGH
SUHFL]LHLWHKQLFJHUPDQ

ACCESORII PENTRU BIROU

03

Capsator B10 FC
&DSVDWRUGHGLPHQVLXQLUHGXVHIDEULFDWGLQPHWDOLDFRSHULWFXSODVWLF3ULQ
FDSVDUHDGHWLS)ODW&OLQFKDFHVWDDVLJXURHFRQRPLVLUHDVSDLXOXLGHVWRFDUHFX
SQODQFUFDUHDFDSVHORUVHHIHFWXHD]SHSDUWHDVXSHULRDU
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHQU
LQFOXGHFDSVH
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP
decapsator
inclus

Cod
NV340001
NV340005
NV340002
decapsator inclus

Culoare
gri
negru
albastru

10
GARANIE

capsare
plat

capsare
tip cui

20

100 x nr.10

16

deschidere 180

Perforator B216
3HUIRUDWRUGHGLPHQVLXQLUHGXVHFXED]GLQPHWDOL
FODSGLQSODVWLFGHRFDOLWDWHGHRVHELW
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV350001
NV350005
NV350002

Culoare
gri
negru
albastru

GARANIE

cu mecanism metalic

Capsator Stabil
)DEULFDWGLQPHWDO
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV16030
NV16035
NV16031
NV16036

Culoare
gri
negru
albastru
rou

GARANIE

30

100 x 24/6,
150 x 26/6

Perforator Master
%D]GLQPHWDOFODSGLQPHWDODFRSHULWFXSODVWLFGHRIRDUWHEXQFDOLWDWH
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
VLVWHPGHEORFDUHDFODSHL
Cod
NV33000
NV33005
NV33001
NV33006

sistem de blocare
a clapei

140

Culoare
gri
negru
albastru
rou

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

GARANIE

25

CALITATE
PRE

capsatoare i perforatoare

Capsator M25

Perforator P30

&DSVDWRUPHWDOLFGHVLJQHUJRQRPLF
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHVDX
PDJD]LQDMFDSVH

Perforator din plastic, cu mecanism metalic.


FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU

Culoare

25

negru

100 x 24/6,
100 x 26/6

Cod
BV014321

Culoare

Capsator P25

Capsator M20

&DSVDWRUGLQSODVWLFFXGHVLJQHUJRQRPLF
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHVDX
PDJD]LQDMFDSVH

Capsator din plastic, cu mecanism metalic.


FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHVDX
PDJD]LQDMFDSVH

Cod
BV013231

Culoare
negru

25

100 x 24/6,
100 x 26/6

Cod
BV013241

Culoare
negru

Perforator P20

Perforator M16

Perforator din plastic, cu mecanism metalic.


FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU

Perforator din metal.


FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU

Cod
BV014311

Culoare

20

negru

Cod
BV014221

30

negru

ACCESORII PENTRU BIROU

Cod
BV013251

03

Culoare

20

100 x 24/6,
100 x 26/6

16

negru

Capsator P12
Capsator din plastic, cu mecanism metalic.
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHQU
PDJD]LQDMFDSVH

Capsator C25

Cod
BV013111

Capsator din plastic, cu mecanism metalic.


FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHVDX
PDJD]LQDMFDSVH
Cod
BV013221

Culoare
negru

25

Perforator din metal.


FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
BV014211

Culoare
negru

10

12

100 x nr. 10

TIAI C?

100 x 24/6
100 x 26/6

Perforator M10

Culoare
negru

Primul capsator a fost creat manual la


QFHSXWXODQLORUSHQWUXUHJHOH
/XGRYLFDO;9OHD)LHFDUHFDSVHUD
IFXWPDQXDOLLQVFULSLRQDWFX
QVHPQHOHUHJDOHQVHFROXODO;,;OHD
DQFHSXWGH]YROWDUHDFDSVDWRUXOXL
DFHVWDGHYHQLQGQWLPSXQDFFHVRULX
LPSRUWDQWSHQWUXRULFHELURX

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

141

capsatoare
Capsator B8 FC
Power on Demand
&DSVDWRUSURIHVLRQDOGHFDOLWDWHVXSHULRDUFXSHUIRUPDQHGHUDQJXO
FDSVDWRDUHORUGHVWLQDWHXWLOL]ULLLQWHQVH(VWHSUHY]XWFXVLVWHP3RZHURQ
'HPDQGWUDGXVSULQWUXQHIRUWGHSXVODFDSVDUHFXPDLUHGXVGHFWOD
DOWHPRGHOH0QHUXOPRELOSRDWHSOLDWSHFRUSXOSULQFLSDODOFDSVDWRUXOXL
HFRQRPLVLQGDVWIHOVSDLXGHGHSR]LWDUH&RUSXOHVWHGLQPHWDOLDUFDUFDVDGLQ
SODVWLF(VWHSUHY]XWFXVLVWHP%\SDVVSHQWUXRFDSVDUHFRQIRUWDELOQWUHGRXL
GHFROLGHKUWLHFXDMXWRUXOFDSVHORU6XSHUIUDQHYRLLVVFKLPEDL
capsele. ncrcarea capselor se efectueaz pe partea frontal.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[
DGQFLPHGHSWUXQGHUHQSDJLQPP

ACCESORII PENTRU BIROU

03

Cod
NV1673S

SUPER
CALITATE

25

capsare
deschis

GARANIE

50

capsare
plat

capsare
bypass

200 x 26/8,
150 x 24/8

- 70 %

power on demand

bypass

maneta rabatabil reduce fora cu peste 70%

se pot capsa dou sau 50 de coli cu acelai model de capse

Capsator B4 FC
&RUSGLQPHWDOFXFDUFDVGLQSODVWLFSUHY]XWFXVLVWHP%\SDVVSHQWUXRFDSVDUH
FRQIRUWDELOQWUHGRXLGHFROLGHKUWLHFXDMXWRUXOFDSVHORU6XSHU
IUDQHYRLLVVFKLPEDLFDSVHOHQFUFDUHDFDSVHORUVHHIHFWXHD]SHSDUWHD
superioar.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV12480
NV12485
NV12482

Culoare
gri
negru
albastru
primul capsator fabricat cu tehnologie de capsare bypass

25

50

GARANIE

100 x 24/6, 24/8


150 x 26/6, 26/8

capsare
deschis

capsare
tip cui

capsare
plat

capsare
bypass

Capsator C3 FC
&XXQGHVLJQFXUEDWFDSVDUHSODWLXQSUHDWUDFWLY1RYXV&)&HVWHVROXLD
LGHDOSHQWUXRULFHWLSGHELURX)LLQGIDEULFDWGLQPHWDODFRSHULWFXRFDUFDV
GLQSODVWLF7RWRGDWHVWHSUHY]XWFXVLVWHP%\SDVVFDUHRIHUSRVLELOLWDWHD
FDSVULLFRQIRUWDELOHDSQODGHFROLQFUFDUHDFDSVHORUVHHIHFWXHD]SH
partea superioar.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV340101
NV340105
NV340106

GARANIE

Culoare
gri
albastru
negru

30

100 x 24/6
150 x 26/6

capsare
tip cui

capsare
plat

capsare
bypass

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

143

capsatoare

capsare plat

03

capsare normal

Capsator 5505

ACCESORII PENTRU BIROU

&DSVDWRUFXFDSVDUHSODWRWHKQRORJLHUHYROXLRQDUFHSHUPLWH
HFRQRPLVLUHDDSQODGLQVSDLXORFXSDWQELEOLRUDXUL
&DSVDUHSODWLGHVFKLGHUHrFHSHUPLWHFDSVDUHDWLSFXL
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
capsare
DGQFLPHGHSWUXQGHUHQSDJLQPP
tip cui
Cod
SL804101
SL804102

Culoare
negru
albastru

10
GARANIE

30

capsare
plat

100 x 24/6
140 x 26/6

Capsator 5523
&DSVDWRUFXFDSVDUHSODWRWHKQRORJLHUHYROXLRQDUFHSHUPLWH
HFRQRPLVLUHDDSQODGLQVSDLXORFXSDWQELEOLRUDXUL
&DSVDUHSODWLGHVFKLGHUHrFHSHUPLWHFDSVDUHDWLSFXL
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
capsare
DGQFLPHGHSWUXQGHUHQSDJLQPP
tip cui
Cod
SL804201
SL804202

ncrcare frontal

automatic

Culoare
negru
albastru

10
GARANIE

40

capsare
plat

100 x 24/6
140 x 26/6

Capsator B7A
Capsator de calitate superioar cu sistem automatic patentat, pentru o capsare fr
HIRUWSQODSDJLQLFDSVDWHODDSDVUHDXQXLGHJHW&RUSIDEULFDWGLQPHWDOFX
FDUFDVGLQSODVWLFOXFLRV6LVWHPDQWLEORFDUH $%6 SHQWUXRFDSVDUHFRPRGIU
SUREOHPHQFUFDUHDFDSVHORUVHHIHFWXHD]SHSDUWHDIURQWDO
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
LQFOXGHFDSVH
PDJD]LQDM[VDX[
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV340201
NV340205
NV340206

uor de utilizat

ncrcare frontal

Culoare
gri
albastru
negru

25
GARANIE

30

150 x 24/6,
200 x 26/6

capsare
deschis

capsare
tip cui

capsare
nchis

sistem de alimentare

Capsator B37/2
&DSVDWRUWLSFOHWHXXULQLFRPRGLWDWHQIRORVLUHGHVLJQHUJRQRPLF
&XORDUHFURPDW6LVWHPDQWLEORFDUH $%6 SHQWUXRFDSVDUHFRPRGIU
SUREOHPHQFUFDUHDFDSVHORUVHHIHFWXHD]SHSDUWHDVXSHULRDU
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWH
150 x 24/6, 24/8
PDJD]LQDM[VDX[
40
GARANIE
210 x 26/6, 26/8
DGQFLPHGHSWUXQGHUHQSDJLQPP

10

mecanism antiblocare
ultraperformant

144

Cod
NV1737

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, www.rtc.ro

capsare
deschis

capsare
nchis

capsatoare
Capsator B54/3
&DSVDWRUGHUHJLVWUDWXUIRDUWHUREXVWLSHUIRUPDQWIDEULFDWGLQPHWDO*KLGDM
PHWDOLFVWDELODOPDJD]LHLLJKLGDMGXEOXSUHFLVDOFDSVHORU0DWULUHYHUVLELO
SHQWUXWUHFHUHVLPSOGHODFDSVDUHSDUDOHOODFDSVDUHQVLVWHP%\SDVV
6LVWHPDQWLEORFDUH $%6 SHQWUXRFDSVDUHFRPRGIUSUREOHPHQFUFDUHD
capselor se efectueaz pe partea superioar.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWHVXSHU
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP

25

170

GARANIE

capsare
bypass

100 x 23/8
23/20

capsare
nchis

mecanism antiblocare
ultraperformant
%UDIRDUWHOXQJLSRVLELOLWDWHGHUHJODUHDGLVWDQHLGH
ODPDUJLQHDFROLLSQODPP

mecanism de reglare a distanei

bra lung pentru o capsare uoar

capsare Bypass - pn la 170 de coli


cu acelai tip de capse

ACCESORII PENTRU BIROU

03

Cod
NV1854

schimbarea rapid a tipului


de capsare

Capsator B45/3
&RQVWUXFLHPHWDOLFLFDUFDVGLQSODVWLF*KLGDMGXEOXDOFDSVHORU
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWHVXSHU
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV1845

25
GARANIE

140

100 x 23/6
23/17

,GHDOSHQWUXUHJLVWUDWXULQRWDULDWHEQFL
departamente administrative.

mecanism antiblocare
ultraperformant

Capsator B40/4
(FRQRPLFLXRUGHXWLOL]DW0HFDQLVPDQWLEORFDM
XOWUDSHUIRUPDQWJKLGDMGXEOXDOFDSVHORU
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWHVXSHU
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
NV1841

10
GARANIE

100

100 x 23/6
23/13

mecanism antiblocare
ultraperformant

fant pentru vizualizarea


nivelului de capse

ncrcare frontal

,GHDOSHQWUXUHJLVWUDWXULQRWDULDWHEQFL
departamente administrative.

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

145

capsatoare
30% economie de spaiu n
bibliorafturi sau caiete mecanice

Capsator 5553
&DSVDWRUGHPDUHFDSDFLWDWHFDUHGDWRULWWHKQRORJLHLIRORVLWHSRDWHFDSVD
VDXGHFROLFXXQVLQJXUPRGHOGHFDSV&DSVDUHSODW
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH;/
PDJD]LQDMFDSVH
GARANIE
DGQFLPHGHSWUXQGHUHQSDJLQPP

10

03
ACCESORII PENTRU BIROU

Cod
SL801400

indicator pentru magazia de capse


permite vizualizarea nivelului de capse

30% economie de spaiu n


bibliorafturi sau caiete mecanice

120

bypass un singur model de caps


pentru capsarea a 20-120 de coli

capsare
plat

400 x
23/15XL

spaiu pentru capse de rezerv


capacitate 400 capse 23/15XL

Capsator 5552
&DSVDWRUSUDFWLFFDUHGDWRULWWHKQRORJLHLIRORVLWHDVLJXURFDSVDUHSODWQ
FRPSDUDLHFXFDSVDWRDUHOHWUDGLLRQDOHDVLJXURHFRQRPLHGHVSDLXGHQ
ELEOLRUDXULVDXFDLHWHPHFDQLFH'DWRULWEUDXOXLHUJRQRPLFIRUDGHDSVDUH
necesar pentru capsare este mai redus. Capsare plat.
FDSDFLWDWHGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
capsare
PDJD]LQDMFDSVH
GARANIE
plat
DGQFLPHGHSWUXQGHUHQSDJLQPP

10

Cod
SL801500

100

100 x 23/6
100 x 23/13

60

140 x 25/10

Capsator M100/M150
Capsator de mare capacitate.
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
BV013321
BV013331

150

146

Model
M100
M150

100 x 23/6
23/24

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Capacitate
100 coli
150 coli

Capse utilizate
23/6-23/13
23/6-23/24

capsatoare i tackere
Capsator B17

Cod
NV1717

distanier

25
GARANIE

150 x 24/6,24/8
200 x 26/6,26/8

capsare
deschis

permite capsarea
brourilor A6-A2

capsare
nchis

capacitate mare de capsare

capsare brouri A4

capsare brouri A5

Capsator cu bra
&DSVDWRUIRORVLWSHQWUXFDSVDUHDUHYLVWHORUEURXULORUFDLHWHORULFDWDORDJHORU
FDSDFLWDWHGHFDSVDUHFROL
FDSVHXWLOL]DWHVDX
PDJD]LQDMFDSVH
DGQFLPHGHSWUXQGHUHQSDJLQPP
Cod
BV013311

25

03
ACCESORII PENTRU BIROU

&DSVDWRUSURIHVLRQDOIRORVLWSHQWUXFDSVDUHDUHYLVWHORUEURXULORU
FDLHWHORULFDWDORDJHORU&XORDUHJULFXQHJUXQFUFDUHD
capselor se efectueaz pe partea superioar.
FDSDFLWDWHPD[LPGHFDSVDUHGHFROL
FDSVHXWLOL]DWH
PDJD]LQDM[VDX[
40
DGQFLPHGHSWUXQGHUHQSDJLQPP
SUHY]XWFXGLVWDQLHU

100 x 24/6
100 x 26/6

Tacker J-19EADHG
7DFNHUPDQXDOXWLOL]DWSHQWUXGHFRUDLXQLLQWHULRDUHWDSLHULHSUHFXPLDOWH
DSOLFDLL&DUFDVGLQ]LQFFXUHFXOVF]XW&DSVHOHVHSRWDSOLFDLQFOXVLYOD
PELQULLFROXUL6LVWHPGHUHJODUHDGLVWDQHLIDGHRPXFKLH3XWHUHD
GHLPSDFWFXFDUHVHDSOLFFDSVHOHSRDWHDMXVWDWSHQWUXPDWHULDOHOHFXR
ULJLGLWDWHVSRULW8WLOL]HD]FDSVHLHVWHSUHY]XWFXVLVWHPGHEORFDUH
DPQHUXOXLSHQWUXVLJXUDQDJWRDUHSHQWUXFXUHDLIHUHDVWUGHLQVSHFLH
a capselor.
Cod
NV6119

GARANIE

agtoare pentru curea

CALITATE
PRE

sistem de reglare a distanei


fa de o muchie

uurin n utilizare, att n poziie vertical, ct i orizontal

Tacker J-08 XX
7DFNHUPDQXDOXWLOL]DWSHQWUXGHFRUDLXQLLQWHULRDUHWDSLHULHSUHFXPLDOWH
DSOLFDLL&DUFDVGLQSODVWLFKLJKWHFK&DSVHOHVHSRWDSOLFDLQFOXVLYODPELQUL
LFROXUL6LVWHPGHUHJODUHDGLVWDQHLIDGHRPXFKLH8WLOL]HD]FDSVH
LHVWHSUHY]XWFXVLVWHPGHEORFDUHDPQHUXOXLSHQWUXVLJXUDQ
DJWRDUHSHQWUXFXUHDLIHUHDVWUGHLQVSHFLHDFDSVHORU
Cod
NV6108

GARANIE

agtoare pentru curea

uurin n utilizare, att n poziie vertical, ct i orizontal

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

147

perforatoare
Perforator B2200
3HUIRUDWRUXO%IDFHSDUWHGLQFODVDSHUIRUDWRDUHORUGHPDUHFDSDFLWDWH
3RDWHSHUIRUDIRDUWHXRUHFDUHGLPHQVLXQHGHOD$OD$RIHULQGXQVLVWHP
VXSOLPHQWDUGHVLJXUDQLDUFXDMXWRUXOGLVWDQLHUXOXLVSHFLDOVHSRWUHDOL]D
IRDUWHXRUSHUIRUDLLGRDUGLQGRXPLFUL&XORDUHJULGHVFKLV
3UHYD]XWFXJULSQSHQWUXRXWLOL]DUHFRQIRUWDELO
GRXSHUIRUDLL
FDSDFLWDWHPD[LPGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
JUHXWDWHNJ

03

Cod
NV32200

ACCESORII PENTRU BIROU

Set accesorii
&XSULQGHFXLWHSODWDQH
Cod
NV322001

10

siguran maxim datorit proteciei


contra introducerii accidentale a
minilor

200

GARANIE

$

$

$
$

$

$

perforarea se poate face fr probleme,


chiar i pentru formatele speciale

datorit funciei de centrare, orice coal n format de


la A4 pn la A6 este perforat cu centrare perfect

unitatea de ajustare glisant face perforarea a 4


guri deosebit de confortabil

Perforator 5182
pn la
250 de coli

3HUIRUDWRUSURIHVLRQDOUHDOL]DWGLQPHWDO%UDXOGHDSVDUHHVWHQYHOLWQFDXFLXF
'DWRULWHUJRQRPLHLVDOHVHSRWSHUIRUDFXXXULQSQODFROL%XUJKLXOGH
perforare*HVWHFRQVXPDELO3UHY]XWFXGLVWDQLHUSQOD$
GRXSHUIRUDLL
FDSDFLWDWHPD[LPGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
SL1802400

10
GARANIE

SUPER
CALITATE

*garania acordat nu include


burghiul de perforare

burghiu de rezerv

tvi pentru resturi

148

capacitate mare - pn la 250 coli

distanier - este gradat pn la A3

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

250

perforatoare
Perforator 5180
3HUIRUDWRUGHPDUHFDSDFLWDWHUREXVWLXRUGHXWLOL]DW0QHUSOLDELOSHQWUX
HFRQRPLHGHVSDLX0QHUXOGHDSVDUHHVWHUHDOL]DWSHQWUXDDVLJXUDFWPDL
HFLHQWWUDQVIHUXOGHSXWHUHQYHGHUHDXXUULLRSHUDLXQLLGHSHUIRUDUH
GRXSHUIRUDLL
FDSDFLWDWHPD[LPGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
VLVWHPGHEORFDUHDFODSHL
Culoare
argintiu
negru
albastru

sistem de blocare a clapei


pentru depozitare eficient n
dulap

10

03

65

GARANIE

ACCESORII PENTRU BIROU

Cod
SL802500
SL802501
SL802502

bra de apsare
nvelit n cauciuc

fr efort!
indicator gradat
perforeaz 65 coli de 80 g/mp indicator mai mare pentru o
printr-o singur apsare
vizibilitate mai ridicat

Perforator B265
,GHDOSHQWUXUHJLVWUDWXULEQFLGHSDUWDPHQWHDGPLQLVWUDWLYH%D]GLQPHWDO
FODSGLQPHWDODFRSHULWFXSODVWLFGHRIRDUWHEXQFDOLWDWH&XORDUHJUL
GHVFKLV
GRXSHUIRUDLL
FDSDFLWDWHPD[LPGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV3265

clapa poate fi blocat orizontal


pentru o depozitare mai uoar

10

sistem de blocare
a clapei

65

GARANIE

distanier

capacitate de perforare
65 coli

Perforator B430
3HUIRUDWRUVROLGGLQPHWDOSHQWUXSHUIRUDLLFHIDFHSDUWHGLQJDPD
SHUIRUDWRDUHORUVSHFLDOH'LVWDQDGLQWUHSHUIRUDLLHVWHYDULDELO3ULQDWDDUHD
XQXLVHWGHFXLWHVHSRDWHIRORVLLSHQWUXSHUIRUDLL&XORDUHJULFXQHJUX
SHUIRUDLL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLYDULDELO
SUHY]XWFXGLVWDQLHU
VLVWHPGHEORFDUHDFODSHL
Cod
NV3208

10

30

GARANIE

Set dou cuite


Cod
NV0361

cuite reglabile
cu ajutorul riglei detaabile se pot determina exact
distanele dintre perforaiile ce trebuie executate

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

149

perforatoare
Perforator B425
3HUIRUDWRUGXEOX SHQWUXSHUIRUDLL FXED]GLQPHWDO&ODSGLQPHWDO
DFRSHULWFXSODVWLFGHRIRDUWHEXQFDOLWDWH&XORDUHJULFXQHJUX
SHUIRUDLL
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV3425

03

10

25

GARANIE

sistem de blocare
a clapei

ACCESORII PENTRU BIROU

)RORVLWSHQWUXSHUIRUDUHDFROLORUFHVH
QGRVDULD]QELEOLRUDXULFXGRX
PHFDQLVPHLFDLHWHPHFDQLFHFXLQHOH

Perforator B260
3HUIRUDWRUHFRQRPLFIDEULFDWGLQPHWDO&XORDUHJULFXQHJUX
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
sistem de blocare
a clapei

Cod
NV3260

10

60

GARANIE

3HUIRUDWRDUHLGHDOHSHQWUXUHJLVWUDWXULEQFLGHSDUWDPHQWHDGPLQLVWUDWLYH
3HUIRUHD]FXXXULQXQQXPUPDUHGHFROLLDUVLVWHPXOGHEORFDUHD
FODSHLSHUPLWHGHSR]LWDUHDSHUIRUDWRUXOXLIUDRFXSDPXOWVSDLX

Perforator B240
%D]GLQPHWDOFODSGLQPHWDODFRSHULWFXSODVWLFGHRIRDUWHEXQFDOLWDWH
&XORDUHJULFXQHJUX
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
Cod
NV3240

10

40

GARANIE

sistem de blocare
a clapei

Perforator M35
Perforator metalic de mare capacitate.
FDSDFLWDWHGHSHUIRUDUHFROL
GLVWDQDQWUHSHUIRUDLLPP
SUHY]XWFXGLVWDQLHU
FXORDUHQHJUX
Cod
BV01441

150

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

35

capse
Indiferent de capsator, indiferent de tipul de capsare,
noi avem capsele potrivite pentru tine!
mai mic numrul, cu att mai gros este firul
de srm folosit. Iar 6 reprezint lungimea
piciorului n mm. Exist i dimensiuni
speciale, cum ar fi capsele nr. 10 pentru
mini-capsatoare, dar i altele.

Leitz Power Performance

Capse
Cod
SL803000

Tip

Ambalare

Nr. coli recomandat

nr. 10

1000

15

SL803100

24/6

1000

30

SL803200

24/8

1000

40

SL803300

26/6

1000

30

SL803400

25/10

1000

60

SL803500

23/15 XL

1000

120

QWRWGHDXQDXRUGHXWLOL]DWSHQWUX
rezultate perfecte
SURGXVHGHFDOLWDWHSUHPLXPLPDLSXLQHEORFDMH
QXVHR[LGHD]GDWRULWRHOXOXLJDOYDQL]DW
FDOLWDWHDWHKQRORJLHLJHUPDQH
SQODDQLJDUDQLHODFDSVDWRDUHOH
/HLW]DWXQFLFQGVXQWXWLOL]DWHFDSVH
/HLW]3RZHU3HUIRUPDQFH
UHFRPDQGDWHDVHXWLOL]DLFXDOWH
EUDQGXULGHFDSVDWRDUH
1000x
24/8

Capse
Cod

Tip

Ambalare

Nr. coli
recomandat

NV2210

nr. 10

1000

20

NV2247

24/6

1000

30

NV2246

24/6 SUPER

1000

30

NV2248

24/8 SUPER

1000

50

NV2266

26/6

1000

25

NV2236

23/6

1000

30

NV2238

23/8

1000

50

NV22310

23/10 SUPER

1000

70

NV22313

23/13 SUPER

1000

100

NV22317

23/17 SUPER

1000

140

NV22319

23/20 SUPER

1000

170

40

03
1000x
25/10

P5
60

P4
Staples
Heftklammern

Staples
Heftklammern

ACCESORII PENTRU BIROU

Nu toate capsele sunt la fel. Alegerea


tipului de caps depinde de ct de multe
coli doreti s capsezi. Poi spune multe
despre o caps dup dimensiunile sale. De
exemplu, o caps 24/6: 24 denot tipul de
srm utilizat pentru caps. Cu ct este

Capse pentru tackere


Cod
NV7538

Tip

Ambalare

53/8

2000

NV75310

53/10

1000

NV75312

53/12

1000

NV75314

53/14

1000

Capse
Cod
BV015111

Tip

Ambalare

Nr. coli recomandat

nr. 10

1000

10

BV015113

24/6

1000

20

BV015112

26/6

1000

20

BV015211

23/8

1000

25

BV015213

23/13

1000

100

BV015214

23/15

1000

120

BV015215

23/17

1000

140

BV015216

23/20

1000

170

BV015217

23/24

1000

210

Decapsator
8WLOL]DWSHQWUXGHFDSVDUHDXUPWRDUHORUWLSXULGHFDSVH
QU
Cod
BV016111

Culoare
negru

Oricare ar fi meseria ta, avem produsul potrivit.

151

seturi pentru birou

ACCESORII PENTRU BIROU

03

DB241701

DB241723

DB241323

DB244301

DB900005

DB241301

DB900009

DB900003

SUPER
CALITATE

Set Vegas
3HQWUXFDELURXOWXVHSHUIHFWRUJDQL]DWDOHJHVROXLLOH
FRPSOHWHGHVHWXULGHDFFHVRULLSHQWUXELURX9HLRIHULDVWIHO
XQDVSHFWXQLWDULHOHJDQWELURXOXLDYQGQDFHODLWLPSOD
QGHPQWRDWHSURGXVHOHFDUHWHDMXWVOXFUH]LPDLHFLHQW

152

DB900007

DB771101

Denumire

Caracteristici

Visifix FLIP

200 buzunare pentru 400 cri de vizit, 104 x 72 mm

negru
DB241701

argintiu
DB241723

Visifix FLIP duo

300 buzunare pentru 600 cri de vizit i 40 cartonae

DB244301

Visifix DESK

100 buzunare pentru 200 cri de vizit, 104 x 72 mm

DB241301

DB241323

Suport agrafe

magnetic, 100 agrafe

DB900005

Suport cub notie

pentru cuburi format 90 x 90 cm

DB900009

Dispenser band adeziv

pentru band adeziv 19 mm x 33 m, conine o rol

DB900003

Suport instrumente de scris

5 compartimente

DB900007

Tvi pentru documente

din material plastic, A4, 255 x 55 x 330 mm

DB771101

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

seturi pentru birou


CALITATE NALT

ELEGANT

PRACTIC

VERSATIL

STABIL
INOVATOR

COMAND
SPECIAL

MOBIL

COMPACT

Suport tablet Varicolor

Organizator cu sertare Varicolor

6XSRUWGHQDOWFDOLWDWHSUDFWLFSHUIHFWVWDELODFRSHULWFXXQFDXFLXF
PRDOHDQWLDOXQHFDUH(VWHFRPSDWLELOFXWRDWHPRGHOHOHGHWDEOHWH
SHUPLQGSR]LLRQDUHDDWWRUL]RQWDOFWLYHUWLFDO6HURWHWHODr
IU]JRPRW

2UJDQL]DWRDUHFXVHUWDUHFRQIHFLRQDWHGLQPDWHULDOSODVWLFGHFDOLWDWHSUHPLXP
)LHFDUHVHUWDUHVWHFRORUDWGLIHULWSHQWUXDDMXWDODRPDLEXQRUJDQL]DUHD
GRFXPHQWHORU6HUWDUHOHVXQWSUHY]XWHFXIHUHVWUHGHHWLFKHWDUHWUDQVSDUHQWHL
LQVHULLGHHWLFKHWHSULQWDELOHXRUGHVFKLPEDW

Cod
DB761112

Cod
DB760527
DB760727

Sertare
5
7

ACCESORII PENTRU BIROU

ORDONAT

ROTATIV

*DPD9DULFRORUHVWHGLVSRQLELO
la comand special.

03

Dimensiuni
292 x 280 x 356 mm
292 x 280 x 356 mm

dou unghiuri de poziionare a tabletei

Organizator sertare Varicolor


2UJDQL]DWRUDWUDFWLYLFRPSDFWFHSRDWHXWLOL]DWSHELURXVDXQVHUWDUSUHY]XW
FXXQFRPSDUWLPHQWVSHFLDOSHQWUXDDH]DWHOHIRQXOVDXWDEOHWDPSUHXQFX
FDEOXULOHDIHUHQWH6ROXLDLGHDOSHQWUXGHSR]LWDUHDDFFHVRULLORUPLFLSHQWUX
ELURX)DEULFDWGLQSODVWLFGHQDOWFDOLWDWH3UHY]XWFXWDPSRDQHGHFDXFLXF
anti-alunecare.
tabletele pot fi fixate
i cu husa de protecie

prevzut cu buton de blocare


a rotirii n poziia dorit

Cod
DB761312

Cutie depozitare Varicolor


&XWLHPRELOLQRYDWRDUHSHQWUXRH[LELOLWDWHPD[LP6XSRUWGH
LQWHULRUFRPSDUWLPHQWDW2VROXLHSUDFWLFGHGHSR]LWDUHDQFUFWRDUHORU
SHQWUXWHOHIRQVDXWDEOHWDLQVWUXPHQWHORUGHVFULVLDDOWRUDFFHVRULL
PLFLSHQWUXELURXLQGLFDWRULODVHUQRWLHDGH]LYHFDUGXUL'LVSXQHGHXQ
VXSRUWGHWDDELOSHQWUXLQVWUXPHQWHGHVFULV
Cod
DB761212

Suport instrumente de scris Varicolor


6XSRUWSHQWUXLQVWUXPHQWHGHVFULVDWUDFWLY
FRPSDWLELOFXVROXLLOH'XUDEOH9DULFRORU6WRFKHD]
SL[XULOHFUHLRDQHOHIRDUIHFHOHLDOWHDFFHVRULLPLFL
SHQWUXELURXQDFHVWVXSRUWFXXQDVSHFWHOHJDQW
LQLVDMHOXFLRDVH
Cod
DB761412

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

153

seturi pentru birou


Leitz Plus
Robust. Modular. Flexibil.
*DPD/HLW]3OXVHVWHVROXLDSUHIHUDWQPLLGH
ELURXUL7YLHOH/HLW]3OXVVXQWFHOHPDLUREXVWHGLQ
FODVDORU SXWQGVXVLQHSQODSDWUXNLORJUDPH
IUQGRLUHVDXUXSHUH
VHUHIHUODWYLHOH/HLW]3OXVVWDQGDUGFRPSDUDWLYFXWYLHOHVWDQGDUGGLQSODVWLF

ACCESORII PENTRU BIROU

03

Tvi cu sertar

Tvi Jumbo

Tvi standard

Tvi Slim

4 kg
&HOHWUHLQOLPLGLIHULWHVSRUHVFQXPUXOGHRSLXQLSHQWUX
FUHDUHDVLVWHPXOXLLGHDOGHRUJDQL]DUH

SL008321

SL008311

SL008261

SL008221

SL008211

SL008231

SL008241

SL008251

Set Leitz Plus


3URLHFWDWHSHQWUXDPRGXODUHWYLHOHSHQWUXGRFXPHQWHSRWVXSUDSXVHQFRORDQVDXQWUHSWHLFRPELQDWHQWUXQQXPUQHOLPLWDW
GHPRGXULQFRQIRUPLWDWHFXQHYRLOHGXPQHDYRDVWUVSHFLFH2IHUXQDVSHFWXQLWDULRLPDJLQHRUGRQDWDVSDLXOXLGHOXFUX

154

6FDQHD]FRGXO
pentru a vedea cel
mai recent videoclip
cu Leitz Plus.

Negru
SL008212

Albastru
SL008211

Articol

Descriere

tvi slim pentru documente

capacitate redus de ncrcare, 255 x 35 x 357 mm

SL008222

SL008221

tvi standard pentru documente

capacitate standard, 255 x 70 x 357 mm

SL008232

SL008231

tvi jumbo pentru documente

capacitate mare de ncrcare, 255 x 70 x 357 mm

SL008242

SL008241

tvi landscape pentru documente

ideal pentru documentele groase, cu cotor lat, 363 x 70 x 273 mm

SL008252

SL008251

tvi jumbo landscape pentru documente ideal pentru documentele groase, cu cotor lat, capacitate sporit, 363 x 103 x 273 mm

SL008262

SL008261

tvi cu sertare

SL008312

SL008311

suport vertical pentru documente

capacitate standard, 72 x 310 x 278 mm

SL008322

SL008321

suport vertical jumbo pentru documente

pentru documente voluminoase, 213 x 321 x 250 mm

produs unic, ce poate fi folosit individual sau ntr-un sistem modular, alturi de
alte tvie, format A4, 255 x 71 x 376 mm

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

seturi pentru birou

Set Europost

Suport cu sertare
3DWUXVHUWDUHFDUHJOLVHD]XRUGRWDWHFXRSULWRU6SDLXSHQWUXHWLFKHWSH
HFDUHVHUWDUED]DQWLDOXQHFDUH
Cod
SL081000
SL081001
SL081002

Culoare
negru
albastru
rou

ACCESORII PENTRU BIROU

03

*DPGHELURXIDEULFDWGLQSODVWLF'HVLJQPRGHUQLWH[WXU
XQLFQWURSDOHWYDULDWGHFXORUL9,9,'$

Tvie i suporturi pentru documente


7YLHFXGHFXSDMIURQWDOURWXQMLWSHQWUXDFFHVIDFLOODGRFXPHQWH6HSRWVXSUDSXQH
SHYHUWLFDOVDXQWUHSWH6XSRUWXULOHYHUWLFDOHDXRQOLPHUHGXVDFRWRUXOXLSHQWUX
LGHQWLFDUHDXRDUDFRQLQXWXOXL%D]FXGHVLJQXQLFLWH[WXU9,9,'$
Cod
SL08101x

suport pentru documente, cotor 68 mm, 72 x 256 x 260 mm

Produs

SL08102x

tvi pentru documente, suprapozabil, 255 x 65 x 350 mm

transparent
fumuriu
[FXORDUH WUDQVSDUHQW fumuriu

[FXORDUHQHJUX URX JDOEHQ DOEDVWUX verde

Co pentru hrtii
'HVLJQPRGHUQLWH[WXUXQLF0QHULQWHJUDWSHQWUXJROLUHXRDU
&DSDFLWDWHO

Suport pentru instrumente de scris

Cod
SL081110
SL081111
SL081113
SL081112
SL081114

Decupat frontal, pentru acces rapid.


%D]VWDELOSHQWUXDSUHYHQLUVWXUQDUHD

Culoare
negru
rou
albastru
verde
galben

Cod
SL083110
SL083111
SL083112

Culoare
negru
rou
albastru

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

155

seturi pentru birou


Set metal Mesh
6HWGHDFFHVRULLSHQWUXELURXIDEULFDWGLQPHWDO

ACCESORII PENTRU BIROU

03

BV012181

CALITATE
PRE

Negru
BV012141

Argintiu
BV012142

Descriere
suport pentru accesorii

BV012131

BV012132

suport pentru cub de hrtie

BV012121

BV012122

suport pentru instrumente de scris

BV012171

BV012172

suport pentru documente

BV012191

BV012192

co pentru hrtii

BV012181

BV012182

set 3 tvie suprapozabile

BV012182

BV012121
BV012142

BV012172

BV012171

BV012132

BV012192

BV012141

BV012122

BV012191

BV012131

Set Star
CALITATE
PRE

*DPGHVXSRUWXULSHQWUXELURXIDEULFDWGLQSODVWLF9DULDQWDHFRQRPLFGDUQDFHODLWLPSSUDFWLFL
HOHJDQWSHQWUXDSVWUDRUJDQL]DWGRFXPHQWHOHSHELURX7YLHOHSRWDH]DWHQGLUHFLLRSXVHLDVWIHO
VHRELQHXQDFFHVPXOWPDLUDSLGODGRFXPHQWHGHSHDPEHOHSULDOHELURXOXL8RUGHDVDPEODWDFHVWH
WYLHRIHUXQVSDLXPDUHGHGHSR]LWDUHSXWQGVXSUDSXVHSQODWYLH6HDGDSWHD]FXVXFFHV
RULFUXLWLSGHELURXLQGGLVSRQLELOQSDWUXFXORUL
Descriere
suport cub hrtie

incolor
AS006001

fumuriu
AS006002

negru
albastru
AS006003 AS006004

set 3 tvie suprapozabile

AS00411

AS00412

AS00422

FL000100

FL000101

FL000102 FL000103

FL000200

FL000201

FL000202 FL000203

tvi pentru documente


cutie 4 tvie pentru documente
suporturi pentru documente
cutie 4 suporturi pentru documente

AS00423

Suport basic pentru documente


6XSRUWHUJRQRPLFFODVLFFXSHUIRUDLLFHDMXWODLGHQWLFDUHDPDLHFLHQWD
GRFXPHQWHORU)DEULFDWGLQPDWHULDOSODVWLF'LPHQVLXQL[[PP
8QLWDWHGHYQ]DUHEXFLFXWLH
Cod
AS007003
AS007001
AS007000
AS007004

156

Culoare
incolor
negru
albastru
fumuriu

Suport din carton pentru documente


8QDGLQWUHFHOHPDLVLPSOHPRGDOLWLGHGHSR]LWDUHDGRVDUHORUVDXFDWDORDJHORU
)DEULFDWGLQFDUWRQ'LPHQVLXQL[[PP
Cod
SL40691
SL40692

Culoare
alb
albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

tvie pentru documente

03
ACCESORII PENTRU BIROU

6LVWHPPXOWLIXQFLRQDOGHSUH]HQWDUHDSOLDQWHORUVDXGHVWRFDUHDGRFXPHQWHORU2ODUJ
YDULHWDWHGHFRPELQDLLHVWHSRVLELOFXGRDUFWHYDFRPSRQHQWH7RDWHPRGXOHOHSRW
IRORVLWHDWWFDWYLHSHQWUXELURXFWLFDWYLHSHQWUXSHUHWHIUDQHYRLHGHSLHVH
VXSOLPHQWDUH7YLHOHVXQWXRUGHDVDPEODWVXQWUH]LVWHQWHODRFXULL]JULHWXUL6H
OLYUHD]PSUHXQFXXUXEXULSHQWUXPRQWDUHDSHSHUHWH&XORDUHWUDQVSDUHQWLQFRORU

pentru perete

pentru birou

COMBIBOXX PRO
6HWGHWYLHYHUWLFDOHGHELURXVDXGHSHUHWHFRPSXVGLQ
WYL$LWYLH$/DDFHVWPRGXOVHSRWDGXJD
DWWWYLH$FWLWYLH$GXSQHFHVLWL
Cod
DB861319

Tvie suplimentare COMBIBOXX


Cod
DB857919

Dimensiuni
A4

COMBIBOXX A4
3RWIRORVLWHDWWFDWYLHGHELURXFWLFDWYLHGHSHUHWH/DDFHVWPRGXOVH
SRWDGXJDWYLHVXSOLPHQWDUHGXSQHFHVLWL
Cod
DB857819

portrait

Model

DB868419

landscape
pentru birou, portrait

pentru perete, portrait


SUPER
CALITATE

Tvi suplimentar COMBIBOXX A4


Cod
DB857919

Model

DB868519

landscape

portrait

pentru birou, landscape


pentru perete, landscape

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

157

suporturi pentru accesorii

Suport pentru accesorii


de birou C50
0RGHUQFRQIHUHOHJDQELURXOXLWX
&RPSDUWLPHQWHSHQWUXDFFHVRULL6HOLYUHD]FXXQSDFKHWGHQRWLH3RVWLWp
GLPHQVLXQL[PPRUROGHEDQGDGH]LY6FRWFK0DJLFXQVHW3RVWLWp
,QGH[PLQLFXORULGLPHQVLXQL[PP&XORDUHDUJLQWLX

03
ACCESORII PENTRU BIROU

Cod
3M7004

Suport rotativ pentru


accesorii C91
(OHJDQWURWDWLYSUHY]XWFXFRPSDUWLPHQWHVSHFLDOHSHQWUXWRDWHDUWLFROHOHGHELURX
6HOLYUHD]FXRUROGHEDQGDGH]LY6FRWFK0DJLFXQSDFKHWGHQRWLH3RVWLWp
[PPLGRX3RVWLWp,QGH[FODVLFGLPHQVLXQL[PP
&XORDUHQHJUX
Cod
3M7003

Suport rotativ cu accesorii


)DEULFDWGLQSODVWLFQHJUX&RQLQHFDSVDWRUGHFDSVDWRUFXWWHUIRDUIHFDVFXLWRDUH
ULJOGLVSHQVHUEDQGDGH]LYUDGLHUFUHLRQ+% EXFL SL[ EXFL SLRQH]H
EXFL DJUDIH EXFL EXFLFDSVHQUQRWLHGLQKUWLH[FP
&XORDUHQHJUX
CALITATE
PRE

Cod
BV071101

complet echipat

158

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, www.rtc.ro

suporturi pentru accesorii


Suport Vegas
pentru accesorii de birou
'HVLJQPRGHUQIDFHSDUWHGLQJDPD9HJDV
&LQFLFRPSDUWLPHQWHED]FDXFLXFDWFHPSLHGLFDOXQHFDUHD6HOLYUHD]QHHFKLSDW
Cod
DB900007

Culoare
negru
SUPER
CALITATE

03
ACCESORII PENTRU BIROU

Pentru gama
complet Vegas
consult pagina 152!

Suport pentru accesorii de birou


)DEULFDWGLQPDWHULDOSODVWLF(VWHXQLQVWUXPHQWSUDFWLFSHQWUXRULFHELURX3UHY]XWFX
FRPSDUWLPHQWHVSHFLDOHSHQWUXLQVWUXPHQWHGHVFULVDJUDIHQRWLHDXWRDGH]LYHLDOWH
DUWLFROHQHFHVDUHSHQWUXELURX6HOLYUHD]QHHFKLSDW
Cod
FL6999

Culoare
negru

Suport Clasic
6XSRUWSHQWUXLQVWUXPHQWHGHVFULVGLQSODVPHWDOLF)DEULFDWGLQPHWDOED]GH
FDXFLXFDQWLGHUDSDQW6HOLYUHD]QHHFKLSDW
Cod
BV012121

Culoare

BV012122

argintiu

negru
Pentru gama
complet Mesh
consult pagina 156!

Suport pentru accesorii de birou


6XSRUWFXUHVSHFWLYFRPSDUWLPHQWHGHVLJQFODVLF3R]LLRQDUHFRPSDFWD
FRPSDUWLPHQWHORU1HFHVLWVSDLXUHGXVSHELURX,GHDOSHQWUXGHSR]LWDUHD
LQVWUXPHQWHORUGHVFULVLDDFFHVRULLORUPLFLGHELURX6HOLYUHD]QHHFKLSDW
Cod
FL6901
FL6900
FL6902
FL6898
FL6897
FL6899

Compartimente
6
6
6
4
4
4

CALITATE
PRE

Culoare
negru
rou
albastru
negru
rou
albastru

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

159

dispensere pentru benzi adezive

Dispenser pentru band adeziv de birou


'LVSHQVHULQRYDWRUSHQWUXELURXFXGHVLJQHUJRQRPLFLSRVLELOLWDWHGH
UHXPSOHUHSHQWUXWLHWXULSUHFLVHLGHPDUHDMXWRU'LVSHQVHUXO7HVDHVWH
SUHY]XWFXVWRSSDGFHJDUDQWHD][DUHDVLJXUSHELURX
ODP]LPDWSHQWUXWLHUHDFXXXULQDEHQ]LLDGH]LYH
SRDWHUHXPSOXWIUHIRUW
FRPSDWLELOFXWRDWHUROHOHGHEHQ]LDGH]LYHFXOLPHDGHSQODPP
EDQGDDGH]LYQXHVWHLQFOXV

03
ACCESORII PENTRU BIROU

Cod
TS539020

Dispenser Scotch Clasic C38


pentru band adeziv
'LVSHQVHUQHJUXFXQLVDMHOHJDQWSHQWUXEDQGDGH]LYPP[P
6HOLYUHD]IUEDQGDGH]LY
Cod
3M2003

Dispenser pentru band adeziv


Vegas
'LVSHQVHUFXED]FDXFLXFDWFHPSLHGLFDOXQHFDUHD3HQWUXEDQGDGH]LY
FXOLPHPD[LPGHPPLOXQJLPHP6HOLYUHD]PSUHXQFXRUROGH
EDQGDGH]LY

SUPER
CALITATE

Cod
DB900003

Culoare
negru

rola poate fi nlocuit cu uurin

Dispenser Caracol
pentru band adeziv
Dispenser pentru band adeziv
'HVLJQXQLFXRUGHPDQHYUDW5HDOL]DWGLQSODVWLFVHIRORVHWHSHQWUXEDQG
DGH]LYPP[P&XORDUHGLVSHQVHUURX,QFOXGHRUROGHEDQG
DGH]LY.RUHV,QYLVLEOH

Cod
BV012213

Cod
KS53639

160

'LVSHQVHUSHQWUXEHQ]LDGH]LYHFXOLPHGHPD[LPPP)DEULFDWGLQSODVWLF
6HOLYUHD]IUEDQGDGH]LY&XORDUHQHJUX

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

benzi adezive

Band Tesafilm invisibil

Cod
TS057335

Dimensiuni

Unitate de vnzare

19 mm x 10 m

rol

TS057661

19 mm x 10 m

rol + dispenser

TS057312

19 mm x 33 m

rol

TS057414

19 mm x 33 m

rol + dispenser

COMAND
SPECIAL

03
ACCESORII PENTRU BIROU

Band TesafilmpLQYL]LELOUHFRPDQGDWSHQWUXOHJDUHDLUHSDUDUHDGLVFUHWD
GRFXPHQWHORULPDQXVFULVHORU$SURDSHLQYL]LELOSHKUWLDGHFXORDUHGHVFKLV
se poate scrie pe ea cu aproape orice stilou. Manevrare facil, se desfoar fr
]JRPRW$GH]LYGLQIROLHGHSROLSURSLOHQIUGLOXDQL$PEDODMIDEULFDWGLQFDUWRQ
UHFLFODWQSURSRULHGH1XLHVHQHYLGHQODIRWRFRSLHUH

Band adeziv invisibil BASIC


%DQGDXWRDGH]LYSHQWUXUHSDUDUHDGLVFUHWDGRFXPHQWHORULPDQXVFULVHORU
3RWVFULVHFXSL[LFUHLRQ1XLHVHQHYLGHQODIRWRFRSLHUH'LVSRQLELOQPDL
multe dimensiuni.
Cod
TS585550

Dimensiuni

Unitate de vnzare

33 m x 15 mm

rol

TS585560

10 m x 15 mm

rol + dispenser

COMAND
SPECIAL

Band adeziv Scotch Magic


%DQGDGH]LYLQYL]LELOGXSDSOLFDUH6HSRDWHUXSHIRDUWHXRUIUDXWLOL]D
IRDUIHFD1XVHQJOEHQHWHQWLPSHVWHUH]LVWHQWODXPLGLWDWHVHSRDWHVFULHSH
HD(VWHUHFRPDQGDWSHQWUXUHSDUDUHDGRFXPHQWHORUXQLUHDSDJLQLORULVHFXUL]DUHD
SOLFXULORU(VWHLGHDOSHQWUXDFWLYLWLOHGHIRWRFRSLHUHGHRDUHFHDUHXQJUDGIRDUWH
PDUHGHWUDQVSDUHQLQGLQYL]LELOSHKUWLDVFULV
Cod
3M2001

7.5 m x 19 mm

Dimensiuni

Unitate de vnzare
rol + dispenser

3M20011

33 m x 19 mm

rol

3M20018

33 m x 19 mm

6 role + 2 GRATIS

SUPER
CALITATE

Band adeziv Invisible


%DQGDGH]LYLQYL]LELOUHFRPDQGDWSHQWUXOLSLUHDGRFXPHQWHORUVDXSHQWUX
VHFXUL]DUHDSOLFXULORU$DFXPLVSXQHLQXPHOHHVWHLQYL]LELOGXSDSOLFDUHDSH
KUWLH6HSRDWHVFULHSHHDLHVWHXRUGHUXSW
Cod
AL012533

Lungime

Lime

33 m

19 mm

CALITATE
PRE

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

161

benzi adezive
Band adeziv transparent
)LDELOXOWHVDOPpHVWHDFXPGLVSRQLELOQWURYHUVLXQHHFRORJLF)LOPLPLH]
IDEULFDWGLQSODVWLFUHFLFODWDGH]LYLIUVROYHQL&DOLWDWHQDOWDSURDSH
LQYL]LELOSHQXPHURDVHVXSUDIHH5H]LVWHQODQYHFKLUHVHGHVIRDUIU]JRPRW
$PEDODMGLQFDUWRQUHFLFODW

ACCESORII PENTRU BIROU

03

Cod
TS057969

Dimensiuni

Unitate de vnzare

15 mm x 10 m

rol + dispenser EasyCut

TS057968

19 mm x 33 m

rol + dispenser EasyCut

TS058240

19 mm x 10 m

rol + Mini dispenser

TS058241

19 mm x 10 m

2 role + Mini dispenser

COMAND
SPECIAL

Band adeziv Crystal


&DOLWDWHDRSWLPLJUDGXOQDOWGHWUDQVSDUHQDOHEHQ]LLWUDQVSDUHQWHFU\VWDO
tesafilmpVXQWLGHDOHSHQWUXPELQULOHLQYL]LELOHSULQGHUHUHSDUDUH[DUHL
DPEDODUH)RDUWHWUDQVSDUHQWLQYL]LELOSHPXOWHVXSUDIHHUH]LVWHQH[FHOHQWOD
UXSHUHDGHUHQSXWHUQLF(VWHUH]LVWHQODQYHFKLUHVHGHVIRDUIU]JRPRW
$GH]LYGLQIROLHGHSROLSURSLOHQIUGLOXDQL

TS579320

TS057937

Cod
TS579320

Dimensiuni

Unitate de vnzare

33 m x 19 mm

rol

TS579470

33 m x 19 mm

8 role/set

TS057937

19 m x 10 mm

2 role + dispenser

COMAND
SPECIAL

COMAND
SPECIAL

TS579470

Band adeziv
Scotch Crystal Clear
3HUIHFWWUDQVSDUHQWUH]LVWHQWQWLPSHVWHLGHDOSHQWUXDPEDODUHDSDFKHWHORU
PLFLSURWHMDUHDXQHLHWLFKHWHVDXRULFQGHVWHQHYRLHGHXQQLVDMGLVFUHW

SUPER
CALITATE

Cod
3M105

Dimensiuni
7.5 m x 19 mm

Unitate de vnzare
rol + dispenser

3M1050

33 m x 19 mm

rol

Band adeziv Crystal


%DQGDGH]LYSHUIHFWWUDQVSDUHQWFDUHQXVHQJOEHQHWHQWLPSLQYL]LELOSH
PXOWHVXSUDIHHUH]LVWHQWODUXSHUH%DQGDVHGHUXOHD]FXXXULQSHQWUXR
XWLOL]DUHFRQIRUWDELO

CALITATE
PRE

Cod
AL011035

162

Dimensiuni
33 m x 19 mm

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

benzi adezive

Band adeziv transparent


Band adeziv Tesafilmp%$6,&GHX]JHQHUDOSHQWUXELURX
*UDGULGLFDWGHWUDQVSDUHQ
Dimensiuni

Unitate de vnzare

12 m x 10 mm

rol

COMAND
SPECIAL

TS585410

15 m x 10 mm

rol

COMAND
SPECIAL

TS585430

19 m x 10 mm

rol

COMAND
SPECIAL

TS585400

33 m x 12 mm

rol

COMAND
SPECIAL

TS585490

33 m x 15 mm

rol + dispenser

TS585440

33 m x 19 mm

rol

03
ACCESORII PENTRU BIROU

Cod
TS585390

Band adeziv Scotch transparent


%DQGDGH]LYWUDQVSDUHQWQXVHQJOEHQHWHQWLPS
Cod
3M119033

Dimensiuni

Unitate de vnzare

33 m x 19 mm

rol

3M119033C

33 m x 19 mm

set (8 role)

3M15010

10 m x 15 mm

rol

SUPER
CALITATE

Band adeziv transparent


%DQGDGH]LYWUDQVSDUHQWFXVXSRUWGLQSODVWLF6HGHUXOHD]XRU
QXVHQJOEHQHWHQWLPSLUH]LVWODXPLGLWDWH
Cod
AL011169

33 m x 12 mm

Dimensiuni

AL011329

33 m x 15 mm

AL11103

33 m x 19 mm

%HQ]LOHDGH]LYHWUDQVSDUHQWHVXQWRVROXLH
HFRQRPLFLHFLHQWSHQWUXDSOLFDLL
GLYHUVHIUHFYHQWHQELURXOWX

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

163

benzi adezive
Band dublu adeziv
buretat pentru interior
%DQGGHPRQWDUHGHPDUHUH]LVWHQGXEOXDGH]LYSHQWUXRJDPODUJGHXWLOL]ULFDVQLFH
PDLDOHVSHQWUX[DUHDRELHFWHORUPLFLQDPHQDMULOHLQWHULRDUH5H]LVWHQIRDUWHPDUHSQOD
NJFPGHEDQG3RDWHIRORVLWSHSOFLGHIDLDQWHQFXLDOOHPQLSODVWLF
Cod
TS557400

Unitate de vnzare

1.5 m x 19 mm

rol

ACCESORII PENTRU BIROU

03

Dimensiuni

Band dublu adeziv buretat


%DQGGHPRQWDMGXEOXDGH]LYFXDGHUHQVSRULWSHQWUX[DUHDQVLJXUDQLUDSLGD
RJOLQ]LORULDDOWRURELHFWHSODWHQQFSHULXPHGH5H]LVWHQWODXPLGLWDWHVXVLQHRJOLQ]LFX
GLPHQVLXQLPD[LPHGH[FPLSQODPPJURVLPH
3RWULYLWSHQWUX]RQHOHXPHGHFXPDUELOH
Cod
TS557320

Dimensiuni

Unitate de vnzare

1.5 m x 19 mm

rol

Band dublu adeziv


(VWHSRWULYLWSHQWUXWRDWHWLSXULOHGHKUWLHLSHQWUXFDUWRQPXOXPLWDELOLWLLLWUDQVSDUHQHLVDOH
7UDQVSDUHQWDGHUHQEXQUH]LVWHQODQYHFKLUH6HGHUXOHD]XRULHVWHUHDOL]DWGLQIROLHGH
polipropilen.
Cod
TS646230

164

Dimensiuni

Unitate de vnzare

10 m x 15 mm

rol

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

benzi adezive

povestea unei mrci


1930

3RYHVWHD6FRWFKpDQFHSXWQFXXQSURGXV
VLPSOXEDQGDDGH]LY$VW]LEUDQGXO6FRWFKp
SURGXFHRJDPDODUJGHDUWLFROHGHODDGH]LYLOD
EHQ]LGHFRUDWLYH

Prezent i viitor...

03
ACCESORII PENTRU BIROU

([SORUHD]HYROXLDPUFLL6FRWFKpLWHVWHD]FHOH
SHVWHGHXWLOL]ULDOHEHQ]LORUDGH]LYH6FRWFKp.

Descoper evoluia mrcii Scotch

Band dublu adeziv Scotch pentru montare


2PRGDOLWDWHVLPSOGH[DUHLPRQWDUHQSODQYHUWLFDODRELHFWHORU'LQPDWHULDO
VSRQJLRVFXDGH]LYSXWHUQLFUH]LVWODYDULDLLOHGHWHPSHUDWXU,GHDOSHQWUX
RELHFWHQWUHLNJ
Cod
3M151066

Dimensiuni

Unitate de vnzare

1.9 m x 12.5 mm

rol

Poate fi folosit pentru


JUHXWLPLFL

simplu de utilizat pentru montarea n plan vertical a obiectelor

Band dublu adeziv de montaj


%DQGGXEOXDGH]LYSHQWUX[DUHDVLJXULUDSLGDRELHFWHORUSODWHLXRDUH
SHPDMRULWDWHDVXSUDIHHORUQHWGH,GHDOSHQWUXX]LQWHULRU8RUGHDSOLFDW
Cod
TS085650

Dimensiuni

Unitate de vnzare

19 mm x 1.5 m

rol

SUPER
CALITATE

COMAND
SPECIAL

Oricare ar fi meseria ta, avem produsul potrivit.

165

Lipiciuri

Clipsuri

Benzi adezive

Produse de curenie

Pastile
autoadezive

adezivi

Lipici solid
'DFVXQWHLQFXWDUHDXQXLDGH]LYSHUPDQHQWFXDSOLFDUHXRDUSHKUWLH
LSURSULHWLGHOLSLUHUDSLGDWXQFLOLSLFLXULOHVROLGH$SOLVXQWVROXLD,GHDOH
SHQWUXDIRORVLWHDWWODELURXFWLDFDV$GH]LYXO$SOLHVWHXRUGHFXUDWL
QXHVWHWR[LF
10 g

AL001120

20 g

AL001140

40 g

03

Cantitate

ACCESORII PENTRU BIROU

Cod
AL001110

TIAI C?
$SOLH[SRUWSURGXVHQPDL
PXOWGHGHULQMXUXO
OXPLLLQGOLGHUGHSLDQ
multe dintre acestea.

Lipici solid
)UVROYHQWQRQWR[LF/LSHWHKUWLHFDUWRQLIRWRJUDL6HSRDWHIRORVLDWW
ODELURXFWLDFDV/LSLUHDVHIDFHVLPSOXLFXUDWPoate fi folosit pentru lipiri
UDSLGHOLSHWHQPDLSXLQGHGHVHFXQGHCapacul nu permite intrarea
DHUXOXLHYLWQGXVHDVWIHOQWULUHD
Cod
KS873425

8g

Cantitate

KS873427

15 g

KS873372

20 g

KS873340

40 g

Lipici solid Eco


)UVROYHQWSHED]GH393QHWR[LFLODYDELO
,GHDOSHQWUXKUWLHFDUWRQLIRWRJUDL
Cod
AY0001

10 g

Cantitate

AY0002

20 g

AY0003

40 g

CALITATE
PRE

putere mare de lipire, datorit


componenei sale chimice, PVP

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

167

adezivi
3URGXVLQRYDWRUDSOLFULXRDUHLUDSLGH3RVLELOLWDWHDGH
FRQWURODOGR]DMXOXLRIHUSUHFL]LHQDSOLFDUHSUHFXPL
UHDOL]DUHDGHHFRQRPLLVXEVWDQLDOH

Roller adeziv
)DEULFDWGLQSODVWLFWUDQVSDUHQWGHVLJQHUJRQRPLF$GH]LYSHUPDQHQWQUROIU
VROYHQW$SOLFDUHXRDULFXUDW

03
ACCESORII PENTRU BIROU

Cod
KS38101

Dimensiuni

Unitate de vnzare

10 m x 8 mm

bucat

ideal pentru:

lipire ambalaje / carton

lipire hrtie

lipire fotografii

Pastile autoadezive
3DVWLOHDXWRDGH]LYHFXDGH]LYSXWHUQLFUHXWLOL]DELOH$SOLFDUHDVHUHDOL]HD]XRU
FXUDWLDUHORFLQVWDQWQHLQGQHYRLHVDWHSWDLFDDGH]LYXOVVHXVXFH6HSRW
XWLOL]DSHWRDWHVXSUDIHHOHQHWHGHLQGLGHDOHSHQWUXEULFRODMLUHSDUDLLJHQHUDOH
Cod
AL001111

Culoare

AL001112

albastru

alb

Cantitate
75 g
57 g

Pastile autoadezive Glue Dots


%XOLQHDGH]LYHSHUPDQHQWHWUDQVSDUHQWHLQYL]LELOHODDSOLFDUH
5HFRPDQGDWHSHQWUXFRODMH[DUHDSRVWHUHORUVDXDIRWRJUDLORU
8QLWDWHGHYQ]DUHSDVWLOHVHW
Cod
AL001113

lipire fotografii

168

lipire etichete

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

lipire afie

adezivi

Lipici instant
5H]LVWHQWLWUDQVSDUHQWOLSLFLXOSXWHUQLFDOWHVDpDUHRDFLXQHLQVWDQWDQHHLQG
SHUIHFWSHQWUXUHSDUDLL3RDWHXWLOL]DWSHDSURDSHWRDWHWLSXULOHGHPDWHULDOH
,GHDOSHQWUXUHSDUDLLUDSLGHDOHVXSUDIHHORUQHWHGHPLFLUHDOL]HD]OLSLUHUDSLGL
UH]LVWHQW2IHUUH]XOWDWHH[FHOHQWHSHWHUPHQOXQJPXOXPLWQDOWHLUH]LVWHQHOD
IULJLFOGXU
Cod
TS570400

03

Cantitate

ACCESORII PENTRU BIROU

4.5 g

Lipici Gel
$GH]LYJHOLGHDOSHQWUXUHSDUDLLUDSLGHDWWDOHVXSUDIHHORUQHWHGHPLFLFWLDOH
VXSUDIHHORUSRURDVH/LSLUHUDSLGLUH]LVWHQWFXDFLXQHLQVWDQWDQHH
Cod
TS570410

Cantitate
4.5 g

Lipici lichid Glufix


)UVROYHQWOLSHWHRULFHIHOGHKUWLHFDUWRQLWH[WLOH3UHY]XWFXYDOY
DQWLFXUJHUHFHDVLJXURXWLOL]DUHFXUDW/LSLFLXOQXFXUJHGHFWQPRPHQWXO
DSOLFULLRIHULQGXQFRQIRUWVSRULWQXWLOL]DUH
Cod
KS20230

30 ml

Cantitate

KS20220

50 ml

vrf prevzut cu valv anticurgere

utilizare facil, curat

Lipici lichid Eco


7UDQVSDUHQWIUGL]ROYDQWODYDELOLIUPLURV$SOLFDUHXRDUSULQWDPSRQDUH
HVWHLGHDOSHQWUXKUWLHLFDUWRQ3UHY]XWFXDSOLFDWRUFXEXUHWH
Cod
AY0007

Cantitate
50 ml

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

CALITATE
PRE

169

foarfeci

urub reglabil

ACCESORII PENTRU BIROU

03

Foarfec Leitz WOW


&XODPHIDEULFDWHGLQRHOLQR[LGDELOLFDSHWHFXWLWDQIRDUIHFHOH/HLW]:2:VXQW
SUHY]XWHFXPQHUHUJRQRPLFSHQWUXRXWLOL]DUHFRQIRUWDELO0DWHULDOHOHIRORVLWH
ODIDEULFDUHDIRDUIHFHORU/HLW]LFDOLWDWHDJHUPDQDDFHVWRUDDVLJXUGXUDELOLWDWHL
JDUDQLHGHDQL

10
GARANIE

Cod
SL890001
SL890002
SL890003
SL890004
SL890005
SL890006

lame din titaniu

Culoare
mov metalizat
verde metalizat
turcoaz metalizat
albastru metalizat
portocaliu metalizat
roz metalizat

Foarfec Scotch
)RDUIHFDXQLYHUVDO6FRWFKpHVWHIDEULFDWGLQPDWHULDOLQR[LGDELOLQGSUHY]XWFX
XUXESHQWUXUHJODUHDWHQVLXQLLQYHGHUHDXQHLXWLOL]ULRSWLPH
*ULSXOHVWHFRQIRUWDELOSHQWUXRXWLOL]DUHXRDU*DUDQLHDQL
)RDUIHF6FRWFKpDQWLDGHUHQWFXODPUHDOL]DWGLQWLWDQ$FHVWPDWHULDOHVWHGH
FLQFLRULPDLUH]LVWHQWGHFWRHOXOLQR[LGDELO&DUDFWHULVWLFDGHQLWRULHDIRDUIHFLL
FRQVWQIDSWXOFQXVHOLSHWHGHEDQGDDGH]LY3UHY]XWFXPQHUQHJUX
*ULSXOIRDUIHFHORUHVWHHUJRQRPLFLGHDODWWSHQWUXGUHSWDFLFWLSHQWUXVWQJDFL
*DUDQLHSHYLD

10

GARANIE

PE
VIA

3M220003

10

GARANIE

3M220002

GARANIE

Cod
3M220001

Dimensiune

Caracteristici

18 cm

universal, mner rou

3M220002

20 cm

universal, mner rou

3M220003

20 cm

antiaderent

3M220001

GARANIE

BV011102

170

BV011201

BV011202

Foarfec Confort Grip

Foarfec universal

,GHDOSHQWUXX]DWWODELURXFWLDFDV3UHY]XWFX
JULSFRQIRUWDELO/DPHOHVXQWIDEULFDWHGLQRHOLQR[LGDELO

,GHDOSHQWUXXWLOL]ULDWWODELURXFWLDFDV
Caracteristici

Dimensiune

Cod
BV011101

Dimensiuni

Cod
DH040025

16.5 cm

mner din plastic

12.7 cm

BV011102

21 cm

mner din plastic

DH040026

15.2 cm

BV011201

16.5 cm

mner cauciucat

DH040028

20.3 cm

BV011202

21 cm

mner cauciucat

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

cuttere
Cutter
&XWWHUSURIHVLRQDOFDUHDVLJXUUH]XOWDWHH[FHOHQWHQXWLOL]DUH
GDWRULWIRUPHLHUJRQRPLFHOSRLIRORVLIUHIRUW
SUHY]XWFXJKLGDMPHWDOLFDOODPHLFHHDFHLFRQIHUSUHFL]LHLUH]LVWHQ
ODPDGLQRHOLQR[LGDELOQXUXJLQHWHLRIHUWLHULILQH
ODPHOHOHVXQWLQWHUVFKLPEDELOHLVHJPHQWDWHSDUWLLL
VLVWHPXOGHEORFDUHDOODPHLSHUPLWHDMXVWDUHDQIXQFLHGHPRGXOGHXWLOL]DUH
GLVSRQLELOQGLPHQVLXQLDGDSWDWQHYRLORUWDOHGHXWLOL]DUH
Cod
DH010860

Model

Lime lam

mic

9 x 100 mm

DH010870

mediu

9 x 100 mm

DH010875

mare

18 x 100 mm

GARANIE

dou rezerve incluse

03
dou rezerve incluse

Cod
DH010861

Unitate de vnzare

Lime lam

10 bucat/set

9 mm

DH010876

10 bucat/set

18 mm

ACCESORII PENTRU BIROU

Rezerve

Cutter
)DEULFDWGLQSODVWLFFXODPGLQRHOLQR[LGDELO
3UHY]XWFXVLVWHPGHEORFDUHDODPHL
Cod
ED9018

Model

Lime lam

M18

17 x 140 mm

ED9009

M9

15 x 125 mm

SUPER
CALITATE

Rezerve
Cod
ED918

Model

Unitate de vnzare

Lime lam

M18

10 bucat/set

24 mm

ED909

M9

10 bucat/set

15 mm

Cutter cu lam din titan


&XWWHUXO6FRWFKFXODPGLQWLWDQHVWHXQSURGXVYHUVDWLOSHQWUXSURLHFWHDWWODELURX
FWLDFDV/DPDGLQWLWDQIRDUWHDVFXLWWUDWDWWHUPRFKLPLFDIRVWFUHDWSHQWUXD
WLDFXXXULQKUWLDFDUWRQXOLFKLDUSODVWLFXO)LLQGWUDWDWODPDHVWHUH]LVWHQWL
GXUDELO&RUSXOFXWWHUXOXLHVWHDFRSHULWFXXQJULSPRDOHSHQWUXXQFRQIRUWVSRULW
ODPGLQWLWDQFXUH]LVWHQGHRULPDLPDUHGHFWDOWHPDWHULDOH
GXUDELOLWDWHDHVWHGHRULPDLPDUH
VLVWHPGHEORFDUHSHQWUXVLJXUDQ
PDUJLQHDODPHLHVWHIRDUWHDVFXLWPLQLPL]QGHIRUWXOGHSXVODXWLOL]DUH
Cod
3M700050

Model

Lime lam

mic

9 x 100 mm

3M700060

mare

18 x 100 mm

Rezerve
Cod
3M700051

Unitate de vnzare

Lime lam

10 buci/set

9 mm

3M700061

10 buci/set

18 mm

BV011301

Cutter
Cod
BV011301

Caracteristici

Lime lam

mic, in plastic

9 mm

BV011302

mare, in plastic

18 mm

BV011303

mare, in metal, cu grip

18 mm

BV011304

mare, in metal

18 mm

BV011302

BV011303

Rezerve
Cod
BV011401

Unitate de vnzare

Lime lam

10 buci/set

9 mm

BV011402

10 buci/set

18 mm

BV011304

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

171

accesorii prindere
Clipsuri
&OLSVXULPHWDOLFHSHQWUXKUWLHQHJUHFXFOHPQLFKHODW
&OHPHOHSRWQGHSUWDWHSHQWUXRSULQGHUHSHUPDQHQW

ACCESORII PENTRU BIROU

03

Cod
AL011948

Caracteristici

Unitate de vnzare

19 mm

12 buci/cutie

AL011949

25 mm

12 buci/cutie

AL011950

32 mm

12 buci/cutie

AL011951

40 mm

12 buci/cutie

AL011952

50 mm

12 buci/cutie

SUPER
CALITATE

Clipsuri
&OLSVXULPHWDOLFHSHQWUXKUWLHFXFOHPQLFKHODW&OHPHOHGLQQLFKHOVHSRW
QGHSUWDSHQWUXRSULQGHUHSHUPDQHQW

CALITATE
PRE

Cod
RQ017411

Caracteristici

Unitate de vnzare

20 mm

12 buci/cutie

RQ017412

25 mm

12 buci/cutie

RQ017413

32 mm

12 buci/cutie

RQ017414

40 mm

12 buci/cutie

Agrafe pentru birou

SUPER
CALITATE

Cod
AL011713

Caracteristici

Unitate de vnzare

26 mm, zincate

100 buci/cutie

AL011714

32 mm, zincate

100 buci/cutie

AL011715

40 mm, zincate

100 buci/cutie

AL011723

32 mm, colorate

100 buci/cutie

Agrafe pentru birou

CALITATE
PRE

Cod
BV017111

Caracteristici

Unitate de vnzare

25 mm

100 buci/cutie

BV017112

28 mm

100 buci/cutie

BV017113

33 mm

100 buci/cutie

BV017114

50 mm

100 buci/cutie

BV017115

70 mm

50 buci/cutie

BV017121

25 mm, colorate

100 buci/cutie

BV017124

55 mm, colorate

100 buci/cutie

Pioneze
)DEULFDWHGLQPHWDOQLFKHODWLQR[LGDELO
Cod
BV017211

Caracteristici
colorate

Unitate de vnzare
100 buci/cutie

BV017221

zincate

100 buci/cutie

Ace cu gmlie
)DEULFDWHGLQPHWDOQLFKHODWLQR[LGDELO
Cod
BV017311

172

Caracteristici

Unitate de vnzare

28 mm

50 g/cutie

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, www.rtc.ro

accesorii prindere
Buretier cu gel
*HOLQRGRUFHIDFLOLWHD]QXPUDUHDEDQFQRWHORUVDXGRFXPHQWHORUPSLHGLFQG
DOXQHFDUHDGHJHWHORUSHKUWLH6XSRUWGLQSODVWLF&DQWLWDWHPO
Cod
KS000206

SUPER
CALITATE

03
Buretier cu ap

ACCESORII PENTRU BIROU

)DEULFDWGLQSODVWLFFXEXUHWHQLQWHULRU
'LDPHWUXPP
Cod
MP2

Suport Vegas pentru agrafe


'HVLJQPRGHUQIDFHSDUWHGLQJDPD9HJDV0DJQHWLFFXED]FDXFLXFDWFH
PSLHGLFDOXQHFDUHD6HOLYUHD]FXGHDJUDIHLQFOXVH
Cod
DB900005

Culoare
negru

Pentru gama
complet Vegas
consult pagina 152!

Dispenser pentru agrafe


'LVSHQVHUPDJQHWLFIDEULFDWGLQSODVWLFFXGHVLJQPRGHUQ8RUGHQFUFDWHVWH
VROXLDSHUIHFWSHQWUXSVWUDUHDDJUDIHORU6HOLYUHD]PSUHXQFXGHDJUDIH
GHPP
Cod
AL013351

TIAI C?
3URGXFHUHDDJUDIHORUGHELURXGDWHD]GHOD
VIULWXOVHFROXOXLDO;,;OHDDWXQFLFQGSULPHOH
PDLQLDXIRVWGH]YROWDWHVQGRDLHLVWDLH
VUPDGLQRHO)XQFLRQDOLWDWHDDJUDIHLGHELURX
VHED]HD]SHSULQFLSLXOHODVWLFLWLL WHQGLQD
XQXLPDWHULDOVROLGGHDUHYHQLODIRUPDRULJLQDO
GXSFHDIRVWGHIRUPDW 

Suport pentru agrafe


)DEULFDWGLQSODVWLFPDJQHWQSDUWHD
VXSHULRDU&XORDUHQHJUX6HOLYUHD]
IUDJUDIH'LPHQVLXQL[[PP
Cod
RQ092210

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

173

hrtie autocopiativ, tu i tuiere

Hrtie copiativ
+UWLHFRSLDWLYGHFDOLWDWHVXSHULRDUSHQWUXGRFXPHQWHPXOWLSOLFDWH
$OEDVWUXSHQWUXVFULVGHPQ
1HJUXSHQWUXPDLQGHVFULV
)RUPDW$
8QLWDWHGHYQ]DUHFROLWRS

03
ACCESORII PENTRU BIROU

Cod
KS72049

Culoare
albastru

Tu pentru tuier
Culori intense, pentru tampile din cauciuc, fr ulei.
&DQWLWDWHPO
5HFLSLHQWSUHY]XWFXDSOLFDWRU

CALITATE
PRE

Cod
KS71033
KS71023
KS71003

Culoare
negru
rou
albastru

Tu pentru tuier
$VLJXURLPSULPDUHGHFDOLWDWH
&DQWLWDWHPO
5HFLSLHQWSUHY]XWFXSLFXUWRU
Cod
SR2311
SR2401
SR2313

Culoare
negru
albastru
rou

Tuier din plastic


Carcas din plastic. Tuier netuat.
'LPHQVLXQL[FP
Cod
FL910

174

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

tampile i tu
Printer 20
WDPSLOHDXWRWXDQWHXRDUHLFXXQGHVLJQPRGHUQ'LPHQVLXQHDSHUIHFWSHQWUX
FHOHPDLLPSRUWDQWHPHVDMH*HQHUHD]RDPSUHQWGUHSWXQJKLXODU
'LPHQVLXQL[PP
Cod
TO00502

Amprent
Conform cu originalul

ACCESORII PENTRU BIROU

03

nseriator automat
Reiner B6K 6 cifre
$SDUDWUREXVWIDEULFDWGLQRHOVSHFLDOFRQFHSXWV
UH]LVWHQFRQGLLLOHXQHLXWLOL]ULIRDUWHQGHOXQJDWH
)XQFLLOHDSDUDWXOXLSHUPLWQXPHURWULLQVHULHUL
indiferent de numrul de copii ale documentelor.
$VWIHOSHQWUXRIDFWXUQWUHLH[HPSODUHDSDUDWXOVH
poate seta s repete un numr de trei ori, dup care
va continua cu urmtorul numr.
QOLPHFDUDFWHUHPP
5HSHWULFLIU[[[[[[[[[
Cod
TO00201

Minidatier S120

Produs
nseriator

0LQLGDWLHUDXWRWXDQWGLQSODVWLFFXXWLOL]ULPXOWLSOH'HVLJQXO
VXELUHLPRGHUQIDFHWDPSLODPDLPLFLPDLXRUGHIRORVLWGHFW
SURGXVHOHFRPSDWLELOHFRQFXUHQWH)RUPGUHSWXQJKLXODU
Cod
TO00101

nlime dat
PP

Set D.I.Y. Printer 30


&UHHD]LVLQJXUWDPSLOD
,GHDOHSHQWUXH[LELOLWDWHDORUSRLUHDOL]DVDXVFKLPEDWDPSLODQWUXQWLPSIRDUWH
VFXUWFXOHJQGFXDMXWRUXOSHQVHWHLFDUDFWHUHOHVDXSLFWRJUDPHOHLQFOXVHQSDFKHW
'LPHQVLXQHDPSUHQW[PP
1XPUPD[LPGHOLQLL
QOLPHDFDUDFWHUHORUPP
Cod
TO00401

Tu pentru tampile
&UHDWVSHFLDOSHQWUXWXLHUHOH&RORS5HFLSLHQWSUHY]XWFXDSOLFDWRU&DQWLWDWHPO
Cod
TO00301

albastru

Culori

TO00302

violet

TO00303

negru

TO00304

rou

TO00305

verde

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

175

VARICOLOR
VARICOLOR
  
        

   
      
 
    
   

 
            !"#$%$"  
&   
       '( 

4. Instrumente de scris i corectur


instrumente de scris

178

markere speciale

200

instrumente de scris Parker

179

markere permanente

202

instrumente de scris Senator

180

textmarkere

208

rollere

182

creioane mecanice

210

linere

189

creioane i rezerve

211

pixuri cu mecanism

190

corectoare

212

pixuri fr mecanism

194

fluide corectoare

214

markere pentru tabl

196

ascuitori, radiere i rigle

216

markere pe baz de vopsea

199

instrumente de scris

SFATUL SPECIALISTULUI
TIPURI DE INSTRUMENTE DE SCRIS

Stilouri i pixuri

04

Textmarkere

INSTRUMENTE DE SCRIS I CORECTUR

4 tipuri de scriere
Cu peni

Rollere

Instrumente
de scris clasice
pentru ocazii
oficiale.

Instrumente
de scris
de ultim
generaie
cu design
deosebit,
pentru calitate
i rapiditate.

2 tehnologii

Cu vrf din
fetru
Instrumente
de scris pentru
o linie de
scriere subire.

Cu bil

1. Cerneal lichid i nivel vizibil al


cernelei

Instrumente
de scris
indispensabile
pentru fiecare zi.
Pot fi cu gel sau
standard.

Avantaje: scriere lin, foarte fluid, culori vesele,


debit i intensitate constant, utilizabil pn la
ultima pictur de cerneal (dac este inut n
poziie vertical).

2. Standard: fetru mbibat cu cerneal


Avantaje: economie, textmarkerul standard
se pstreaz n poziie orizontal pentru o mai
bun utilizare.

Cte ceva despre produse:


- ergonomie: este dat de design, corp subire sau gros
- grip: pentru o mai bun prindere
- vizibilitate nivel cerneal: permite evitarea unei pene de cerneal
Pentru precizie se recomand instrumente de scris cu vrf needle point.
Pentru rezisten se recomand instrumente de scris cu vrf conic.

3 tipuri de cerneal pentru 3 senzaii diferite:


Cerneal standard

Cerneal gel

Creioane grafit

Cerneal lichid

tiai c?
fluiditate redus

fluiditate sporit

- cerneal lichid: fluiditate i urm de scris constant, dens i luminoas. Durabilitate n timp i scriere
ultra alunecoas.
- cerneal gel: senzaie plcut i confortabil. Varietate de culori, senzaie de alunecare n timpul scrierii.
- cerneal standard: numit de cele mai multe ori past. Fabricat pe baz de ulei. Este recomandat
pentru documentele ce urmeaz a fi copiate uscare foarte rapid.

Grosimea vrfului
tiai c exist o diferen ntre grosimea vrfului i urma pe care acesta o las?
De exemplu, un vrf de 0.5 mm las o urm de scriere de 0.3 mm. Totui, aceasta depinde foarte mult
de modul dumneavoastr de scriere (nclinaia, intensitatea i presiunea exercitat asupra vrfului), de
tipul instrumentului de scris i de tipul de hrtie utilizat (mai mult sau mai puin absorbant). Pe tot
parcursul capitolului, v vom informa cu privire la grosimea vrfului fiecrui instrument de scris.

Minele creioanelor sunt clasificate n funcie de


2 caracteristici?
H hardness (duritate)
B blackness (intensitate negru)
Cu ct cifra care precede caracteristica este mai
mare, cu att aceasta este mai puternic.

Duritate 2H min dur, se terge foarte uor.


Duritate HB compromisul ideal ntre
duritatea minei i intensitatea culorii (negrului)
a urmei de scriere.
Duritate B (B, 2B) min moale de un negru intens.

Markere - varietate de vrfuri


Nepermanente

Permanente

Pentru table
de conferine

Pentru
flipchart

Cerneala se
usuc rapid
i poate fi
tears uor.

Cerneal pe
baz de ap,
nu ptrunde
n hrtie.

Speciale

Industriale

Cu vopsea

Multifuncionale

Markere
pentru pictur
sau pentru
decorare.
Markere
pentru CD i
DVD.

Cerneala pe
baz de solvent
sau alcool pur
ofer un marcaj
definitiv, corpul
din metal ofer
o excelent
pstrare a
cernelei.

Markerele pe
baz de vopsea
sunt cele mai
utilizate n
domeniul
industrial, dar
pot fi folosite
cu succes
pentru hobbyurile fiecruia.

Instrumente de
scris indispensabile
pentru fiecare zi.
Pot fi folosite n
scopuri multiple.

Pstrarea markerelor:

2 tipuri de vrfuri

Markerele se pstreaz n poziie orizontal (cu excepia celor cu cerneal lichid


i a celor pentru pictur i decorare). Dac sunt inute cu vrful n jos, concentraia
excesiv de pigment face ca urma de scriere s fie dificil de ters la markerele
pentru tabl. Dac sunt inute cu vrful n sus este posibil ca acesta s se usuce.

178

Vrf teit
limea liniei de scriere
este diferit n funcie de
orientarea vrfului

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Vrf rotund
limea liniei de scriere
este constant

instrumente de scris Parker

De ce Parker...
Ca s poi rspunde la ntrebarea aceasta, trebuie mai nti s tii rspunsul la ntrebarea Cine este Parker?
Parker este firma fondat n 1888 de cel al crui crez era: F ceva mai bun i oamenii l vor cumpra!
Parker este firma care a rmas de-a lungul timpului credincioas acestui principiu, devenind, din 1962, furnizorul de
instrumente de scris al Casei regale britanice.

Instrumentele de scris Parker sunt cadouri de lux perfecte pentru cei pe care i preuieti sau, de ce nu, chiar pentru tine!

Pentru toate aceste motive ndrznim s-i recomandm s achiziionezi stilouri i pixuri Parker.

Vector
Clipul n form de sgeat este elementul distinctiv al acestei game. Stiloul are
peni din oel inoxidabil, cu vrf fin. Alimentare cu patroane Quink sau convertor
standard. Pix cu mecanism acionat prin apsare. Rezerv Parker. Accesorii cromate.
Cod
WM04207

Tip

Culoare

stilou

inox

WM44651399

pix

inox

WM4468211

stilou

negru

WM4468231

pix

negru

WM4468212

stilou

rou

WM4468232

pix

rou

WM4468213

stilou

albastru

WM4468233

pix

albastru

INSTRUMENTE DE SCRIS I CORECTUR

04

Un Parker nu este un simplu stilou sau un pix de duzin


- este o inovaie: un numr impresionant de patente stau la baza fabricrii unui stilou Parker sau a unui pix Parker;
- este ajutorul perfect pentru a semna att contractul de milioane, ct i bileelul cu te iubesc pe care-l lai persoanei
dragi cnd eti plecat;
- este acel accesoriu care poate completa fericit att o inut elegant, ct i una modern, la urma urmei este un statut
social.

GARANIE

Jotter
Jotter este cea mai popular gam a instrumentelor de scris Parker, recunoscut n
toat lumea pentru funcionalitatea sa. Stiloul are peni din oel inoxidabil, cu
vrf fin. Alimentarea se realizeaz cu patroane Quink sau convertor standard.
Pix cu mecanism acionat prin apsare. Rezerv Parker, de culoare albastr.
Cod
WM44851199

Tip

Model

Finisaj

stilou

inox

inox

WM44851399

pix

inox

inox

WM44871321

pix

special

lac negru

WM44871341

pix

special

lac albastru

WM44871371

pix

special

lac rou

GARANIE

Rezerv Standard
Rezerv pentru pix.
JURVLPHYUIPP Q PP PHGLX
Cod
WM46699332

Vrf

Culoare

fin, standard

albastru
albastru

WM46699333

mediu, standard

WM21020

fin, cu gel

negru

WM21040

mediu, cu gel

albastru

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

179

instrumente de scris Senator

povestea unei mrci


Senator reprezint idei i produse diferite. Aceasta a fost viziunea lui Friedrich Merz cnd
a fondat compania Merz&Krell n anul 1920, mpreun cu fratele su Georg i strungarul
Justus Krell. Fosta companie de artizanat pentru suporturi de penie din lemn, creioane i
stilouri, a devenit cu timpul unul dintre cei mai importani productori din lume.
Noi, n Senator, suntem angajai n afacerea cu instrumente de scris nc din 1920 i iubim
ceea ce facem! Senator este o companie de origine german, cu experien n producie de
aproape 100 de ani i un lider de pia. n 2014, Senator a servit clieni n 88 de ri, fiind
astfel unul dintre furnizorii cu cea mai vast experien internaional. Cu standarde nalte
att n producie ct i n aprovizionare, ne asigurm clienii c produsele sunt minuios
proiectate i fabricate cu mult know-how, astfel nct s ndeplineasc cerinele stabilite
de ctre instituii externe, dar i de ctre propriul departament de calitate - laboratorul
Senator testeaz toate produsele pentru a le garanta calitatea. Pretenia Senator nu este de
a nteprinde lucruri ordinare, ci s fie ntotdeauna extraordinari.

INSTRUMENTE DE SCRIS I CORECTUR

04

President
Stilou cu piston, de nalt clas - o adevrat capodoper a miestriei germane
pentru ocazii foarte speciale. Precizie la detaliu, cu materiale fine, accesorii aurite i
finisaje ce transmit conotaii de cea mai nalt stim.
Peni cu vrf din iridium i sistem de alimentare cu piston. Corp fabricat din metal
dur, cu accesorii aurite, livrat n cutie cadou.
Cod
SE002512

Putei personaliza corpul adugnd iniialele


dumneavoastr, prin tehnologia laserprint.

Carbon Line
Set cu design modern, high-tech, compus din dou piese cu corpul din metal,
combinat cu fibr de carbon. Stilou cu peni cu vrf de iridium (mediu) i sistem de
alimentare cu patron. Pix prevzut cu mecanism acionat prin rsucire i cu rezerv
tip Parker de culoare albastr. Cutie de cadou individual inclus.
Cod
SE6239

Tip
set pix i stilou

personalizare prin tampografie (H),


gravur mecanic (I) sau gravur laser (J)

Peni din iridium.


Vrf metalic.

Clip metalic rezistent.

180

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

instrumente de scris Senator


Tizio
Gam clasic ce mbin tradiionalul cu modernul. Instrumente de scris din metal,
crom lucios n partea superioar, n combinaie cu lemn de nuc.
Stilou cu peni din oel inoxidabil i vrf din iridium, mediu.
Roller cu rezerv metalic, de mare capacitate, culoarea scrierii: albastru.
Pix cu mecanism acionat prin rsucire i rezerv metalic tip Parker, de culoare
albastr. Cutie cadou pentru set.

04

Tip
set pix i stilou

personalizare prin gravur mecanic (I) sau gravur laser (J)

Image Line
Gam clasic, linii bine conturate. Instrumente de scris metalice, acoperite cu straturi
de lac superior negru i accesorii cromate. Stilou cu peni din oel inoxidabil i vrf
din iridium, mediu. Roller cu rezerv metalic, de mare capacitate, culoarea scrierii:
albastru. Pix cu mecanism acionat prin rsucire i rezerv metalic tip Parker, de
culoare albastr. Cutie cadou pentru set.
Cod
SE800040

Tip

Culoare

set pix i stilou

negru

SE800041

set pix i stilou

alb

INSTRUMENTE DE SCRIS I CORECTUR

Cod
SE800080

personalizare prin gravur mecanic (I), gravur laser (J) sau tampografie (H)

Delgado
Instrumente de scris cu design modern i corp din metal. Pix cu mecanism acionat
prin apsare i rezerv tip Parker, de culoare albastr.
Cod
SE2241

Tip

Finisaj

Accesorii

pix

gri mat

crom

SE2242

pix

argintiu

crom

SE2803

pix

argintiu

auriu

SE2804

pix

negru mat

auriu

personalizare prin tampografie (H), gravur laser (J) sau gravur mecanic (I)

Oricare ar fi meseria ta, avem produsul potrivit.

181

rollere

povestea unei mrci


Compania este fondat n 1946 n Japonia, sub numele de The Japan Stationery, prin reorganizarea unui magazin care vindea
pensule i vopsea. tiind c educaia reprezint unul din factorii dezvoltatori ai Japoniei, Pentel ncepe producia i comercializarea
produselor colare, cum ar fi acuarele i creioane. Produsele Pentel i Pentel Water Colors
sunt distribuite n ntreaga Japonie, asigurnd astfel succesul companiei.
De-a lungul anilor, Pentel s-a dezvoltat masiv, deschiznd filiale i puncte de producie
n mai multe ri, fabricnd o gam vast de intrumente de scris inovatoare, toate avnd
ncorporat tehnologia japonez. Una dintre tehnologiile inventate de Pentel este cea a
markerului nepermanent, precum i a creionului mecanic cu min de 0.3 mm pentru care
obine premiul Deming.

04
INSTRUMENTE DE SCRIS I CORECTUR

Numele companiei vine de la combinarea a dou cuvinte: pen (stilou) i tell (poveste)
adic povestea stiloului, produsele Pentel beneficiind la ora actual de o important
recunoatere internaional.

Roller Energel
0.5

0.7

Roller cu mecanism, corp din plastic cu finisaj metalic, prevzut cu grip i clip de
prindere metalic.
JULSFDXFLXFDWYUIPHWDOLF
JURVLPHYUIPPPPQHHGOHSRLQW
OLQLHGHVFULHUHPP
OXQJLPHGHVFULHUHP
Cod

Grosime
vrf

Linie de scriere

Lungime de
scriere

Culoare

PE101210

0.5 mm

0.25 mm

900 m

negru

PE101211

0.5 mm

0.25 mm

900 m

rou
albastru

PE101212

0.5 mm

0.25 mm

900 m

PE101200

0.7 mm

0.35 mm

550 m

negru

PE101201

0.7 mm

0.35 mm

550 m

rou

PE101202

0.7 mm

0.35 mm

550 m

albastru

Roller Energel X

0.5

0.7

182

Roller cu mecanism, corp din plastic n culoarea minei, grip cauciucat pentru un
scris confortabil i clip de prindere rezistent.
YUIPHWDOLF
JURVLPHYUIPPPPQHHGOHSRLQW
OLQLHGHVFULHUHPP
OXQJLPHGHVFULHUHP
Cod

Grosime
vrf

Linie de scriere

Lungime de
scriere

Culoare

PE101230

0.5 mm

0.25 mm

900 m

negru

PE101231

0.5 mm

0.25 mm

900 m

rou

PE101232

0.5 mm

0.25 mm

900 m

albastru

PE102170

0.7 mm

0.35 mm

550 m

negru

PE102171

0.7 mm

0.35 mm

550 m

rou

PE102172

0.7 mm

0.35 mm

550 m

albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

rollere

Roller Energel

Cod
PE101110

Grosime vrf

Lungime de scriere

Culoare

0.5 mm

1.500 m

negru

PE101111

0.5 mm

1.500 m

rou

PE101112

0.5 mm

1.500 m

albastru

PE101100

0.7 mm

1.200 m

negru

PE101101

0.7 mm

1.200 m

rou

PE101102

0.7 mm

1.200 m

albastru

0.5

04

0.7

Roller Energel Tradio


Roller fr mecanism, corp din plastic, capac cu clip de prindere, grip cauciucat.
YUIPHWDOLF
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Cod
PE101500

Grosime vrf

Linie de scriere

Culoare

PE101501

0.5 mm

900 m

negru

0.5 mm

900 m

PE101502

rou

0.5 mm

900 m

albastru

PE101600

0.7 mm

550 m

negru

PE101601

0.7 mm

550 m

rou

PE101602

0.7 mm

550 m

albastru

0.5

INSTRUMENTE DE SCRIS I CORECTUR

Roller fr mecanism, corp din plastic cu finisaj metalic, prevzut cu grip i capac
cu clip de prindere metalic.
JULSFDXFLXFDW
YUIPHWDOLFQHHGOHSRLQW
JURVLPHYUIPP
OXQJLPHGHVFULHUHP

0.7

Stilou Tradio
Corp cu finisaje tip imitaie piele. Peni din iridium.
Rencrcabil cu patroane standard.
Cod
PE101700

Culoare corp
rou

PE101701

negru

PE101702

caramel
0.7

Rezerv Energel
Rezerv pentru rollerele cu mecanism.
JURVLPHYUIPP

Cod
PE101000

Grosime vrf

Culoare

0.5 mm

negru

PE101001

0.5 mm

rou

PE101002

0.5 mm

albastru

PE101010

0.7 mm

negru

PE101011

0.7 mm

rou

PE101012

0.7 mm

albastru

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

183

rollere

povestea unei mrci

INSTRUMENTE DE SCRIS I CORECTUR

04

nfiinat n 1855 ca o mic fabric de creioane n localitatea german Nrnberg, numele de Stabilo este
sinonim cu stilou pentru majoritatea tinerilor din noua generaie. n 1865 compania a fost cumprat de ctre
familia Schwanhaer, care asigur stabilitate financiar i continu activitatea de producie. De numele
proprietarilor este legat i sigla companiei, reprezentnd prescurtarea numelui de familie, schwan, care n
limba german nseamn lebd.
Stabilo devine unul din productorii de top de creioane, participnd la o expoziie cu un creion impresionant,
nalt de 30 de metri, fapt care sugera succesul financiar nregistrat. Preluat de cei doi fii ai lui Gustav A. Schwanhaer, Stabilo
scoate pe pia n 1909 un produs spectaculos i anume primul creion pentru ochi (Dermatograph) conceput special pentru
chirurgi. Succesul este impresionant, deschiznd drumul produselor cosmetice. n timpul celui de-al doilea Rzboi Mondial
firma este distrus i se relanseaz dup civa ani, moment n care se ia decizia de a produce i intrumente de scris pe baz de
cerneal. Sub conducerea celei de-a patra generaii i cu peste 100 de ani de experien, se nate ideea unui instrument de scris
UHYROXLRQDUWH[WPDUNHUXOFXFHUQHDOIRVIRUHVFHQWODQVDWQVXEQXPHOHGH6WDELOR%RVV'HDOXQJXODQLORU6WDELORVH
dezvolt constant i i mbogete gama cu produse inovatoare i design deosebit.

design nou

Roller Bionic
Roller high-tech, cu cerneal de cea mai bun calitate, creat de Stabilo special
pentru utilizatori pretenioi, oferindu-le n timpul scrierii un confort sporit, la
standarde nalte.
Vrful perfect sferic i indestructibil, garanteaz precizie maxim, rollerul
alunecnd lin pe hrtie, fr s zgrie. Zona de prindere prevzut cu grip moale,
corpul translucid, n culoarea scrierii i fereastra ce permite verificarea nivelului
de cerneal, fac din noul roller Stabilo Bionic unul dintre cele mai aspectuoase i
confortabile instrumente de scris, cu un stil contemporan.
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
lungime de scriere: 3.000 m

SUPER
CALITATE

0.4

Recomandat profesionitilor cu standarde nalte


cu privire la calitatea documentelor redactate.

Cod
SW152011
SW152012
SW152013
SW152014

Culoare
negru
rou
albastru
verde

Roller Bionic Worker Colorful


Recomandat utilizatorilor profesioniti ori celor ce doresc s-i mbunteasc
abilitile de scriere, cu un raport excelent calitate-pre. Este fabricat din
materiale de cea mai bun calitate, cu cerneal inovatoare ce asigur un scris
extrem de lin i precis indiferent de tipul de hrtie pe care este folosit.
Corpul este prevzut cu grip moale pe toat lungimea acestuia, asigurnd astfel
un control maxim n timpul folosirii. Rollerul Bionic Worker este ideal att pentru
studeni, ct i pentru profesionitii ce se bazeaz pe un instrument de scris de
ncredere.
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
design nou

184

grip fin pe tot corpul

0.5

Cod
SW201841

Culoare

SW201842

rou

SW201843

albastru

SW201844

verde

negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

www.stabilo.com

rollere

Roller Hybrid Gel Grip


Roller fr mecanism, corp din plastic, capac cu clip de prindere.
JULSFDXFLXFDW
YUIPHWDOLF
JURVLPHYUIPP
OLQLHGHVFULHUHPP
OXQJLPHGHVFULHUHP

04
INSTRUMENTE DE SCRIS I CORECTUR

0.6

Cod
PE102130

Culoare

PE102131

rou

PE102132

albastru

negru

Roller Crystal Jelly


Roller fr mecanism, corp din plastic, prevzut cu grip i capac cu clip de prindere.
YUIPHWDOLF
JURVLPHYUIPP
Cod
ED21851

Culoare

ED21852

rou

ED21853

albastru

ED21854

verde

ED218553

auriu

ED218554

argintiu

negru

Datorit cernelei metalizate este ideal pentru personalizarea


felicitrilor, cadourilor, oferind un plus de stil i atractivitate.
SUPER
CALITATE

0.7

CALITATE
PRE

Roller Office 85
Roller cu cerneal pe baz de ap, potrivit i pentru hrtie copiativ. Corp din
plastic. Capacul este prevzut cu clip de prindere.
FHUQHDOSHED]GHDS
YUIPHWDOLF
JURVLPHYUIPP
Cod
ED85001

0.5

Culoare
negru

ED85002

rou

ED85003

albastru

ED85004

verde

Roller seria 1000


Roller cu cerneal care folosete tehnologia german free-ink, ce i ofer o
adevrat plcere n timpul scrierii. Corp din plastic, mat, cu accesorii cromate.
Tehnologia free-ink permite verificarea nivelului de cerneal, evitnd riscul de a
rmne fr n timpul scrierii. Mai mult, tehnologia permite o scriere lin, constant
i fin datorit ncperii ce echilibreaz nivelul de cerneal cu care se alimenteaz
vrful. Cerneal lichid, ce se usuc rapid.
JURVLPHYUIPP

CALITATE
PRE

186

0.7

alimentare free-ink

Cod
SE000201

Culoare

SE000202

negru

SE000203

rou

albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

rollere
Roller Edding Gel 2190
Roller cu mecanism, corp din plastic transparent, prevzut cu clip de prindere.
JULSFDXFLXFDW
FHUQHDOSHED]GHDS
YUIPHWDOLF
JURVLPHYUIPP
Cod
ED21901

Culoare
negru
rou

ED21903

albastru

ED21904

set 4 culori

0.7

Roller WOW Gel


Roller cu mecanism, corp din plastic n culoarea minei, grip cauciucat pentru un
scris confortabil i clip de prindere rezistent.
YUIPHWDOLF
JURVLPHYUIPP
Cod
PE101240

Culoare

PE101241

rou

PE101242

albastru

04

SUPER
CALITATE

INSTRUMENTE DE SCRIS I CORECTUR

ED21902

negru

0.7

Pix cu gel seria 5000


Destinat scrierii fine, constante, de lung durat. Grip cauciucat i accesorii din
plastic satinat, corp n culoarea scrierii, cu cerneal rezistent la UV.
JURVLPHYUIPP
Cod
SE000301

Culoare

SE000302

negru

SE000303

rou

albastru
0.7
CALITATE
PRE

Pix cu gel seria 1000


Pix cu gel, fr mecanism, corp de plastic n culoarea scrierii, design inovator n
patru culori moderne. Corpul este cauciucat, evitnd astfel alunecarea n timpul
scrierii. Cerneal rezistent la razele UV.
JURVLPHYUIPP
Cod
SE000701

Culoare

SE000702

negru

SE000703

rou

albastru

0.7
CALITATE
PRE

TIAI C?
n anul 2014, Senator a vndut mai mult de
235,4 milioane de instrumente de scris.
O cifra extraordinar, pentru c dac am aeza
produsele unul lng altul, atunci ar rezulta o
distana de 35,311 kilometri - aproape nconjurul
lumii?

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

187

rollere

INSTRUMENTE DE SCRIS I CORECTUR

04

Liner edding 68
Liner cu corp din plastic, vrf din plastic, cerneal pigmentat, rezistent la ap i
la lumin. Tehnologie free-ink a cernelei, rezervor de mare capacitate. Ideal pentru
semnarea documentelor. Capac n culoarea scrierii.
YUIGLQSODVWLF
JURVLPHYUIPP

0.4

Cod
ED68001

Culoare

ED68002

rou

ED68003

albastru

ED68004

verde

SUPER
CALITATE

negru

TIAI C?
Cel mai mare pix a fost creat n India, de ctre
Acharya Makunuri Srinivasa? Are 5,5 metri
OXQJLPHLRJUHXWDWHGHNLORJUDPH
Corpul su este gravat cu scene din mitologia
indian?

Pix cu gel
Corp transparent, capac cu clip de prindere n culoarea scrierii.
FHUQHDOJHO
YUIPHWDOLF
JURVLPHYUIPP

0.7

188

Cod
LW030311

Culoare

LW030312

rou

LW030313

albastru

negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

linere
Liner Office 89
Liner pentru scriere fin. Capac n culoarea cernelei, prevzut cu clip de prindere.
YUIGLQIHWUXQFDVWUDWQPHWDO
FHUQHDOSHED]GHDS
JURVLPHYUIPP
Cod
ED891

Culoare

ED892

rou

ED893

albastru

negru

ED893000

04
0.3

set 3 culori

INSTRUMENTE DE SCRIS I CORECTUR

SUPER
CALITATE

Liner Point 88
Linerul numrul 1 n Europa - special creat pentru studeni i profesioniti, ideal
pentru a-l folosi mpreun cu rigle i saboane, vrful de 0.4 mm fiind ncastrat
n metal, prevenind astfel ruperea. Design hexagonal, dungat, recunoscut
peste tot n lume. Cerneala se usuc rapid, asigurnd astfel un scris curat, fr
murdrie. n schimb, lsat fr capac vrful se usuc foarte greu.
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Cod
SW168811

negru

SW168812

rou

linerul numrul 1 n Europa!

0.4

Culoare

SW168813

albastru

SW168814

verde

SW168806

set 6 culori

SW168810

set 10 culori

disponibil n 30 de culori vibrante

Liner seria 1000


Fineliner cu un corp clasic, hexagonal, cu dungi. Ideal pentru a fi utilizat cu rigle sau
abloane. Capac ventilat conform normelor europene de siguran, corp n culoarea
scrierii.
FHUQHDOSHED]GHDS
YUIGLQIHWUXQFDVWUDWQPHWDO
JURVLPHYUIPP
Cod
SE000401

Culoare

SE000402

negru

SE000404

rou

albastru

SE000407

verde deschis

0.4
CALITATE
PRE

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

189

pixuri cu mecanism

Pix Leitz Stylus Pro Presenter


Multifuncional: control PC wireless, indicator laser pentru prezentri, pix rencrcabil
i vrf din silicon pentru ecran tactil. Sistem plug-and-play pentru Windows i Mac,
QXQHFHVLWVRZDUH3L[GHFDOLWDWHFHUQHDOQHDJU UH]HUYWLS'OXQJLPHPP 
UHFHSWRU86%QLQWHULRUXOFDSDFXOXLDSDVLJOLVHD]
EXWRDQHSHQWUXFRQWUROSDJLQVXVMRVLLQGLFDWRUODVHU
LQGLFDWRUODVHUURXSHUIHFWSHQWUXPDUFDUHQFDGUXOSUH]HQWULL
YUILQWHUVFKLPEDELOSHQWUXGLVSR]LWLYHFXHFUDQWDFWLO
UD]GHDFLXQHSQODP

INSTRUMENTE DE SCRIS I CORECTUR

04

receptor USB retractabil inclus n capac

indicator laser

Cod
SL647701

Culoare

SL647702

negru

alb

vrf pentru touch screen

Pix multifuncional Leitz Stylus 4 n 1


Rencrcabil, dotat cu indicator laser pentru prezentri, vrf pentru touch screen i
lantern LED integrat. Evitai lsarea amprentelor, zgrierea i murdrirea ecranului
cu ajutorul vrfului de silicon. Raza de aciune a indicatorului laser ajunge pn la
100 m. Include baterii.

lantern led

indicator laser

Cod
SL641401

Culoare

SL641402

negru

pix rencrcabil

alb

vrf pentru touchscreen

Pix cu mecanism 4 n 1

0.7

Pix cu 4 culori de scriere ntr-un singur instrument, cu butoane n culoarea minei


alese (albastru, rou, verde, negru). Clip rezistent i grip confortabil. Corp din plastic
cu finisaj metalic, cerneal ce permite o scriere fin.
YUIPHWDOLF
JURVLPHYUIPP
Cod
SE000131

CALITATE
PRE

Pix Tikky III


Design clasic i ergonomic, corp din plastic rezistent, accesorii metalice. Rezerv tip
Parker, de culoare albastr.
JULSFDXFLXFDW
YUIPHWDOLF
JURVLPHYUIPP

0.8

190

Cod
RO033210

Culoare

RO033211

alb

RO033213

albastru

RO033216

rou

negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

pixuri cu mecanism
Pix cu mecanism seria 5000
Pix cu mecanism, corp metalic, design elegant, accesorii cromate, rezerv tip Parker,
GHPDUHFDSDFLWDWHWHKQRORJLHJHUPDQDFHUQHOHLFHUWLFDW,62DPEDODW
individual n cutie de carton. Culoare de scriere: albastru.
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Culoare

SE000503

negru

SE000504

gri

albastru

04

CALITATE
PRE

personalizare prin tampografie (H) sau gravur laser (J)

0.7

Pix Point Classic


Corp din plastic, cu accesorii metalice. Rezerv tip Parker, de culoare albastr.
FOLSPHWDOLFGHSULQGHUH
YUIPHWDOLF
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Cod
SE25740

Culoare

SE25741

negru

SE25742

bordo

0.8

alb

SE25743

albastru

SE25744

verde

CALITATE
PRE

INSTRUMENTE DE SCRIS I CORECTUR

Cod
SE000502

personalizare prin serigrafie (A)

Pix cu mecanism seria 1000


Pix cu mecanism acionat prin apsare, cu arc, corp semitransparent, n culoarea
FHUQHOHLJULSFRQIRUWDELOWHKQRORJLHJHUPDQDFHUQHOHLFHUWLFDW,62
YUIPHWDOLF
JURVLPHYUIPP
Cod
SE000601

Culoare

SE000602

negru

SE000603

rou

SE000604

verde

albastru

0.7

Pix Dart
Pix din plastic, corp rotund, cu clip, mecanism acionat prin apsare.
Rezerv X20, albastr.
YUIGLQRHOLQR[LGDELO
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Cod
SE26000

Culoare

SE26003

albastru

alb

personalizare prin serigrafie (A)

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

191

pixuri cu mecanism

Pix BK-437
Pix retractabil, avnd corp din plastic transparent, clip de prindere i grip
triunghiular ergonomic n culoarea minei.
JULSFDXFLXFDW
JURVLPHYUIPP
OLQLHGHVFULHUHPP

INSTRUMENTE DE SCRIS I CORECTUR

04

Cod
PE103220

Culoare

PE103221

rou

PE103222

albastru

negru

0.7

Pix BK-417
Pix retractabil, avnd corp din plastic transparent, clip de prindere i grip
triunghiular ergonomic n culoarea minei.
OLQLDGHVFULHUHHVWHFODUFXUDWGHHFDUHGDW
FRUSXOVOLPFXJULSFRQIRUWDELORIHUSL[XOXLXQDVSHFWSOFXW
JURVLPHYUIPPOLQLHGHVFULHUHGHDSUR[LPDWLYPP
LGHDOSHQWUXDXWLOL]DWDWWODELURXGDULDFDVVDXODFRDO

0.7

Cod
PE417001

Culoare

PE417002

rou

PE417000

albastru

negru

Pix Liner 308


Corp semitransparent n culoarea minei, prevzut cu clip integrat corpului.
Retractabil, design ergonomic.
YUIGLQRHOLQR[LGDELO
JURVLPHYUIPP
OXQJLPHGHVFULHUHP

0.38

CALITATE
PRE

192

Cod
SW3081

Culoare

SW3082

rou

SW3083

albastru

negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

pixuri fr mecanism

Pix Ink Joy


Pix fr mecanism, corp din plastic transparent, capac cu clip de prindere n culoarea
minei. Funcionalitate sporit datorit sistemului inteligent de scriere Inkjoy, pentru
o utilizare fr efort. Cerneala curge uor, necesitnd astfel o presiune minim a
minii utilizatorului.
YUIPHWDOLFPPOLQLHGHVFULHUHGHDSUR[LPDWLYPP
OLQLDGHVFULHUHHVWHFODUFXUDWGHHFDUHGDW
FRUSXOWULXQJKLXODURIHUFRQIRUWLFRQWURO

04
INSTRUMENTE DE SCRIS I CORECTUR

Cod
PP000102

Culoare

PP000103

rou

PP000101

albastru

negru

Pix Excel 828


Corp din plastic de culoarea minei, design ergonomic i capac ventilat.
FDSDFFXFOLSGHSULQGHUH
YUIGLQRHO
JURVLPHYUIPP

0.38

Cod
SW148281

negru

Culoare

SW148282

rou

SW148283

albastru

Pix Liner 808


Corp din plastic de culoarea minei, design ergonomic.
FDSDFYHQWLODWFXFOLSGHSULQGHUH
YUIGLQRHO
JURVLPHYUIPP

0.38
CALITATE
PRE

Cod
SW148081

Culoare

SW148082

rou

SW148083

albastru

negru

Pix transparent
Pix fr mecanism, corp din plastic transparent, capac cu clip de prindere n culoarea
minei.
YUIPHWDOLF
JURVLPHYUIPP

0.4

194

Cod
LW030101

Unitate de vnzare

Culoare

cutie (12 buci)

albastru

LW030102

cutie (12 buci)

rou

LW030103

cutie (12 buci)

negru

LW030111

cutie (50 buci)

albastru

LW030112

cutie (50 buci)

rou

LW030113

cutie (50 buci)

negru

LW030120

10 buci/set (4 albastre, 4 negre, 2 roii)

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

pixuri fr mecanism

Pix SuperbG
Corp din plastic, n culoarea scrierii, clip de prindere pe capac.
JULSFDXFLXFDW
JURVLPHYUIPP
OLQLHGHVFULHUHPP
Cod
PE103100

Culoare

PE103101

rou

PE103102

albastru

04
INSTRUMENTE DE SCRIS I CORECTUR

negru

0.7

Pix Stick Pen


Pix fr mecanism, corp alb, semitransparent, cu design frosty. Capac n culoarea
scrierii, tehnologie german a cernelei.
JURVLPHYUIPP
Cod
SE000101

Culoare

SE000102

negru

SE000103

rou

SE000104

verde

albastru

0.7
CALITATE
PRE

Pix cu suport
Pix din plastic, cu suport autoadeziv. Min n culoarea inelului i a suportului.
YUIGLQRHO
JURVLPHYUIPP
Cod
LW030141

Culoare

LW030142

albastru

negru
0.7

Rezerv tip Parker


Rezerv pentru pix. Lungime: 98 mm. Grosime vrf: 0.8 mm.

Cod
RQ049211

Tip

Culoare

plastic

negru
albastru

RQ049212

plastic

RQ049221

metal

negru

RQ049222

metal

albastru

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

195

markere pentru tabl


Marker pentru tabl TZ140
Se folosete att pentru scrierea pe tabl, ct i pe hrtia de flipchart sau
plannere.
YUIURWXQG
JURVLPHYUIPP
VHWFXORULQHJUXURXDOEDVWUXYHUGH
Cod
PS0015

04
1

uscare rapid

INSTRUMENTE DE SCRIS I CORECTUR

Unitate de vnzare
set 4 culori

Marker universal TZ1


Potrivit att pentru scrierea pe hrtia de flipchart, ct i pe suprafaa magnetic
a tablelor de conferin.
YUIURWXQG
JURVLPHYUIPP

uscare rapid

Cod
PS110094

Culoare

PS110096

set 6 culori

set 4 culori

1.5-3

Marker pentru flipchart 380


Marker rencrcabil pentru flipchart, cu cerneal pe baz de ap i miros neutru.
Poate fi lsat fr capac timp de sptmni ntregi fr ca cerneala s se usuce.
Capac n culoarea scrierii.
YUIURWXQG
JURVLPHYUIPP
Cod
ED380001

Culoare

ED380002

rou

ED380003

albastru

ED380004

verde

ED380005

set 4 culori

negru

1.5-3

vrf de rezerv

?
196

TIAI C?
Poi umple aproximativ 6.500 de czi
de baie cu cerneala folosit de edding
n produsele create n fabrica din
Bautzen, ncepnd cu 1994?

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

markere pentru tabl


Marker pentru tabl 28
Marker ecologic cu cerneal nepermanent, corp din plastic, realizat n proporie de
90% din materiale reciclate.
UHQFUFDELO
YUIURWXQG
JURVLPHYUIPP
Culoare

1.5-3

negru

ED280002

rou

ED280003

albastru

ED280004

verde

ED280005

set 4 culori

04

SUPER
CALITATE

INSTRUMENTE DE SCRIS I CORECTUR

Cod
ED280001

Marker pentru tabl Plan 64


Rencrcabil, pentru tabl, fr adaos de xilen sau toluen.
Scriere nepermanent, se terge uor cu ajutorul unui material textil uscat.
YUIURWXQG
JURVLPHYUIPP
VHWFXORULQHJUXURXDOEDVWUXYHUGH
Cod
SW6411

Culoare

SW6412

albastru

SW6413

rou

SW13641

set 4 culori

negru

1.5-3

CALITATE
PRE

Marker pentru tabl


Corp din plastic alb, prevzut cu capac cu clip de prindere n culoarea scrierii.
Cerneal nepermanent.
GLDPHWUXFRUSPP
YUIURWXQG
JURVLPHYUIPP

Cod
LW030511

Culoare

LW030512

rou

LW030513

negru

albastru

2.5-4

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

197

Professional Marking Solutions

www.edding.com

markere pe baz de vopsea

povestea unei mrci


Durabil, versatil, expresiv, calitativ - acestea sunt valorile pe care grupul
edding le reprezint. Compania a fost fondat n 1960 de ctre Carl-Wilhelm
Edding i Volker Detlef Ledermann. Primul lor produs - legendarul marker
edding nr. 1 - a servit drept exemplu generaiilor urmtoare de markere.
Astzi, produsele realizate de edding sunt marketate n peste 110 ri.
Acestea variaz de la markere permanente clasice pn la produse speciale
ca i markerul pentru CD, precum i produse pentru aplicaii creative.

04

Marker 750
Marker permanent pe baz de vopsea, scriere opac i lucioas pe aproape orice tip
de material. Recomandat pentru materialele de culoare nchis sau transparente.
Poate fi folosit att pentru marcare, etichetare, decorare, ct i pentru a colora
aproape orice tip de suprafa. Se vede excelent pe suprafee negre, transparente i
netede.
YUIURWXQG
corp din aluminiu
JURVLPHYUIPP
Cod
ED7500

Culoare

2-4

alb

ED7501

negru

ED7502

rou

ED7503

albastru

ED7504

verde

ED7505

galben

ED75053

auriu

ED75054

argintiu

TIAI C?
Culorile galben, portocaliu, maro, violet, roz, albastru deschis,
DOELDUJLQWLXDOHPDUNHUXOXLHGGLQJUH]LVWODWHPSHUDWXUL
de pn la 1000o C. La fel si culorile alb si argintiu ale
PDUNHUXOXLHGGLQJ
Mai mult, gamele de markere pe baz de vopsea edding
LVXQWUHFRPDQGDWHGH/XKDQVD7HFKQLNFHOPDL
important productor i furnizor independent de servicii de
ntreinere, revizie i reparaii de aeronave.

INSTRUMENTE DE SCRIS I CORECTUR

Aflai mai multe despre companie i produsele disponibile la www.


edding.com

Marker 780
Marker permanent, pe baz de vopsea, fr miros,
ce ofer o scriere opac i lucioas.
YUIURWXQGVXELUHQFDVWUDWQPHWDO
JURVLPHYUIPP
Cod
ED7801

Culoare

corp din aluminiu

negru

ED78053

auriu

ED78054

argintiu

ED7800

alb
Recomandat pentru materialele de culoare nchis sau
transparente, cum ar fi: sticl, plastic sau metal.

Oricare ar fi meseria ta, avem produsul potrivit.

0.8

199

markere speciale
Marker 8750
Marker permanent, pe baz de vopsea. Capac ventilat, scriere opac i lucioas.
Ideal pentru a scrie pe suprafee prfuite sau unsuroase. Corp din aluminiu.
YUIURWXQG
JURVLPHYUIPP
Cod
ED875049

INSTRUMENTE DE SCRIS I CORECTUR

04
corp din aluminiu

2-4

Culoare
alb

ED87501

negru

ED87502

rou

ED87503

albastru

ED87504

verde

ED87505

galben

ideal pentru suprafee


prfuite sau unsuroase

Marker 790
Marker permanent, pe baz de vopsea. Capac ventilat, scriere opac i lucioas pe
aproape orice tip de suprafa, recomandat pentru materialele de culoare nchis
sau transparente. Cerneala este fr adaos de xilen sau toluen.
YUIURWXQGJURVLPHYUIPP
Cod 790
ED7900

Culoare

ED7901

negru

ED7902

rou

alb

ED7903

albastru

ED7904

verde

ED7905

galben

ED79053

auriu

ED79054

argintiu

2-3
CALITATE
PRE

Marker 791
Marker permanent, pe baz de vopsea. Capac ventilat, scriere opac i lucioas pe
aproape orice tip de suprafa, recomandat pentru materialele de culoare nchis
sau transparente. Cerneala este fr adaos de xilen sau toluen.
YUIURWXQGJURVLPHYUIPP
Cod 791
ED7910

Culoare

ED7911

negru

ED7912

rou

ED7913

albastru

ED7914

verde

ED7915

galben

ED79153

auriu

ED79154

argintiu

alb

1-2

200

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

markere speciale
Marker 4090
Marker pe baz de cret lichid pentru decoraiuni pe sticl, ferestre, table i alte
suprafee non-poroase. Opacitate excelent, chiar i pe suprafee nchise la culoare
sau transparente.
YUIUHWH]DW
JURVLPHYUIPP
Culoare

ED409002

rou

ED409003

albastru

SUPER
CALITATE

negru

ED409004

verde

ED409005

alb

ED409006

galben

4-15

Marker 8300 Industrial


Marker permanent, ideal pentru a scrie pe suprafee prfuite sau unsuroase.
YUIURWXQG
JURVLPHYUIPP
Cod
ED083001

Culoare

ED083002

rou

ED083003

albastru

negru

1.5-3

corp din aluminiu

04
INSTRUMENTE DE SCRIS I CORECTUR

Cod
ED409001

ideal pentru suprafee


prfuite sau unsuroase

Marker 8030 NLS


Marker permanent, conine cerneal special, ideal pentru industria aviaiei,
industria metalului i chiar staiile spaiale. Slab n coninut de halogen, ideal
pentru metalele sensibile.
YUIURWXQG
JURVLPHYUIPP
Cod
ED80302

Culoare

ED80303

albastru

1.5-3

rou
cerneal slab coroziv

TIAI C?
Distana acoperit de linia de scriere a
cernelei folosit de edding n produsele
realizate n fabrica Bautzen este egal cu
aproximativ de 28 de ori distana dintre
Pamnt i Soare?

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

201

markere permanente
Marker cu vrf ultrafin 140S
Marker permanent. Cerneala este rezistent la ap, translucid, cu urm bine
conturat i nu poate fi tears dect cu alcool. Scrie pe aproape toate suprafeele
netede, transparente, plane (plastic, filme retroproiector, sticl, metal, ceramic).
YUIQFDVWUDWQPHWDOGHPP

04

Cod
ED1401

negru

Culoare

ED1402

rou

ED1403

albastru

INSTRUMENTE DE SCRIS I CORECTUR

0.3

Marker cu vrf fin 141F


Marker permanent. Cerneala este rezistent la ap, translucid, cu urm bine
conturat i nu poate fi tears dect cu alcool. Scrie pe aproape toate suprafeele
netede, transparente, plane (plastic, filme retroproiector, sticl, metal, ceramic).
YUIURWXQGGHPP
Cod
ED1411

negru

Culoare

ED1412

rou

ED1413

albastru

0.6

Recomandat scrierii pe
filme de retroproiector.

Marker cu vrf mediu 142M


Marker permanent. Cerneala este rezistent la ap, translucid, cu urm bine
conturat i nu poate fi tears dect cu alcool. Scrie pe aproape toate suprafeele
netede, transparente, plane (plastic, filme retroproiector, sticl, metal, ceramic).
YUIURWXQGGHPP
Cod
ED1421

negru

Culoare

ED1422

rou

ED1423

albastru

202

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

markere permanente

Marker Universal
Marker permanent ce scrie pe aproape toate suprafeele netede, transparente,
plane (plastic, sticl, metal, ceramic, filme retroproiector). Prevzut cu grip
cauciucat, cerneal permanent.
YUIURWXQG
JURVLPHYUIPP
Culoare

SW84142

rou

04

0.7

negru

SW84143

albastru

SW8414

set 4 culori

Marker 8400
Marker special pentru scriere permanent pe CD, DVD sau Blu-ray. Cerneala
permanent ofer o maxim securitate a scrierii.
YUIURWXQG
JURVLPHYUIPP
Cod
ED8400

Culoare

ED84002

rou

ED84003

albastru

negru

0.75

INSTRUMENTE DE SCRIS I CORECTUR

Cod
SW84141

Marker recomandat de Verbatim. Cerneal cu caracter


permanent, urm a scrierii durabil n timp.

Marker 84
0DUNHUSHQWUX&''9'FXFHUQHDOSHUPDQHQWUH]LVWHQWODPXUGULHLDS
YUIURWXQG
JURVLPHYUIPP
0.6

Cod
ED084001

Culoare

ED084002

rou

ED084003

albastru

negru

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

203

markere permanente
Marker 800
Pentru scriere permanent pe aproape orice suprafa. Cerneal fr adaos de xilen
sau toluen.
YUIUHWH]DW
JURVLPHYUIPP
corp aluminiu

INSTRUMENTE DE SCRIS I CORECTUR

04

Cod
ED8001

negru

Culoare

ED8002

rou

ED8003

albastru

rencrcabil

4-12
SUPER
CALITATE

Marker 500
Pentru scriere permanent pe aproape toate suprafeele, chiar i metal, sticl,
plastic. Miros slab, uscare rapid.
YUIUHWH]DW
JURVLPHYUIPP

corp aluminiu

rencrcabil

Cod
ED5001

Culoare

ED5002

rou

ED5003

albastru

ED5004

verde

negru

2-7

Marker No. 1
Pentru scriere permanent, pe aproape orice suprafa. Rencrcabil, corp din
aluminiu, cerneal fr adaos de xilen sau toluen.
YUIUHWH]DW
JURVLPHYUIPP
Cod

corp aluminiu

rencrcabil

Culoare

ED11

negru

ED12

rou

ED13

albastru

1-5

Marker 390
Marker cu vrf teit, cerneal slab mirositoare i rezistent la ap, pentru scriere
permanent pe aproape orice suprafa, rencrcabil.
YUIWHLW
JURVLPHYUIPP
Cod
ED3901

negru

Culoare

ED3902

rou

ED3903

albastru

ED3904

verde

4-12

204

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

markere permanente
Marker 2000C
Pentru scriere permanent pe aproape orice suprafa, rencrcabil, corp din metal,
cerneal fr adaos de xilen sau toluen. Marker clasic pentru toate aplicaiile. Poate
fi folosit pe orice tip de suprafa. Ideal scrierilor pe hrtie, metal, sticl, porelan,
plastic, polistiren, cauciuc, lemn, piatr, piele.
YUIURWXQG
JURVLPHYUIPP
Cod
ED20001

Culoare

ED20002

rou

ED20003

albastru

negru

1.5-3

Marker 400
Pentru scriere permanent pe aproape orice suprafa, capac prevzut cu clip de
prindere, cerneal fr adaos de xilen sau toluen. Poate fi rencrcat, recomandabil
cu tu edding T25. Cerneala se usuc rapid, este impermeabil i rezistent la uzur.
YUIURWXQG
JURVLPHYUIPP
Cod
ED4001

rencrcabil

INSTRUMENTE DE SCRIS I CORECTUR

04

Culoare
negru

ED4002

rou

ED4003

albastru

Marker 370
Marker cu vrf fin, cerneal slab mirositoare i rezistent la ap, pentru scriere
permanent pe aproape orice suprafa, rencrcabil i prevzut cu clip de prindere.
YUIURWXQG
JURVLPHYUIPP
Cod
ED3701

Culoare

ED3702

rou

ED3703

albastru

ED3704

verde

negru

rencrcabil

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

205

markere permanente
Marker Write-4-All
Marker permanent, recomandat pentru scriere pe aproape orice suprafa (CD,
sticl, ceramic, porelan, metal, aluminiu). Corp din plastic, cerneal pe baz
de alcool, fr adaos de xilen sau toluen, rencrcabil. Urmele de scriere se
usuc repede.
YUIURWXQG
JURVLPHYUIPP

rezistent la
lumin i nghe

04
INSTRUMENTE DE SCRIS I CORECTUR

Cod
SW131411

Culoare

SW131412

rou

SW131413

albastru

negru

Marker 300/330
Pentru scriere permanent pe aproape orice suprafa, rencrcabil, capac prevzut
cu clip de prindere, cerneal fr adaos de xilen sau toluen.
HGGLQJYUIURWXQGGHPP
HGGLQJYUIUHWH]DWGHPP

1.5-3

rencrcabil

CALITATE
PRE

Cod
ED3301

Tip vrf

Unitate de vnzare

Culoare

teit

bucat

negru

ED3302

teit

bucat

rou

ED3303

teit

bucat

albastru

ED3001

rotund

bucat

negru

ED3002

rotund

bucat

rou

ED3003

rotund

bucat

albastru

ED3004

rotund

bucat

verde

ED300/4

rotund

4 buci/set

1-5

Marker Sharpie
Dou capete sunt mai bune dect unul!
IXQFLRQDOLWDWHVSRULWFXDMXWRUXOYUIXOXLQLDFHOXLJURV
SHUPDQHQWSHPDMRULWDWHDVXSUDIHHORU
FHUQHDOSHED]GHDSUH]LVWHQWQWLPSQFXUDMQGDVWIHOXWLOL]ULQPXOWLSOH
proiecte
FHUQHDOFXXVFDUHUDSLGLIRUPXOQRQWR[LFFHUWLFDW
YUIQPP
YUIJURVPP

206

Cod
PP110802

Culoare

PP110803

rou

PP110801

albastru

negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

markere permanente
Marker Mark-4-All
Recomandat pentru scriere pe aproape orice suprafa. Corp din plastic, cerneal
pe baz de alcool, fr adaos de xilen sau toluen.
Vrf rotund
JURVLPHYUIPP
Cod
SW136511

Culoare

SW136512

rou

SW136513

albastru

SW13651/4

set 4 culori

negru

04

Vrf retezat
JURVLPHYUIPP

INSTRUMENTE DE SCRIS I CORECTUR

1.5-2.5

CALITATE
PRE

Cod
SW65346

Culoare

SW65341

albastru

negru

Marker permanent
Marker permanent economic, corp din plastic, capac cu clip de prindere n culoarea
scrierii.
GLDPHWUXFRUSPP
YUIURWXQG
JURVLPHYUIPP
Cod
LW030523

Culoare

LW030522

rou

negru

LW030521

albastru

LW030524

verde

2-3

Marker permanent
Marker permanent economic, capac cu clip de prindere n culoarea scrierii.
GLDPHWUXFRUSPP
YUIURWXQG
JURVLPHYUIPP
Cod
LW030503

Culoare

LW030502

rou

LW030501

albastru

LW030504

verde

LW030510

set 4 culori

negru

1-4

SFATUL SPECIALISTULUI
CERNEALA MARKERELOR PERMANENTE

Tu T25
Tu pentru rencrcarea markerelor permanente. Sticla este prevzut cu
sistem de picurare, tuul este potrivit i pentru aplicri directe cu pensula
sau cu instrumente de trasat. Capacitate: 30 ml.
Cod
ED94251

Culoare

ED94252

rou

ED94253

albastru

Cerneala produs pe baz de ap sau alcool nu este duntoare


sntii sau mediului nconjurtor. De aceea, atunci cnd alegi un
marker, opteaz pentru cele cu cerneal produs pe baz de alcool
sau ap, fr adaos de xilen sau toluen.

negru

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

207

textmarkere
Textmarker Luminator
Textmarker cu design modern i ergonomic, sistem free-ink i
aciune microcapilar. Nu curge sub presiune (n avion). Prevzut
cu indicator de msurare a nivelului cernelei. Disponibil n ase
culori fluorescente, capacitate de stocare a cernelei dubl fa de
un textmarker obinuit.
Mai mult, textmarkerul Stabilo Luminator este cel mai bine vndut
din segmentul free-ink.
JULSHUJRQRPLF
FHUQHDOSHED]GHDS
YUIUHWH]DW
JURVLPHYUIPP
OXQJLPHGHVFULHUHP

INSTRUMENTE DE SCRIS I CORECTUR

04

Cod
SW1171x

Unitate de vnzare
bucat

x-culoare: 24- galben, 33- verde, 40- rou, 41- albastru,


54- orange, 56- roz

capacitate dubl de
stocare a cernelei

SUPER
CALITATE

2-5

Textmarker Boss
Textmarkerul numrul 1 n Europa, rencrcabil, culori
fluorescente. Este singurul textmarker care dispune de o gam de
DSWHFXORULXRUHVFHQWH&ODVLFVHPHQLQHQWRSQFGLQ
YUIUHWH]DW
JURVLPHYUIPP
OXQJLPHGHVFULHUHP
Cod
SW1170x

bucat

Unitate de vnzare

SW117004

set 4 culori

SW117006

set 6 culori

x-culoare: 24- galben, 31- bleu, 33- verde, 40- rou, 54- orange,
55- mov, 56- roz

2-5
CALITATE
PRE

208

Cele mai multe textmarkere au vrful teit, avnd rolul


de a scoate n eviden anumite pasaje dintr-un text,
fie c e vorba de scris de mn sau imprimare.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

textmarkere
Textmarker 345
Textmarker rencrcabil, cerneal pe baz de ap.
YUIUHWH]DW
JURVLPHYUIPP
Cod
ED3455

Culoare

ED3456

portocaliu

ED3459

roz

ED34511

verde

ED34510

albastru

ED34512

gri

ED345400

set 4 culori

galben

Culoarea gri-argintiu este special pentru evidenierea textelor supuse


copierii. Textele evideniate, ct i evidenierea nsi, rmn vizibile
chiar i pe materialele rezultate n urma copierii.
2-5

Textmarker
Textmarker cu design clasic, cerneal flourescent, rezistent la UV, destinat att
pentru hrtie clasic, ct i pentru hrtie pentru fax sau destinat copierii. Corp n
culoarea scrierii, cu vrf din fetru de calitate ce asigur o perioad de via lung.
JURVLPHYUIPP
Cod
SE000801

Culoare
galben

SE000802

verde

SE000803

portocaliu

SE000804

roz

CALITATE
PRE

INSTRUMENTE DE SCRIS I CORECTUR

04

1-5

Textmarker dreptunghiular
Textmarker disponibil n patru culori fluorescente.
YUIUHWH]DW
JURVLPHYUIPP
Cod
LW030411

Culoare

LW030412

portocaliu

LW030413

roz

LW030414

verde

LW030415

set 4 culori

galben

2-5

Textmarker rotund
Textmarker disponibil n patru culori fluorescente.
YUIUHWH]DW
JURVLPHYUIPP
Cod
LW030401

Culoare

LW030402

portocaliu

LW030403

roz

LW030404

verde

LW030405

set 4 culori

galben

1-4

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

209

creioane mecanice
Creion mecanic Tikky III
Design clasic i ergonomic. Corp din plastic rezistent, diverse culori, vrf i accesorii
metalice, radier ncorporat.
Cod
RO502003

04
INSTRUMENTE DE SCRIS I CORECTUR

SUPER
CALITATE

Min (mm)

Culoare

0.35

negru
negru

RO502025

0.50

RO502015

0.50

alb

RO502020

0.50

rou

RO502045

0.50

albastru

RO502007

0.70

negru

RO502107

0.70

bordo

RO502011

1.00

negru

Creion mecanic Fiesta


Corp din plastic transparent, prevzut cu grip ergonomic din plastic i cu
radier. Vrf metalic retractabil. Culoare: nuane de gri.
Cod
PE105131

0.5

Min (mm)

PE105132

0.7

Creion mecanic
Corp din plastic, prevzut cu clip de prindere metalic i radier. Vrf metalic.
Cod
LW030203

Min (mm)

LW030204

0.7

0.5

Creion mecanic
Corp din plastic, prevzut cu clip de prindere i radier. Vrf din plastic.

?
210

Cod
LW030201

Min (mm)

LW030202

0.7

0.5

TIAI C?
Creionul mecanic a fost patentat in 1822?
Compania fondat de dezvoltatori britanici
a prosperat pn n anul 1941, cnd fabrica
a fost bombardat.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

creioane i rezerve

Creion mecanic
Corp plastic i accesorii metalice, design elegant, cu dou rezerve de nalt calitate, cu
radiera ascuns sub butonul mecanismului. Ambalat individual n cutie de carton.
Cod
SE000901
SE000902

Min (mm)
0.5

04
INSTRUMENTE DE SCRIS I CORECTUR

0.7

Creion Swano
Corp din lemn vopsit, cu radier, min de duritate HB.
Cod
SW174901

Mine pentru creion mecanic


Mine de calitate superioar. Lungime: 60 mm.
8QLWDWHGHYQ]DUHPLQHFXWLH
Cod
RO505508

Diametru (mm)

Duritate

0.5

HB

RO505507

0.5

RO505506

0.5

2B

RO505708

0.7

HB

RO505707

0.7

RO505908

1.0

HB

SUPER
CALITATE

Mine pentru creion mecanic


0LQHGHFDOLWDWHVXSHULRDUOXQJLPHPP
8QLWDWHGHYQ]DUHPLQHFXWLH
Cod
SW129351

Diametru (mm)

Duritate

0.5

HB

SW129371

0.7

HB

CALITATE
PRE

Mine pentru creion mecanic


Lungime: 60 mm.
8QLWDWHGHYQ]DUHPLQHFXWLH

Cod
LW030211

Diametru (mm)

Duritate

0.5

HB

LW030212

0.7

HB

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

211

corectoare
Band corectoare Roll On
Corectur uscat. Se poate rescrie imediat, nu las umbre la copiere.
Ergonomic: uor de inut, corecteaz de la stnga la dreapta.
OLPHEDQGPP
Cod
KS84751

Lungime band (m)


8.5

INSTRUMENTE DE SCRIS I CORECTUR

04
TIAI C?

Vopseaua galben a creioanelor dateaz nc din 1980?


n anii 1800, cel mai bun grafit din lume era produs n
China. n America, proiectanii de creioane i doreau s
transmit lumii c la fabricarea creioanelor s-a folosit
grafit chinezesc. n China, culoarea galben simbolizeaz
roialitate i respect, astfel au decis s vopseasc creioanele
n galben, transmind sentimentul regal i asocierea cu
grafitul chinezesc.
$VW]LGLQFUHLRDQHOHYQGXWHVXQWYRSVLWHJDOEHQ

Band corectoare Scooter


Corectur uscat. Se poate rescrie imediat, nu las umbre la copiere.
Design inovator - rotiele permit poziionarea perfect a corectorului pe hrtie.
OLPHEDQGPP
Cod
KS880000

Lungime band (m)


5

Band corectoare
CALITATE
PRE

Permite scrierea imediat dup aplicare. Nu las umbre la copiere.


OLPHEDQGPP
OXQJLPHEDQGP
Cod
AY0005

Lungime band (m)


8

Band corectoare
Aplicare uoar, se poate scrie imediat dupa aplicare.
OLPHEDQGPP
OXQJLPHEDQGP
Cod
BV041111

212

Lungime band (m)


8

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

corectoare
Band corectoare
Band cu design atractiv i corp transparent ce permite vizualizarea benzii
rmase. Design perfect ergonomic, cu vrf flexibil ce ajut la urmrirea liniei
de corectat. Se poate rescrie. Produs destinat att pentru birou i coal, ct i
pentru acas.
Dimensiuni

Culoare

4.2 mm x 10 m

rou

ED000232

5 mm x 6 m

albastru

SUPER
CALITATE

Creion corector 7700


Creion corector 7707
Creion corector cu vrf metalic pentru corecturi precise. Corp din plastic moale
SHQWUXRXWLOL]DUHFRPRG6HXVXFUDSLGLDFRSHUSHUIHFW&DQWLWDWHPO
YUIURWXQG
JURVLPHYUIPP

Creion corector cu vrf metalic, uscare rapid, grosimea urmei de


aproximativ 1-2 mm. Ideal pentru corectarea textelor scrise de mn sau
la main, ct i a celor de pe hrtia supus copierii sau transmis prin
fax. Cantitate: 10 ml.
YUIURWXQG
JURVLPHYUIPP

04
INSTRUMENTE DE SCRIS I CORECTUR

Cod
ED000231

Cod
ED7000

Cod
ED000241

Creion corector
Creion corector
Uscare rapid, repartizare uniform, nu las umbre la copiere. Corectare uoar, prin
apsarea vrfului creionului pe hrtie.
Cantitate: 10 ml.
Cod
KS84030

Corectare uoar, prin apsarea vrfului creionului pe hrtie. Uscare rapid, nu las
umbre la copiere. Cantitate: 9 ml.
Cod
AY0004

Corector cu rescriere 1515


Pentru tergerea cernelei de culoare albastr. Grosimea vrfului de tergere: 0.8 mm.
Rescrierea se face cu linerul cu cerneal albastr aflat la captul opus.
JURVLPHYUIPP
Cod
ED1515

CALITATE
PRE

Oricare ar fi meseria ta, avem produsul potrivit.

213

fluide corectoare

Set corector
Fluid corector i diluant, pentru toate tipurile de corecturi. Fluidul nu las
umbre la copiere, uscare rapid dup aplicare.
Cantitate: 20 ml + 20 ml.

04
INSTRUMENTE DE SCRIS I CORECTUR

Cod
KS62115

Fluid corector Soft Tip


Prevzut cu aplicator cu burete. Nu las umbre la copiere, uscare rapid dup
aplicare. Cantitate: 20 ml.
Cod
KS66406

pe baz de solvent

Tip

KS69417

pe baz de ap

Fluid corector
Prevzut cu aplicator cu pensul. Nu las umbre la copiere, uscare rapid
dup aplicare. Cantitate: 20 ml.
Cod
KS66119

pe baz de solvent

Tip

KS69101

pe baz de ap

CALITATE
PRE

Diluant
Pentru fluide corectoare pe baz de solvent.
Cantitate: 20 ml.
Cod
KS61109

214

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

fluide corectoare
Fluid corector
Fluid corector pe baz de ap, cu pensul, pentru a corecta suprefee mari.
Fluidul se usuc rapid i las o suprafa perfect neted.
Cantitate: 20 ml.
Cod
ED000242

INSTRUMENTE DE SCRIS I CORECTUR

04

Fluid corector
Pentru toate tipurile de corecturi, nu las umbre la copiere, uscare rapid dup
aplicare, posibilitate de rescriere, repartizare uniform.
Cantitate: 20 ml.
Cod
AY0006

Tip
pe baz de solvent

Aplicator
pensul

AY0008

pe baz de ap

burete

SFATUL SPECIALISTULUI
UTILIZAREA FLUIDELOR CORECTOARE
Fluidele corectoare au o mai mare putere de acoperire dect orice alt
dispozitiv de corectur. Pentru o mai bun eficien, alege fluidele
corectoare care asigur o uscare rapid a pastei i care faciliteaz o
rescriere uoar.

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

215

ascuitori, radiere i rigle

Ascuitoare Exam Grade


Ascuitoare office, modern, cu container. Corp din plastic transparent i lam
durabil.
Cod
SW4518

INSTRUMENTE DE SCRIS I CORECTUR

04
tratat special
antiruginire

Produsul completeaz gama de instrumente


de scris Exam Grade, de la Stabilo.

Radiere
Radiere office sau pentru uz colar.
Cod
SW1196

Model

Dimensiuni (mm)

Supreme 1196

62 x 22 x 11

SW119612

Exam Grade

62 x 22 x 11

SW1191

Exam Grade

40 x 22 x 11

Ascuitori
Ascuitori cu lam din oel, diverse tipuri i culori.
Cod
RQ048111

Tip

Material

simpl

plastic

RQ048121

simpl

metal

RQ048112

dubl

plastic

RQ048122

dubl

metal

Radiere
Radiere destinate pentru tergerea urmelor de creion.
Pentru cerneal folosii radiera bicolor.
Cod
RQ041412

Model

RQ041411

mini

bicolor

Rigle
Realizate din plastic.

216

Cod
RQ048212

20

Lungime (cm)

RQ048211

30

RQ048213

40

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

5. Articole din hrtie


hrtie pentru copiator i
imprimant

218

plicuri speciale

237

hrtie i carton color

224

etichete autoadezive

238

hrtie operaional

226

notie autoadezive

242

formulare comune

230

cuburi din hrtie

248

plicuri pentru coresponden

234

caiete i blocnotesuri

249

plicuri pentru documente

236

hrtie pentru copiator i imprimant


Povestea i drumul hrtiei
WLDLF3DSLUXVXODIRVWSULPXOPDWHULDODVHPQWRUKUWLHLLD

ARTICOLE DIN HRTIE

05

IRVWIRORVLWSULPDGDWGHFWUHHJLSWHQLQFGLQDQXO(Q
&XYQWXOKUWLHSURYLQHGLQODWLQHVFXOSDS\UXVSDSLHUQOLPED
IUDQFH]SDSHUQOLPEDHQJOH]
2ULJLQHDFXYQWXOXLGLQOLPEDURPQHVWHOLPEDVODYFKDUWLM
+UWLDSURGXVGLQGHHXULDIRVWLQYHQWDWQ&KLQDQDQXO
+UWLDDQFHSXWVHXWLOL]DWQ$VLDQMXUXODQXOXLLDUQ%DJGDGL'DPDVFQDQXO
Q(XURSDKUWLDDIRVWDGXVGHFWUHLQYDGDWRULLDUDELQ6SDQLD
3ULPDIDEULFGHKUWLHGLQ(XURSDDIRVWQ9DOHQFLDQDQXO'XSDFHVWDQDX
QFHSXWVDSDUIDEULFLGHKUWLHLQFHOHODOWHUL,WDOLD*HUPDQLD)UDQD
,GHHDXWLOL]ULLOHPQXOXLQSURGXFHUHDKUWLHLLDDSDULQXWIUDQFH]XOXL$QWRLQH
)HUFKDXOWGH5HDXPXUFDUHDIRVWLQVSLUDWGHPRGXOQFDUHYLHVSLOHFRQVWUXLHVFVWXSLL
QOELUHDKUWLHLDDYXWORFGXSGHVFRSHULUHDFORUXOXLQDQXO$FHVWDHVWHDQXOQ
FDUHVDQVFXWKUWLDPRGHUQ
Q5RPQLDSULPDPRDUGHKUWLHDIRVWQLQDWQDQXOOD2UODWOQJ6LELX
3ULPDIDEULFGHKUWLHGLQ5RPQLDDIRVWOD%XWHQLQDQXO
Formatele hrtiei

Condiii aclimatizare hrtie


50 C

100 C

150 C

200 C

5 topuri

4h

12 h

17 h

35 h

25 topuri

7h

200 topuri 12 h

17 h

25 h

50 h

25 h

35 h

75 h

Simboluri i semnificaii hrtie


TCFKUWLHQWRWDOLWDWHIUFORU
Nordic Ecolabel1RUGLF6ZDQDFRSHUQWUHJXOFLFOXGHYLDDOSURGXVXOXLQPDWHULHGHPHGLXGHOD
PDWHULLSULPHODGHHXULPRQLWRUL]QGDVSHFWHFDHQHUJLDLFRQVXPXOGHUHVXUVHSUHFXPLHPLVLLOHIDEULFLL
QDSLDHU
EU Ecolabel(WLFKHWD8(HFRORJLFSURSULHD8(6HLDQFRQVLGHUDUHQWUHJXOFLFOXGHYLDDOSURGXVXOXL
GHODPDWHULLSULPHODGHHXULLGHDVHPHQHDVWDELOHWHFULWHULLSHQWUXHPLVLLVF]XWHLFRQVXPUHGXVGH
HQHUJLH
EMAS0DQDJHPHQWXOLDXGLWXO8(QFHHDFHSULYHWHPHGLXOQFRQMXUWRU6FRSXO(0$6HVWHQWUXQ
PRGVLVWHPDWLFLVWUXFWXUDWGHDFUHDFRQGLLLOHSHQWUXSUHYHQLUHDOLPLWDUHDLUHGXFHUHDQPRGFRQVWDQWDO
LPSDFWXOXLDVXSUDPHGLXOXL(VWHQHYRLHGHRUDSRUWDUHSXEOLFDPHGLXOXLDQXDO
FSC&RQVLOLXO)RUHVW6WHZDUGVKLSOXFUHD]SHQWUXDSURWHMDPHGLLOHIRUHVWLHUHLPSRUWDQWHLRDPHQLLFDUH
WULHVFLOXFUHD]QHOH

218

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

hrtie pentru copiator i imprimant

Printeaz cu stil!
6XSRUWXOLGHDOSHQWUXFRUHVSRQGHQDGH]LFX]L
&HUWLFUL,62,62,62

ARTICOLE DIN HRTIE

05

Office Express
+UWLHDOESHQWUXELURX$VLJXUUH]XOWDWHGHRVHELWHODLPSULPDUHDPRQRFURP
5HFRPDQGDWSHQWUXWRDWHWLSXULOHGHDSDUDWHLPSULPDQWHFRSLDWRDUHID[XUL
*UDPDMJPS
1XPUFROLWRS
Cod
NF1174
NF1173

Format (mm)

Unitate de vnzare

A4 (210 x 297)

cutie (5 topuri)

A4 (210 x 297)

palet (240 topuri)

A3 (297 x 420)

top

A3 (297 x 420)

cutie (5 topuri)

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

219

hrtie pentru copiator i imprimant


MultiCopy - Hrtia alb cu contiin verde.
0XOWL&RS\HVWHRKUWLHFXXQJUDGGHDOEH[FHSLRQDO &,(:KLWHQHVV LQDFHODLWLPSXQXOGLQWUHSURGXVHOHFXFHOPDL
PDUHUHVSHFWSHQWUXPHGLXOQFRQMXUWRU$FHVWOXFUXVHQWPSOSHQWUXFQHSDVQXQXPDLGHSGXUHGDULGHFHLPDL
PLFLORFXLWRULDLVL$SURSRWLDLF0XOWL&RS\HVWHSURGXVGHIDEULFDGLQ1\POODFX]HURHPLVLLGH&2GLQFRPEXVWLELOLL
IRVLOL"&0XOWL&RS\WHQWPSLQFXXQSDFKHWGHHWLFKHWHGHPHGLX"$FXPWLL
&LWHWHPDLPXOWHGHVSUH0XOWL&RS\LHWLFKHWHOHQRDVWUHGHPHGLXODZZZVWRUDHQVRFRPPXOWLFRS\

ARTICOLE DIN HRTIE

05

MultiCopy
+UWLHFXXQJUDGGHDOEH[FHSLRQDO &,(:KLWHQHVV SHUIHFWSHQWUXWRDWH
WLSXULOHGHDSDUDWHGHELURXLPSULPDQWHFRSLDWRDUHID[XUL
&HUWLFUL(8)ORZHU1RUGLF6ZDQ,62,62,62
1XPUFROLWRS*UDPDMJPS
Cod
NF1180

Format (mm)
A4 (210 x 297)
A4 (210 x 297)

Unitate de vnzare
cutie ( 5 topuri)
palet ( 240 topuri)

1XPUFROLWRS*UDPDMJPS
Cod
NF1190

220

Format (mm)
A4 (210 x 297)

Unitate de vnzare
top

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

hrtie pentru copiator i imprimant

Team

Cod
NF2404
NF2403

Format (mm)

Unitate de vnzare

A4 (210 x 297)

cutie (5 topuri)

A4 (210 x 297)

palet (240 topuri)

A3 (297 x 420)

top

A3 (297 x 420)

cutie (5 topuri)

05
ARTICOLE DIN HRTIE

+UWLHDOESHQWUXELURXJDUDQWDWSHQWUXLPSULPDUHDODVHULLQNMHWODRVLQJXU
FXORDUHHVWHSRWULYLWSHQWUXOXFUULQWLUDMPDUH(VWHLGHDOSHQWUXUDSRDUWHLQWHUQH
LFRPXQLFUL
&HUWLFUL,62,62,62
*UDPDMJPS
1XPUFROLWRS

Double A
+UWLHGHFDOLWDWHVXSHULRDUUHQXPLWSHQWUXSHUIRUPDQHOHH[FHOHQWH
SRWULYLWSHQWUXWRDWHWLSXULOHGHLPSULPULFXMHWGHFHUQHDOODVHUMHW
IRWRFRSLL
1XPUFROLWRS*UDPDMJPS
&HUWLFUL(8)ORZHU1RUGLF6ZDQ,62,62,62
Cod
NF3880

Format (mm)
A4 (210 x 297)
A4 (210 x 297)

Unitate de vnzare
cutie ( 5 topuri)
palet ( 300 topuri)

Hrtie reciclat Recyconomic


+UWLHSHQWUXFRSLDWRUSURGXVGLQPDWHULDOHUHFLFODWHQSURFHVXOGH
SURGXFLHDODFHVWHLKUWLLQXVXQWXWLOL]DLSHQWUXDOELUHQLFLXQIHOGHDJHQLRSWLFL
*UDPDMJPS
1XPUFROLWRS
Cod
NF2282

Format (mm)

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

Hrtie certificat Blaue Engel


&HHVWH%ODXH(QJHO"8QVLPEROFHHYLGHQLD]SURGXVHOHFDUHVXQWIDEULFDWHQVWULFW
FRQFRUGDQFXQRUPHOHGHSURWHMDUHDPHGLXOXLQFRQMXUWRUQWUXQLQGQDFHODLWLPS
WRDWHVWDQGDUGHOHGHFDOLWDWHRXWLOL]DUHFDUHUHVSHFWUHJXOLOHGHVQWDWHLREXQ
IXQFLRQDUHDSURGXVHORU
3ULQSURGXFHUHDKUWLHLUHFLFODWH
VHUHGXFHGHSHQGHQDXWLOL]ULLFRPEXVWLELOXOXLIRVLO
FRQWULEXLPODROXPHPDLVQWRDVLFXUDW
VHGLPLQXHD]SROXDUHD
)RORVLQGKUWLDUHFLFODWDYHPPSUHXQJULMGHYLLWRUXOSODQHWHLQRDVWUH

Rezultatele utilizrii hrtiei produs 100% din materiale reciclate


3HQWUXHFDUHGHWRSXULGHKUWLHUHFLFODWSURGXVVHHFRQRPLVHVF
NZKHQHUJLHHOHFWULF HQHUJLHVXFLHQWXQXLFRQVXPFDVQLFGHOXQL
ODS

Oricare ar fi meseria ta, avem produsul potrivit.

221

 
   
       

Visit us on rtc.ro for


more innovative solutions

     

Everyday Papers

hrtie pentru copiator i imprimant

Printing Paper
0DLVWUOXFLWRDUHLPDLDOEGHFWPDMRULWDWHDKUWLLORUGHELURXX]XDOH
2PRJHQLWDWHDULGLFDWDFROLORURIHUUH]XOWDWHH[FHOHQWHDOHLPSULPULLQWRDWH
WLSXULOHGHHFKLSDPHQWH,GHDOSHQWUXDSOLFDLLDOEQHJUXVDXFDUHFRQLQDFFHQWHGH
FXORDUH5HFRPDQGDWSHQWUXSUH]HQWULVFULVRULRFLDOHJUDFHVDXWDEHOHFRORU
DOWHGRFXPHQWHLPSRUWDQWH
*UDPDMJPS
1XPUGHFROLWRS
Format (mm)

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

Everyday Papers

Office

ARTICOLE DIN HRTIE

Cod
NF3454

05

'LVSRQLELOQIRUPDW$L$KUWLD+32FHHVWHUHFRPDQGDWSHQWUXOXFUULOHGH
YROXPFDUHVHWLSUHVFSHHFKLSDPHQWHGHYLWH]PDUH7LHUHDSHUIHFWLWHKQRORJLD
DQWLFHQXSUHOXQJHVFYLDDDSDUDWHORU
*UDPDMJPS
1XPUGHFROLWRS
Cod

Format (mm)

NF3444
NF3443

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

A4 (210 x 297)

palet ( 240 topuri)

A3 (297 x 420)

top

A3 (297 x 420)

cutie ( 5 topuri)

Everyday Papers

Home & Office


+UWLHVSHFLDOFRQFHSXWSHQWUXGRFXPHQWHOHGH]LFX]L*UDGXOGHDOEULGLFDW
DVLJXUFRQWUDVWHOHSXWHUQLFHIFQGGRFXPHQWHOHXRUGHFLWLW
*UDPDMJPS
1XPUGHFROLWRS
Cod

Format (mm)

NF3434

A4 (210 x 297)

Unitate de vnzare
cutie ( 5 topuri)

A4 (210 x 297)

palet ( 240 topuri)

Everyday Papers
Tehnologia ColorLok
3UHVXSXQHGLIHULWHWLSXULGHKUWLHFDUHDXIRVWWUDWDWHFXDGLWLYLVSHFLDOLSHQWUXDDVLJXUDFDOLWDWHDVXSHULRDUDSULQWXOXL
%HQHFLLOHWHKQRORJLHL&RORU/RN
FXORULPDLVWUOXFLWRDUHFXSHVWHSUHYLQHDEVRUELDFHUQHOHLFXORULOHUPQQGVWUOXFLWRDUHLLQWHQVH
QHJUXPDLSURQXQDWFXSHVWHWH[WXOUPQHFODUSURQXQDWVWULGHQW
XVFDUHGHSQODRULPDLUDSLGGRFXPHQWHOHSULQWDWHSRWIRORVLWHLPHGLDWIUULVFGHQWLQGHUHDFXORULORU

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

223

hrtie i carton color


Image Impact
+UWLHSUHPLXPFXXQJUDGGHDOEULGLFDWFHJDUDQWHD]UH]XOWDWHH[FHOHQWHSHQWUX
GRFXPHQWHLPSULPDWHFRORUSHFRSLDWRDUHLLPSULPDQWHODVHUFWLLQNMHW&HUWLFDUH
&RORU/RNL)6&QFRQIRUPLWDWHFX(XURSHDQ(FR/DEHO5HSURGXFHUHH[FHOHQWD
FXORULORUGDWRULWWHKQRORJLHL&RORU/RNUHFRPDQGDWQDSOLFDLLSUHFXPSUH]HQWUL
UDSRDUWHLFRPXQLFULH[WHUQH
*UDPDMJPS
1XPUFROLWRS

05

Cod

Format (mm)

cutie ( 5 topuri)

A4 (210 x 297)

palet (300 topuri)

ARTICOLE DIN HRTIE

NF1134

Unitate de vnzare

A4 (210 x 297)

Hrtie color Image Coloraction


3ULQFLSDOHOHDYDQWDMHXQDGLQFHOHPDLH[WLQVHJDPHHXURSHQHGHKUWLLFRORUDWHH[FHOHQWHSURSULHWLGHWLSULUHRXQLIRUPLWDWHUHPDUFDELODFXORULL
'LVSRQLELOQFXORULFXRJDPFHDFRSHUWRWVSHFWUXOXQXLFXUFXEHX,PDJH&RORUDFWLRQRIHUFXORDUHDSRWULYLWSHQWUXPHVDMXOSRWULYLW
,PDJH&RORUDFWLRQSRDWHXWLOL]DWSHQWUXDSOLFDLLGLYHUVHFXPDUSOLDQWHSURPRLRQDOHLQYLWDLLSUH]HQWULPDSHXWXUDLPDLOLQJFRQWUDFWHHWFVDXSXULVLPSOX
SHQWUXVLVWHPXOGHFODVLFDUHDGRFXPHQWHORU&XXQH[FHOHQWFRPSRUWDPHQWQWLSDULPSULPDUHEXQSHDPEHOHIHHLRSDOHWODUJGHQWUHEXLQUL,PDJH&RORUDFWLRQ
HVWHLGHDOSHQWUXWLSDUXORVHWLQHJDOPVXUSHQWUXODVHUFRORULPSULPDQWHLQNMHWLFRSLDWRDUHFRORUSHQWUXJUDPDMHOHGHSQODJPS$GDXJRSDWGHFXORDUH
QYLDDWDXWLOL]QGKUWLLOH,PDJH&RORUDFWLRQ

ISO
14001

224

ISO

ECF

9001

OHSAS
18001

ISO


Gama hrtie

Gama carton

*UDPDMJPS
8QLWDWHGHYQ]DUHWRS
1XPUFROLWRS

*UDPDMJPS
8QLWDWHGHYQ]DUHWRS
1XPUFROLWRS

Cod
CL0801

galben pal

Cod
CL1601

galben pal

CL0802

albastru pal

CL1602

albastru pal

CL0803

roz

CL1603

roz

CL0804

somon

CL1604

somon

CL0805

galben intens

CL1605

galben intens

CL0806

verde intens

CL1606

verde intens

CL0807

rou

CL1607

rou

CL0808

portocaliu

CL1608

portocaliu

CL0810

albastru nchis

CL1610

albastru nchis

CL0811

verde pdure

CL1611

verde pdure

CL0850

5 x 50 culori pastel asortate

CL0851

5 x 50 culori intense asortate

Culoare

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Culoare

hrtie pentru copiator i imprimant

Premier
+UWLHDOESHQWUXELURX0DUFGHSUHVWLJLXDUPHL;HUR[RIHUGRFXPHQWHORU
LPSRUWDQWHGLQELURXOWXXQDVSHFWLRSUH]HQWDUHSURIHVLRQDOGHRFDOLWDWH
LQFRQWHVWDELO&HUWLFUL,62,62,62
*UDPDMJPS
1XPUFROLWRS
Format (mm)

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

05
ARTICOLE DIN HRTIE

Cod
RX1481

Business
+UWLHDOESHQWUXELURX'HRVHELWGHSHUIRUPDQWDWWSHQWUXLPSULPDQWHOHFX
MHWGHFHUQHDOVDXODVHUFWLSHQWUXFRSLDWRDUH7LDWSUHFLVHVWHSHUPDQHQW
PEXQWLWSHQWUXDSURWHMDHFKLSDPHQWXOOVQGPDLSXLQSUDIGHKUWLH
&HUWLFUL,62,62,62
*UDPDMJPS
1XPUFROLWRS
Cod

Format (mm)

RX1480

RX1380

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

A4 (210 x 297)

palet (240 topuri)

A3 (297 x 420)

top

A3 (297 x 420)

cutie ( 5 topuri)

A3 (297 x 420)

palet (100 topuri)

Transit
+UWLHDOESHQWUXELURX5HFRPDQGDWSHQWUXLPSULPDUHDDOEQHJUXD
GRFXPHQWHORUGH]LFX]LFROLFXDQWHWVFULVRULRIHUWH&HUWLFUL,62,62
,62
*UDPDMJPS1XPUFROLWRS
Cod

Format (mm)

RX1479

Unitate de vnzare

A4 (210 x 297)

cutie ( 5 topuri)

A4 (210 x 297)

palet (240 topuri)

TIAI C?
;HUR[DLQYHQWDWSULQWXO
IDYHUVRQ

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

225

hrtie operaional

&RORU&RS\,QVSLUDLDQRDVWU
FXORULOHVWUOXFLWRDUHDOHQDWXULL

ARTICOLE DIN HRTIE

05

&RORU&RS\KUWLDUHFRPDQGDWGHSURIHVLRQLWL
SHQWUXSURIHVLRQDOLVPQWLSDU
6FXIXQGWHQOXPHDFXORULORUYLEUDQWHSHFDUHQXPDL&RORU&RS\LOHSRDWHRIHUL([SHULPHQWHD]
FRSLHUHDSDJLQGXSSDJLQLODVWHLQVSLUDWGHIRUDFXORULORU&RORU&RS\HVWHSURGXVGHFWUH
0RQGLVXEHJLGDSURGXVHORUSULHWHQRDVHFXPHGLXOQFRQMXUWRULLPSUHVLRQHD]SULQDFUHGLWULOH
VDOH&2QHXWUDO)6&L(8(FRODEHO&HUWLHG

&$5$&7(5,67,&,
VXSUDIDQHWHGDKUWLHL
GLVWULEXLHRPRJHQDEUHORU
VXSUDIDVSHFLDOWUDWDW
DJHQWGHQFOHLHUHWHUPRVWDELO

%(1(),&,,
FRQVXPPDLPLFGHWRQHU
GHQVLWDWHULGLFDWDFXORULORU
WUDQVIHUXQLIRUPDOWRQHUXOXL
FRVWXULGHPHQWHQDQUHGXVH

Hrtie i carton pentru


aparate laser i digitale
&RORU&RS\HVWHOLGHUSHSLDDKUWLLORUGLJLWDOHSHQWUXRJDPODUJGHXWLOL]UL
DFUHGLWDW)6&3URGXVFXDPSUHQWGHFDUERQ]HUR&RORU&RS\RIHUFOLHQLORUXQ
DYDQWDMGHPHGLXVXSOLPHQWDU3ULQDFKL]LLRQDUHD&RORU&RS\DYHLXQURODFWLY
QUHGXFHUHDHPLVLLORUGHFDUERQLFRPEDWHUHDHIHFWHORUQHJDWLYHFDUHFDX]HD]
VFKLPEULFOLPDWLFH&RORU&RS\HVWHSULPDKUWLHGHSHSLDDWLSDUXOXLGLJLWDOFH
DSULPLWDFUHGLWDUHDLQWHUQDLRQDO)RUHVW6WHZDUGVKLS&RXQFLO )6& /RJRXO)6&
LGHQWLFSURGXVHOHFHFRQLQOHPQGLQSGXULOHDGPLQLVWUDWHUHVSRQVDELO

Format A4
Cod
Gramaj
CL309021 90 g/mp
CL310021 100 g/mp

226

Unitate de vnzare
500 coli/top

Format A3
Unitate de vnzare

250 coli/top

Cod
CL309042

Gramaj

CL312022 120 g/mp


CL316021 JPS

90 g/mp

500 coli/top

250 coli/top

CL310042

100 g/mp

500 coli/top

CL320021 200 g/mp


CL325022 250 g/mp

250 coli/top

CL312044

120 g/mp

250 coli/top

125 coli/top

CL316042

JPS

250 coli/top

CL328021 280 g/mp


CL330021 300 g/mp

150 coli/top

CL320042

200 g/mp 250 coli/top

125 coli/top

CL325042

250 g/mp

500 coli/top

125 coli/top

Format A4, lucios


Cod
Gramaj
CL413521 135 g/mp
CL417021 170 g/mp

Unitate de vnzare
250 coli/top

250 coli/top
CL420021 200 g/mp 250 coli/top
CL425021 250 g/mp 250 coli/top

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

hrtie operaional
Carton pentru cri de vizit
&DOLWDWHVXSHULRDUFXORDUHDOE3HQWUXWLUDMHPLFLVHSRDWHXWLOL]DLSHLPSULPDQWH
ODVHULFXMHWGHFHUQHDO6HSRDWHXWLOL]DLODQGRVDULHUHDFXLQHOHLVSLUH
)RUPDW$FROLWRS
Cod
AG103

250 g/mp

Gramaj

Tip
carton dublu cretat lucios

AG104

250 g/mp

carton dublu cretat mat

AG105

200 g/mp

filde pnzat ultra

05
GXEOXFUHWDWPDW

OGHSQ]DWXOWUD

Hrtie calc
+UWLHFXRVXSUDIDIRDUWHQLQHWHGGHRWUDQVSDUHQULGLFDW3RWULYLWSHQWUX
FUHLRQWXLQVWUXPHQWHGHGHVHQWHKQLF5H]LVWHQWODWHUVWXULUHSHWDWHSHUIHFW
SHQWUXWLSULUHRVHW
Cod
CO32195

Dimensiuni

Gramaj

Unitate de vnzare

A4 (210 x 297)

90/95 g/mp

500 coli/top

CO329951

A3 (297 x 420)

90/95 g/mp

250 coli/top

CO32995

A3 (297 x 420)

90/95 g/mp

500 coli/top

ARTICOLE DIN HRTIE

GXEOXFUHWDWOXFLRV

Hrtie n rol
,GHDOSHQWUXDSOLFDLLGLYHUVHSUHFXPSODQHSODQXULOXFUULGHFDGDVWUXJHRORJLH
XUEDQLVPVFKLHSUH]HQWULHWHKQLFH
*UDPDMJPS
Cod
NF26800

Format

Diametru interior

A0+ (914 mm x 175 m)

PP

NF2680

A0 (840 mm x 175 m)

PP

NF2681

A1 (594 mm x 175 m)

PP

NF2682

A2 (420 mm x 175 m)

PP

Hrtie HP pentru plottere


8WLOL]ULQFHQWUHGHFRSLHUHSHQWUXIRUPDWHLYROXPHPDULLQVWLWXWHGHSURLHFWDUH
UROHOHDVLJXUHFRQRPLLLPSRUWDQWHQFRVWXULOHWRWDOHDOHSURLHFWHORULOXFUULORU 
Cod
HP971

Model HP Format

Gramaj

Caracteristici

Q1445A

594 mm x 45.7 m (23" x 150')

90 g/mp

Bright White

HP9881 &$
HP1444 Q1444A
HP981 Q1397A

PP[P [

90 g/mp

Bright White

841 mm x 45.7 m (33" x 150')

90 g/mp

Bright White

PP[P [

80 g/mp

Universal Bond

HP988

PP[P [

90 g/mp

Bright White

&$

HP1398 Q1398A

PP[P [
80 g/mp

Universal Bond

Hrtie n rol pentru plotter


Cod
RX1801

Format

Diametru interior

Gramaj

A0+ (914 mm x 50 m)

50.8 mm

80 g/mp

RX1803

$ PP[P

50.8 mm

80 g/mp

RX1804

A1 (594 mm x 50 m)

50.8 mm

80 g/mp

RX1805

A2 (420 mm x 50 m)

50.8 mm

80 g/mp

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

227

hrtie operaional
Role din hrtie termic
5ROHGLQKUWLHWHUPRVHQVLELOLPSULPDUHJDUDQWDWSHQWUXRGXUDWGHDQL
'LDPHWUXOLQWHULRUDOWXEXOXLHVWHGHPP
8QLWDWHGHYQ]DUHUROHVHW
Cod
RB053810

Lime (mm)

Lungime (m)

38

30

RB05571

57

30

RB05573/5



30

ARTICOLE DIN HRTIE

05

Role din hrtie


'LDPHWUXOLQWHULRUDOWXEXOXLHVWHGHPP
8QLWDWHGHYQ]DUHUROHVHW
Cod
RB04574

Lime (mm)

Lungime (m) Gramaj (g/mp) Tip hrtie

57

30



offset

RB04761



30



offset

RB037611



25



autocopiativ

Role din hrtie personalizate


/DFHUHUHYSXWHPRIHULVHUYLFLLSURIHVLRQDOHGHSHUVRQDOL]DUHDUROHORU
GLQKUWLH3HUVRQDOL]DUHDVHHIHFWXHD]SHYHUVRFXSQODPD[LPGRX
FXORUL&RPDQGDPLQLPVHVWDELOHWHSXQFWXDOQIXQFLHGHFDQWLWDWHWLS
KUWLHLSHUVRQDOL]DUH$OHJHSHUVRQDOL]DUHDSHQWUXDWHIDFHFXQRVFXW
QWUXQPRGIDFLOLHFRQRPLF

Role fax
5ROHGLQKUWLHWHUPRVHQVLELOGHRVHQVLELOLWDWHULGLFDW*DUDQWDWHSHQWUXRGXUDW
GHDQLQFRQGLLLOHGHGHSR]LWDUHLSVWUDUHQVFULVHSHHWLFKHW'LDPHWUXOLQWHULRU
DOWXEXOXLHVWHGHPP*UDPDMsJPSJUDGGHDOEsRSDFLWDWHs
/LPHPPOXQJLPHP
8QLWDWHGHYQ]DUHURO
Cod
RB0103N

TIAI C?

?
228

)D[HVWHGHIDSWRSUHVFXUWDUHDFXYQWXOXL
IDFVLPLODGLFRFRSLHGHODXQXLGRFXPHQW
$SDUDWXOGHODFDUHVHWUDQVPLWHPHVDMXOSDUFXUJH
HFDUHSXQFWDOGRFXPHQWXOXLLHPLWHVHPQDOHFDUH
DMXQJSULQLQWHUPHGLXOFDEOXULORUWHOHIRQLFHVDXDO
XQGHORUUDGLRODXQDSDUDWVLPLODU$FHVWDWUDQVIRUP
VHPQDOHOHSULPLWHQSXQFWHDOEHLQHJUHLPSULPDWH
SHKUWLHIRWRVHQVLELOVDXWLSULWHSHKUWLHRELQXLW

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

hrtie operaional
Print Liner autocopiativ
+UWLHDXWRFRSLDWLYGHVWLQDWXWLOL]ULLSHWRDWHWLSXULOHGHLPSULPDQWHFXWUDFWRU
PELQFRQIRUWXOLFDOLWDWHDGHRVHELW9DULDQWHOHGHFXORDUHSHUPLWRSHUIHFW
RUJDQL]DUHDGLVWULEXLHLGLIHULWHORUFRSLLSHGHSDUWDPHQWH/DFHUHUHVHSRWH[HFXWD
GLIHULWHFRPELQDLLGHFXORDUHLVDXSHUVRQDOL]DDVWIHOQFWKUWLDVFRUHVSXQG
WXWXURUFHULQHORUWDOH
Format

Gramaj

Seturi/cutie Exemplare Culoare

240 mm x 12"

JPS

1.000

alb/alb

HI223711

375 mm x 12"

JPS

1.000

alb/alb

HI222412

240 mm x 12"

JPS

1.000

alb/roz

HI2324111

240 mm x 12"

JPS

750

alb/alb/alb

240 mm x 12"
HI24241234 240 mm x 12"

JPS

750

alb/roz/verde

JPS 500

alb/roz/verde/galben

HI2324123

05
ARTICOLE DIN HRTIE

Cod
HI222411

High Liner
3URGXVGHFDOLWDWHGHVWLQDWXWLOL]ULLSHWRDWHWLSXULOHGHLPSULPDQWHFXWUDFWRU*UDG
ULGLFDWGHDOEFRPSDWLELOXWLOL]ULLQPHGLLSHUIRUPDQWH H[HPSODU 7LSKUWLHRVHW
LPSRUWGHJPS
Cod
HI112417

Format

Coli/cutie

240 mm x 12"

2.000

HI113717

375 mm x 12"

2.000

Print Liner simpl


3URGXVGHFDOLWDWHGHVWLQDWXWLOL]ULLSHWRDWHWLSXULOHGHLPSULPDQWHFXWUDFWRU
H[HPSODU 7LSKUWLHRVHWJPS
Cod
HI112416

Format

Coli/cutie

240 mm x 12"

2.000

HI113716

375 mm x 12"

2.000

TIAI C?

'LQGRULQDGHDWLSULGDWHOHGHSHHFUDQ
RDPHQLLDXLQYHQWDWLPSULPDQWDHOHFWURQLF
(DVHED]DSHSULQFLSLXOSULQFDUHFDUDFWHUHOH
HUDXLPSULPDWHSULQORYLUHDKUWLHLFX
DMXWRUXOXQXLULEERQWH[WLO EDQGWXDW 
SULQLQWHUPHGLXOXQRUDFHGHRHO$FHDVWDD
IRVWSULPDLPSULPDQWLQYHQWDW'RW0DWUL[
3ULQWHUVDXLPSULPDQWDPDWULFLDO

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

229

formulare comune
Fie
8QLWDWHGHYQ]DUHEXFLSDFKHW*UDPDMJPS
Cod
Denumire
TI19007 fi de magazie

Tipar

Format

fa/verso

A5

05
ARTICOLE DIN HRTIE

TI8099

TI8093

TI8094

Formulare salariai
TI19007

Cod
TI8093

Denumire

Unitate de vnzare

fi de instruire individual privind


securitatea i sntatea n munc

carnet 10 file

TI8094

fi individual de instructaj n domeniul carnet 10 file


situaiilor de urgen, carnet 10 file

TI8099

set dosar medical (dosar medical, fi


protecia muncii, fi PSI)

set 3 x 3 buci

Registre
7LSULWHSHKUWLHRVHWOHFDUQHW8QLWDWHGHYQ]DUHFDUQHWHVHW
Cod
TI17527

Denumire

Tipar

registru de cas

fa

A4

fa/verso

A4

fa/verso

A4

TI186273 registru intrare-ieire coresponden


TI8066
registru intrare-iesire, copert duplex
230 g/mp, hrtie interior 80 g/mp

TI17527

TI8066

Format

TI186273

Scrisoare de transport internaional


8QLWDWHGHYQ]DUHVHW0&PRGXOFRQWLQXX
Cod
TI23011

Denumire

Dimensiuni

TI23011

230

Exemplare Ambalare

CMR, color, FV, 5 exemplare 240 mm x 12 5 MC

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

400 seturi/cutie

formulare comune
Formulare pe hrtie offset
OHFDUQHW8QLWDWHGHYQ]DUHFDUQHWHVHW
Cod
TI120273

Denumire

Tipar

Format

dispoziie de plat ctre casierie

fa/verso

$

TI10327

bon predare transfer-restituire

fa/verso

2/A4

TI10527

bon consum colectiv

fa/verso

2/A4

TI12927

dispoziie de livrare

fa/verso

A5

TI14127

foaie de parcurs autovehicule marf

fa/verso

A5

ordin deplasare delegaie


TI123203* decont cheltuieli
TI14027
foaie de parcurs autovehicule marf

fa/verso

A5

fa/verso

A5

TI14227

fa/verso

A4

foaie de parcurs autovehicule persoane fa/verso

A4

TI117173* condic de prezen


TI15907
not de intrare-recepie

fa/verso

A4

fa

A4

TI16627

fa

A4

raport gestiune zilnic

05
ARTICOLE DIN HRTIE

TI16027

TI120273

TI10327

OHFDUQHW

TI10527

TI12927

TI123203

TI16027

TI14127

TI14227

TI14027
TI117173

TI15907
TI16627

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

231

formulare comune
Formulare pe hrtie autocopiativ, 2 exemplare alb-color
VHWXULFDUQHW8QLWDWHGHYQ]DUHFDUQHWHSDFKHW

TI21421

TI810603

ARTICOLE DIN HRTIE

05

Cod
TI21421

Denumire

Tipar

Format

bon de consum

fa

3/A4

TI22921

not de intrare-recepie

fa

A4

TI22621

not de recepie i constatare diferene fa

A4

TI22721

registru de cas

fa

A4

TI810603

monetar

fa

$

Format

NOT DE INTRARE RECEPIE I CONSTATARE DE DIFERENE


Unitatea ..........................
.........................................

Data
Numr
document

Luna

Ziua

Factur
Nr.
Aviz de nsoire a mrfii

Anul

Subsemnaii membrii comisiei de recepie am procedat la recepionarea valorilor materiale furnizate de ...............................................................................................................
.........................................................................................din ..................................................cu vagonul/auto nr. ...................................................................................................
Documente nsoitoare ...........................................delegat .........................................................constatndu-se urmtoarele: ................................................................................
Nr.
crt.

Denumirea
bunurilor recepionate

U.M.

Cantitate
conform documente

Recepionat
Pre unitar

Cantitate

Valoare

Comisia de recepie
Numele i prenumele

Primit n gestiune
Data

Semntura

Semntura

14-3-1 A t2

TI22921

Furnizor: ...............................................
Nr.ord.registru.com/an: ..........................
C.I.F.: .......................................................
C.U.I.: .....................................................
Sediul (localitate, str.,nr.): .......................
..................................................................
Judeul: ....................................................
Contul: ......................................................
Banca: ......................................................
Capital social: ..........................................

Nr.

Seria

TI22721

TI22621

Cumprtor ...............................................
...................................................................
(denumire,form juridic)

Nr. ......................................................................

Nr.ord.registru.com/an .............................
C.I.F. ......................../C.U.I......................
Sediul .......................................................
Judeul ......................................................
Contul .......................................................

Data (ziua, luna, anul) ........................................

Banca ........................................................

AVIZ DE NSOIRE A MRFII

Nr.
crt.

Specificaia
(produse, ambalaje, etc.)

U.M.

Cantitatea
livrat

Preul unitar
(fr T.V.A.)
- lei -

Valoarea
- lei -

Formulare pe hrtie autocopiativ


VHWXULFDUQHW8QLWDWHGHYQ]DUHFDUQHWHSDFKHW

Semntura i
tampila
furnizorului

Date privind expediia


Numele delegatului .................................................
Buletinul/cartea de identitate
seria ........ nr. ................... eliberat() .....................
Mijlocul de transport .......... nr. ................................
Expedierea s-a efectuat n prezena noastr la
data de ....................................... ora ......................
Semnturile

Total

Cod
TI8100

Denumire

Tip

culori

Tipar

aviz de nsoire a mrfii

3 exemplare

alb/color/color

fa

A4

TI8101

aviz de nsoire a mrfii

3 exemplare

alb/color/color

fa

A5

TI8102

chitanier

2 exemplare

alb/color

fa

$

TI8103

chitanier

3 exemplare

alb/color/color

fa

$

TI8104

facturier

3 exemplare

alb/color/color

fa

A5

Semntura
de primire

TI810003

Furnizor: ............................................
Nr.ord.registru.com/an: .......................
C.I.F.: ....................................................
C.U.I.: ..................................................
Sediul (localitate, str.,nr.): ....................
...............................................................
Judeul: .................................................
Contul: ...................................................
Banca: ...................................................
Capital social: .......................................

Nr.

Seria

Cumprtor ..............................................
....................................................................
(denumire,form juridic)

Nr.ord.registru.com/an .............................

AVIZ DE NSOIRE A MRFII

C.I.F. ......................../C.U.I......................
Sediul .......................................................
Judeul ......................................................

Nr. ...................................................................

Contul .......................................................

Data (ziua, luna, anul) .....................................

Banca ........................................................

Nr.
crt.

Specificaia
(produse, ambalaje, etc.)

U.M.

Cantitatea
livrat

Preul unitar
(fr T.V.A.)
- lei -

Valoarea
- lei -

Semntura i
tampila
furnizorului

Date privind expediia


Numele delegatului .................................................
Buletinul/cartea de identitate
seria ........ nr. ................... eliberat() .....................
Mijlocul de transport .......... nr. ................................
Expedierea s-a efectuat n prezena noastr la
data de ....................................... ora ......................
Semnturile

Total
Semntura
de primire

TI8101

Unitatea ..................................................
C.I.F. ......................./C.U.I. ....................
Nr de nmatriculare n Registrul
comerului/anul: .....................................
Sediul (localitatea, str.,nr.): ...................
...............................................................
Judeul: .................................................

Seria

Unitatea ..................................................
C.I.F. ......................./C.U.I. ....................
Nr de nmatriculare n Registrul
comerului/anul: .....................................
Sediul (localitatea, str.,nr.): ...................
...............................................................
Judeul: .................................................

Nr

CHITANA Nr. ............................


din data de ........................... 20 ..........

Seria

Nr

CHITANA Nr. ............................


din data de ........................... 20 ..........

Am primit de la ...............................................................................

Am primit de la ...............................................................................

Adresa ............................................................................................

Adresa ............................................................................................

C.I.F. ............................ Nr.n.Reg.Com/An ..................................

C.I.F. ............................ Nr.n.Reg.Com/An ..................................

Suma de .................................... adic ...........................................

Suma de .................................... adic ...........................................

........................................................................................................

........................................................................................................

reprezentnd ..................................................................................

reprezentnd ..................................................................................

Casier,

Casier,

TI8102

TI8103

Furnizor: ......................................................

Seria

nr.

Nr.ORC/an: .................................................
C.I.F.: ......................./C.U.I. .........................
Sediul (localitate, str.,nr.): ............................
.......................................................................
Judeul: ........................................................
Contul: ..........................................................

?
232

TIAI C?
)LEUHOHGHKUWLHSRWUHIRORVLWH
GHSQODRULLDUFHOHGH
FDUWRQGHSQODRUL"

FACTUR

Cumprtor .......................................................
...........................................................................
(denumire,form juridic)

Nr. facturii .........................................................


Data (ziua, luna, anul) ........................................

Banca: .........................................................

Nr. aviz nsoire a mrfii (dac este cazul)

Capital social: ...............................................

...........................................................................

Cota T.V.A. ............................%


Nr.
crt

Denumirea produselor
sau a serviciilor

Semntura
i tampila
furnizorului

U.M. Cantitatea
2

Pre unitar
(fr T.V.A.)
-lei-

Valoarea
-lei-

Valoarea
T.V.A.
-lei-

5(3x4)

Date privind expediia:


Numele delegatului .....................................................................
B.I./C.I.seria...........nr....................eli.berat()..............................
Mijlocul de transport ....................... nr. .....................................
Expedierea s-a efectuat n prezena noastr la
data de ................................... ora ...............................................
Semnturile .................................................................................

Nr.ord.registru.com/an ......................................
C.I.F. ............................../C.U.I.........................
Sediul ................................................................
Judeul ..............................................................
Contul ...............................................................
Banca ................................................................

Total
din care:
accize
Semntura
de primire

X
Total de plat
(col.5+col.6)

TI8104

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

plicuri pentru coresponden

SFATUL SPECIALISTULUI
CARACTERISTICILE PLICURILOR
Dimensiunile
plicurilor

ARTICOLE DIN HRTIE

05

VXQWQFRQFRUGDQFX
GLPHQVLXQLOHLQWHUQDLRQDOH
DOHKUWLHL

Modaliti de lipire
GLIHUQIXQFLHGHWLSXOGH
DGH]LYIRORVLW
Gumat
QFKLGHUHDSOLFXOXLVHIDFHSULQ
XPH]LUHDVXSUDIHHLJXPDWH

Autoadeziv
QFKLGHUHDVHUHDOL]HD]SULQ
VXSUDSXQHUHDVXSUDIHHORU
DFRSHULWHFXDGH]LY

Band silicon
QFKLGHUHDSOLFXOXLVHIDFHSULQ
QGHSUWDUHDEHQ]LLFDUHDFRSHU
VXSUDIDDVLOLFRQLF/LSLUHDVHUHDOL]HD]
SULQVLPSODVXSUDSXQHUHDFODSHORU

Gramajul hrtiei plicurilor


JUDPDMXOKUWLHLSOLFXULORUVHH[SULPQJUDPHPHWUXSWUDW
FXFWJUDPDMXOHVWHPDLPDUHFXDWWUH]LVWHQDSOLFXOXLHVWHPDLULGLFDW
([LVWLSOLFXULFXRJUHXWDWHUHGXVGDUFDUHVXQWVSHFLDOWUDWDWHDVWIHOQFWVDLERUH]LVWHQVSRULW3HQWUXRELHFWHOHYROXPLQRDVH
VHUHFRPDQGSOLFXULOHFXEXUGXI

2.

Plicuri cu fereastr poziionarea ferestrei

1. QOLPHDIHUHVWUHL

3R]LLDIHUHVWUHLVHGHWHUPLQIXQFLHGH
QOLPHDIHUHVWUHL
OLPHDIHUHVWUHL
GLVWDQDIDGHODWXUDGLQVWQJD
GLVWDQDIDGHODWXUDGHMRV

GLVWDQDIDGH
ODWXUDGHMRV

OLPHDIHUHVWUHL

DL

DL

KF20221
KF20225

C4

4.

3.
GLVWDQDIDGHODWXUD
GLQVWQJD

C5
KF20211
KF20215

KF30325

KF30355

Plicuri albe cu fereastr pentru coresponden


Cod

Gramaj

Tipar
Mod de lipire
interior

Unitate de
vnzare

Detalii suplimentare

DL 110 x 220 mm

C4
KF30345

234

KF20225

80 g/mp

da

band silicon

100 buci/set

fereastr stnga, 35 x 90 mm

KF20215

80 g/mp

da

band silicon

100 buci/set

fereastr dreapta, 35 x 90 mm

KF20221
KF20211

80 g/mp

da

autoadeziv

1000 buci/cutie

fereastr stnga, 45 x 90 mm

80 g/mp

da

autoadeziv

1000 buci/cutie

fereastr dreapta, 45 x 90 mm

&[PP
KF30325
80 g/mp

da

autoadeziv

500 buci/cutie

fereastr dreapta, 35 x 90 mm

C4 229 x 324 mm
KF30345
80 g/mp

da

band silicon

250 buci/cutie

fereastr stnga, 50 x 100 mm

KF30355

da

band silicon

250 buci/cutie

fereastr dreapta, 50 x 100 mm

80 g/mp

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

plicuri pentru coresponden

ARTICOLE DIN HRTIE

05

Plicuri albe pentru coresponden


Cod

Gramaj

Tipar interior

Mod de lipire

Unitate de vnzare

Detalii
suplimentare

&[PP
KF11110

80 g/mp

da

gumat

25 buci/set

clap V

KF11111

70 g/mp

da

gumat

1000 buci/cutie

clap V

KF10210

80 g/mp

da

autoadeziv

25 buci/set

clap dreapt

KF10211

70 g/mp

da

autoadeziv

1000 buci/cutie

clap dreapt

KF10100

80 g/mp

da

band silicon

25 buci/set

clap dreapt

KF10101

70 g/mp

da

band silicon

1000 buci/cutie

clap dreapt

DL 110 x 220 mm
KF2110

70 g/mp

gumat

25 buci/set

KF2111

80 g/mp

gumat

1000 buci/cutie

KF20200

80 g/mp

da

autoadeziv

25 buci/set

KF20201

80 g/mp

da

autoadeziv

1000 buci/cutie

KF20300

80 g/mp

da

band silicon

25 buci/set

KF20301

80 g/mp

da

band silicon

1000 buci/cutie

&[PP
KF30310

80 g/mp

da

autoadeziv

25 buci/set

lipire latura lung

KF30315

70 g/mp

da

autoadeziv

500 buci/cutie

lipire latura lung

KF30300

80 g/mp

da

band silicon

25 buci/set

lipire latura lung

KF30305

80 g/mp

da

band silicon

500 bucicutie

lipire latura lung

Plicuri pentru CD-uri


3OLFXULSHQWUX&'XULSUHY]XWHFXIHUHDVWUWUDQVSDUHQWDYQGGLDPHWUXOGHPP
+UWLHRVHW
Cod
KF1020

Gramaj

Dimensiuni plic (mm)

Mod de lipire

90 g/mp

124 x 127

gumat

Unitate de vnzare
25 buci/set

KF10025

90 g/mp

124 x 127

fr adeziv

25 buci/set

KF10021

90 g/mp

124 x 127

fr adeziv

1000 buci/cutie

3OLFXULOHVXQWDFRSHULWHSHLQWHULRUFXXQVWUDWGHFXORDUH$FHDVWSURFHGXUVHDSOLFGHRELFHLSOLFXULORUDOEHUHDOL]DWHGLQKUWLHGH
JUDPDMVF]XWLDUHFDVFRSVFGHUHDJUDGXOXLGHWUDQVSDUHQDKUWLHL$YDQWDMXOSULQFLSDODOWLSDUXOXLLQWHULRUHVWHUHSUH]HQWDWGH
VSRULUHDJUDGXOXLGHFRQGHQLDOLWDWHSURWHMQGDVWIHOLQIRUPDLLOHGLQLQWHULRUXOSOLFXULORU

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

235

plicuri pentru documente


Plicuri albe pentru documente
3OLFXULSHQWUXGRFXPHQWHGLQKUWLHRVHW&ODSSHODWXUDVFXUW
Cod

ARTICOLE DIN HRTIE

05

Gramaj

Mod de lipire

Unitate de vnzare

&[PP
KF31110

80 g/mp

gumat

25 buci/set

KF31115

80 g/mp

gumat

500 buci/cutie

KF30220

90 g/mp

autoadeziv

25 buci/set

KF30225

90 g/mp

autoadeziv

500 buci/cutie

KF30200

80 g/mp

band silicon

25 buci/set

KF30205

80 g/mp

band silicon

500 buci/cutie

C4 229 x 324 mm
KF51110

80 g/mp

gumat

25 buci/set

KF51119

90 g/mp

gumat

250 buci/cutie

KF50220

90 g/mp

autoadeziv

25 buci/set

KF50222

90 g/mp

autoadeziv

250 buci/cutie

KF50320

90 g/mp

band silicon

25 buci/set

KF50322

90 g/mp

band silicon

250 buci/cutie

B4 250 x 353 mm
KF60225

90 g/mp

autoadeziv

250 buci/cutie

KF60205

100 g/mp

band silicon

250 buci/cutie

Plicuri din hrtie kraft pentru documente


3OLFXULSHQWUXGRFXPHQWHGLQKUWLHQDWXU&ODSSHODWXUDVFXUW

236

Cod

Gramaj (g/mp)

Mod de lipire

&[PP
KF30115

70 g/mp

gumat

500 buci/cutie

KF30210

90 g/mp

autoadeziv

25 buci/set

KF30215

90 g/mp

autoadeziv

500 buci/cutie

KF30100

90 g/mp

band silicon

25 buci/set

KF30105

90 g/mp

band silicon

500 buci/cutie

C4 229 x 324 mm
KF50110

90 g/mp

gumat

25 buci/set

KF50112

90 g/mp

gumat

250 buci/cutie

KF50210

90 g/mp

autoadeziv

25 buci/set

KF50212

90 g/mp

autoadeziv

250 buci/cutie

KF50100

90 g/mp

band silicon

25 buci/set

KF50102

90 g/mp

band silicon

250 buci/cutie

B4 250 x 353 mm
KF60210

110 g/mp

autoadeziv

25 buci/set

KF60100

90 g/mp

band silicon

25 buci/set

KF60105

90 g/mp

band silicon

250 buci/cutie

E4 280 x 400 mm
KF60305

120 g/mp

gumat

250 buci/cutie

EXTRA 350 x 450 mm


KF60405

90 g/mp

gumat

250 buci/cutie

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Unitate de vnzare

plicuri speciale
Plicuri cu protecie
3OLFXULFXEDQGVLOLFRQ
Culoare hrtie

KF70010
KF70015
KF70100
KF70105
KF70110
KF70115
KF70300
KF70305
KF70310
KF70315
KF70400
KF70405
KF70410
KF70415

alb
alb
maro
maro
alb
alb
maro
maro
alb
alb
maro
maro
alb
alb

Dimensiuni interior
(mm)
150 x 215
150 x 215
[
[
[
[
220 x 340
220 x 340
220 x 340
220 x 340
270 x 370
270 x 370
270 x 370
270 x 370

Unitate de vnzare
5 buci/set
100 buci/cutie
5 buci/set
100 buci/cutiet
5 buci/set
100 buci/cutie
5 buci/set
100 buci/cutie
5 buci/set
100 buci/cutie
5 buci/set
100 buci/cutie
5 buci/set
100 buci/cutie

3OLFXULOHFXSURWHFLHVXQWH[WUHPGHUH]LVWHQWHODUXSHUHJDUDQWQGSURWHFLHPD[LPFROHWHORUWDOH6XQWLGHDOHSHQWUXRELHFWHOHIUDJLOH
EDQGDVLOLFRQLFDVLJXUQGXQSOXVGHSURWHFLHFRQLQXWXOXLSOLFXOXLSULQVLJLODUHIHUP3ODVWLFXOGLQLQWHULRUHVWHQHWHGIDFLOLWQG
LQWURGXFHUHDSURGXVHORUQSOLF+UWLDNUDSHUPLWHVFULHUHDGHPQLPSULPDUHDIRORVLUHDGHHWLFKHWHVDXWDPSLODUHDSOLFXOXL

05
ARTICOLE DIN HRTIE

Cod

Plicuri cu burduf
3OLFXULFXEDQGVLOLFRQ5HDOL]DWHGLQKUWLHNUD
Cod

Gramaj

KF30131

120 g/mp

Dimensiuni plic
(mm)
[

KF30136
KF40131
KF40136
KF80131
KF80135
KF50131
KF50135
KF60131
KF60136
KF70131
KF70135
KF80141
KF80145
KF80151
KF80155

120 g/mp
120 g/mp
90 g/mp
120 g/mp
120 g/mp
130 g/mp
130 g/mp
130 g/mp
130 g/mp
120 g/mp
120 g/mp
120 g/mp
120 g/mp
120 g/mp
120 g/mp

[
175 x 250
175 x 250
229 x 324
229 x 324
229 x 324
229 x 324
250 x 353
250 x 353
250 x 353
250 x 353
250 x 353
250 x 353
250 x 353
250 x 353

Dimensiuni
burduf (mm)
20

Unitate de vnzare
10 buci/set

20
20
20
30
30
40
40
40
40
50
50
100
100
150
150

250 buci/cutie
10 buci/set
250 buci/cutie
10 buci/set
100 buci/cutie
10 buci/set
100 buci/cutie
10 buci/set
250 buci/cutie
10 buci/set
100 buci/cutie
10 buci/set
100 buci/cutie
10 buci/set
100 buci/cutie

Plicuri port documente


3OLFXULGLQSODVWLFLPSHUPHDELOHIDDGH]LY6XQWLGHDOHSHQWUXWUDQVSRUWXODFWHORUDIHUHQWH
GLYHUVHORUFROHWH6HOLSHVFSHSDUWHDODWHUDODFROHWHORULSRWVLJLODWH
Cod
KF80225

DL (110 x 220)

Dimensiuni (mm)

1000 buci/cutie

KF80235

& [

1000 buci/cutie

KF80240

C4 (324 x 229)

500 buci/cutie

Unitate de vnzare

Oricare ar fi meseria ta, avem produsul potrivit.

237

etichete autoadezive

povestea unei mrci


$3/,3$3(5RFRPSDQLHUHFXQRVFXWODQLYHOPRQGLDOFDXQXOGLQWUHFHLPDLLPSRUWDQLSURGXFWRULGHHWLFKHWH
DXWRDGH]LYHLDUWLFROHGHSDSHWULHQFGHODIRQGDUHDVDQ$3/,DXUPULWPDWHULDOL]DUHDYL]LXQLLXQXL
PHGLXGHELURXLGHDOED]DWSHLQRYDUHXQVHUYLFLXH[FHOHQWLSURGXVHHXURSHQHGHQDOWFDOLWDWH&XDFHDVW
ORVRH$3/,GHGLFQWUHDJDVDDFWLYLWDWH]LOQLFSHQWUXDVDWLVIDFHGLQFHQFHPDLHFLHQWLH[LJHQWQHYRLOH
FRQVXPDWRUXOXLQDO

ARTICOLE DIN HRTIE

05

$3/,3$3(5DUHPDLPXOWGHGHSHUVRDQHDQJDMDWHQOLDOHOHVDOHGLQ6SDQLD)UDQD%HOJLD3RUWXJDOLDL
5XVLD3HQWUXDIDFHIDFHUHULLQFUHWHUHGHDUWLFROHGHSDSHWULHGHQDOWFDOLWDWH$3/,DH[WLQVIDFLOLWLOHVDOHGH
SURGXFLHQDQXOLHVWHXQDGLQWUHSXLQHOHFRPSDQLLHXURSHQHFDUHSURGXFHFOLSVXULLDOWHSURGXVHPHWDOLFH
$VW]L$3/,RIHUFHDPDLODUJJDPGHHWLFKHWHSHQWUXSLDDVSDLLORUGHELURXSHQWUXFRDOVDXSHQWUXX]
FDVQLF)LHFVXQWHLQFXWDUHDXQHLHWLFKHWHFXVFRSVWDQGDUGVDXVSHFLF$3/,OHSRDWHRIHULSHWRDWHQJDPD
$3/,SXWHLJVLHWLFKHWHDYQGFROXULOHGUHSWHVDXURWXQMLWHFXDGH]LYSHUPDQHQWVDXQHSHUPDQHQWUH]LVWHQWHOD
LQWHPSHULLWUDQVSDUHQWHWUDQVOXFLGHFRORUDWHRXUHVFHQWHRSDFHURWXQGHFKLDULWH[WLOH

Etichete autoadezive albe, coluri drepte

Cod: AL11201
48.5 x 16.9 mm
6800 etichete

Cod: AL11102
38 x 21.2 mm
6500 etichete

Cod: AL11284 Cod: AL11294


52.5 x 21.2 mm 70 x 16.9 mm
5600 etichete 5100 etichete

Cod: AL11202
Cod: AL11304
48.5 x 25.4 mm 52.5 x 29.7 mm
4400 etichete
4000 etichete

Cod: AL11270
70 x 25.4 mm
3300 etichete

Cod: AL11271
70 x 30 mm
2700 etichete

Cod: AL11406
64.6 x 33.8 mm
2400 etichete

Cod: AL11508
70 x 37 mm
2400 etichete

Cod: AL03136
70 x 42.4 mm
2100 etichete

Cod: AL11299
105 x 29 mm
2000 etichete

100
COLI

Cod: AL11298
70 x 36 mm
2400 etichete

A4

SUPER
CALITATE

Cod: AL11290
70 x 67.7 mm
1200 etichete

238

Cod: AL11288
97 x 42.4 mm
1200 etichete

Cod: AL11711
105 x 48 mm
1200 etichete

Cod: AL11712
105 x 57 mm
1000 etichete

Cod: AL11292
105 x 70 mm
800 etichete

Cod: AL11707
105 x 35 mm
1600 etichete

Cod: AL10817
105 x 37 mm
1600 etichete

Cod: AL11295
70 x 50.8 mm
1500 etichete

Cod: AL11710
105 x 42.4 mm
1400 etichete

Cod: AL11714
105 x 74 mm
800 etichete

Cod: AL11715
105 x 148 mm
400 etichete

Cod: AL11716
210 x 148 mm
200 etichete

Cod: AL11817
210 x 297 mm
100 etichete

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

etichete autoadezive

SFATUL SPECIALISTULUI
FOLOSIREA ETICHETELOR AUTOADEZIVE APLI

La prima vedere toate etichetele par s fie la fel. Apli contrazice acest lucru!
Tehnologiile i procesele folosite la producerea lor determin nivelul calitativ al etichetelor. Descoperii de ce etichetele Apli sunt
total diferite fa de restul etichetelor!

1. GRAD DE ALB

2. OPACITATE

Alte branduri
Cu ct gradul de alb este mai mare, cu att imprimarea
va fi mai bun i mai clar.

Alte branduri

Alte branduri

Cu ct opacitatea este mai ridicat, cu att textul


imprimat va fi mai vizibil, n condiiile aplicrii etichetei
pe o suprafa deja imprimat.

4. DENSITATE

Datorit adezivului de calitate al etichetelor Apli, acestea


nu se dezlipesc n momentul imprimrii, mpiedicnd
astfel blocarea imprimantei.

02'8/'($0%$/$5(

5. REZISTENA LA NDOIRE

Alte branduri
Densitatea colilor de etichete Apli este optim, pentru a
preveni alunecarea n timpul printrii, prevenind astfel
blocarea colilor n imprimant.

3. REZISTEN ADEZIV

05
ARTICOLE DIN HRTIE

&XVDXIUPDUJLQL"
(WLFKHWHOHDXWRDGH]LYHFXPDUJLQLSUH]LQWDYDQWDMXOGHDDYHDPULPHDGHSULQWDUHGHOLPLWDWH[DFW
LVXQWLGHDOHSHQWUXLPSULPDQWHQFRQGLLLOHQFDUHDFHVWHDQXSULQWHD]SQQFDSWXOSDJLQLORU
(WLFKHWHOHDXWRDGH]LYHIUPDUJLQLDFRSHUQWUHDJDSDJLQLVXQWLGHDOHSHQWUXFRSLDWRDUH)LHFDUH
WRSGHHWLFKHWH$3/,FRQLQHLQVWUXFLXQLGHXWLOL]DUHDVRXOXLGHSULQWDUHFHSRDWHGHVFUFDWJUDWXLW
GHSHZZZUWFUR
(VWHUHFRPDQGDWFDHWLFKHWHOHVHDSOLFDWHQWRWGHDXQDSHRVXSUDIDQHWHGLFXUDWOD
WHPSHUDWXULQWUH&L&SHQWUXDEHQHFLDGHSURSULHWLOHDGH]LYHFRPSOHWHDOHHWLFKHWHORU

Alte branduri

Alte branduri

Procesul tehnologic special folosit n timpul produciei


etichetelor Apli, mpiedic curbarea colilor n timpul
imprimrii.

Cartonul folosit pentru ambalarea etichetelor Apli asigur


pstrarea acestora n condiii optime de umiditate i
temperatur. Mai mult, Apli ne ofer un mod rapid de
extragere a colilor din cutie.

Etichete autoadezive albe, coluri rotunjite


0XOWLIXQFLRQDOHVHSRWXWLOL]DQFRSLDWRULPSULPDQWHODVHU
LFXMHWGHFHUQHDO)RUPDW$8QLWDWHGHYQ]DUHFROLWRS

Cod: AL02409 Cod: AL02420 Cod: AL02421 Cod: AL02422 Cod: AL02423
Cod: AL02412
64 x 33.9 mm 99.1 x 67.7 mm 99.1 x 93.1 mm 99.1 x 139 mm 199.6 x 144.5 mm 199.6 x 289.1 mm
2400 etichete 800 etichete
600 etichete
400 etichete
200 etichete
100 etichete

100
COLI

A4

TIAI C?
$FKL]LLRQQGHWLFKHWHDXWRDGH]LYHFHUWLFDWH
)6& )RUHVW6WHZDUGVKLS&RXQFLO FRQWULEXLL
ODSURWHFLDPHGLXOXLQFRQMXUWRU3HQWUX
HFDUHFRSDFWLDW$3/,SODQWHD]DOWXO
(WLFKHWHOH$3/,VXQWFHUWLFDWH)6&

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

239

etichete autoadezive

Etichete textile de identificare

Cod: AL12252
63.5 x 29.6 mm
540 etichete

ARTICOLE DIN HRTIE

05

20

A4

COLI

1XXWLOL]DLHWLFKHWHOHSH
PDWHULDOHGLQPWDVH
SLHOHVDXFDWLIHD

(WLFKHWHOHGHLGHQWLFDUHVXQWUHDOL]DWHGLQWUXQPDWHULDOWH[WLOFHSUH]LQWXQ
DVSHFWLPSHFDELO$GH]LYXOIRORVLWHVWHVSHFLDOLQXDWDFHVWXUDSHFDUHVXQW
DSOLFDWHH[FHSLHIFQGSLHOHDQDWXUDOFDWLIHDXDLPWDVHD6HSRWVFULH
GHPQVDXLPSULPD6XQWLGHDOHSHQWUXWUDLQLQJXULFRQYHQLLFRQJUHVH
VDXWHDPEXLOGLQJXUL(WLFKHWHOHGHLGHQWLFDUHVXQWYDULDQWDHFRQRPLFD
HFXVRDQHORU)RUPDW$8QLWDWHGHYQ]DUHFROLWRS

SFATUL SPECIALISTULUI
UTILIZAREA ETICHETELOR APLI
(WLFKHWHOHWH[WLOH$SOLVXQWSRWULYLWHSHQWUXHVWXULGHOLFDWH
LVXQWVROXLDLGHDOSHQWUXFRQIHULQHLFRQYHQLL

Etichete autoadezive
rezistente la intemperii
(WLFKHWHDOEHGLQSROLHVWHUUH]LVWHQWHODYDULDLLOHGHWHPSHUDWXU(WLFKHWHOH
VXQWUH]LVWHQWHODWHPSHUDWXULFXSULQVHQWUH&L&DSXPLGLWDWH
SUDILFRQGLLLH[WUHPH5HFRPDQGDWHXWLOL]ULLH[WHULRDUHSHQWUXLGHQWLFDUHD
PDWHULDOHORULQGXVWULDOHHOHFWULFHHWF3HQWUXLPSULPDQWHODVHULFRSLDWRDUH
)RUPDW$8QLWDWHGHYQ]DUHFROLWRS

20

A4

COLI

Cod: AL01226
64.6 x 33.8 mm
480 etichete

Cod: AL01227
105 x 148 mm
80 etichete

Cod: AL01228
210 x 297 mm
20 etichete

Etichete autoadezive
translucide
(WLFKHWHWUDQVSDUHQWHSHQWUXLPSULPDQWHODVHULFRSLDWRDUH5HDOL]DWHGLQ
SROLHVWHULUH]LVWHQWHODLQWHPSHULL,GHDOHSHQWUXFRUHVSRQGHQSRVWHUH
SURPRLRQDOHHWF)RUPDW$8QLWDWHGHYQ]DUHFROLWRS

44

20

A4

COLI

240

Cod: AL01223
48.5 x 25.4 mm
880 etichete

Cod: AL01224
70 x 37 mm
480 etichete

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Cod: AL01225
210 x 297 mm
20 etichete

etichete autoadezive
Etichete autoadezive multimedia

(WLFKHWHSHQWUX&''9'5H]LVWHQWHODWHPSHUDWXULQDOWH
8QLWDWHGHYQ]DUHFROLVHW
Cod: AL02001
GLDPHWUXOH[WHULRUPP
GLDPHWUXOLQWHULRUPP
HWLFKHWH

05

ARTICOLE DIN HRTIE

Cod
AL02001

TIAI C?
)LHFDUHFRDOGHHWLFKHWH$3/,HVWH
PDUFDWFXXQFRGFHSHUPLWH
LGHQWLFDUHDUDSLGDXQXLORWGHIHFW

25
COLI

A4

/(,7=,&216,67(0,17(/,*(17'((7,&+(7$5(/$
)(/'(',*,7$/35(&805(678/81,9(568/8,78
6LVWHPXOLQWHOLJHQWGHHWLFKHWDUH/HLW],FRQUHYROXLRQHD]PRGXOQFDUHIDFHL
HWLFKHWH3XWHLLPSULPDHWLFKHWHSHQWUXSOLFXULGHFRUHVSRQGHQSDFKHWHL
FROHWHSHQWUXLQYHQWDULFKLDULEDQQHUHODRYLWH]GHSQODHWLFKHWH
SHPLQXW

VEZI MAI MULTE


DETALII LA
PAGINILE 78-79!

Etichete multifuncionale

RH1000
210 x 297 mm
100 etichete

RH1001
210 x 148 mm
200 etichete

RH1009
105 x 57 mm
1000 etichete

RH1011
105 x 42.4 mm
1400 etichete

RH1002
105 x 148 mm
400 etichete

RH1008
105 x 35 mm
1600 etichete

RH1003
105 x 74 mm
800 etichete

RH1004
70 x 42.4 mm
2100 etichete

(WLFKHWHDXWRDGH]LYHDOEHSHQWUXLPSULPDQWHODVHUFXMHWGHFHUQHDOL
FRSLDWRDUH'LVSRQLELOHQWURJDPYDULDWGHGLPHQVLXQLFXFROXULGUHSWH
JDWDVUVSXQGWXWXURUFHULQHORUFRQVXPDWRULORU
8WLOL]ULGLYHUVHHWLFKHWDUHSURGXVHFRGXULGHEDUHSUHXULLQYHQWDULHUH
FRUHVSRQGHQLFRGLFDUH
)RUPDW$8QLWDWHGHYQ]DUHFROLWRS

RH1005
70 x 37 mm
2400 etichete

CALITATE
PRE

A4

100
COLI

RH1012
64.6 x 33.8 mm
2400 etichete

RH1006
52.5 x 29.7 mm
4000 etichete

RH1010
48.5 x 25.4 mm
4400 etichete

RH1007
38 x 21.2 mm
6500 etichete

RH1013
48.5 x 16.9 mm
6800 etichete

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

241

notie autoadezive
Notie autoadezive Post-it Super Sticky
1RWLHFXXQDGH]LYIRDUWHSXWHUQLFSR]LLRQDELOHSHQXPHURDVHVXSUDIHHYLQLOLQ
OHPQSODVWLFPHWDOVWLFOFDUWRQ1RWLHOHSRWUHSR]LLRQDWHGHSQODRUL
LHVWHLGHDOXWLOL]DUHDORUSHVXSUDIHHYHUWLFDOHFRPSR]LLDXQLFDDGH]LYXOXL
SHUPLQGDGHUDUHDXQLIRUPSHRULFHVXSUDIDIUDOVDXUPHGHDGH]LYOD
QGHSDUWDUHDORU3RVWLW6XSHU6WLFN\QXVHFXUEHD]LHVWHLGHDOSHQWUXDVFULHSH
HO$VLJXUPD[LPXPGHYL]LELOLWDWHQWLPSUHFRPDQGDWHDWWODELURXFWLSH
WHUHQ'LPHQVLXQL[PP
Cod
3M1076778

Caracteristici

3M1076783

5 buci/set, 90 file/bucat, culori neon asortate

galben narcis, 90 file/bucat

ARTICOLE DIN HRTIE

05

Dispenser pentru Post-it Z-Notes

Z-Notes

'LVSHQVHUWUDQVSDUHQW2IHUELURXOXLRQRWGLVWLQFWSVWUQGQDFHODLWLPS
QRWLHOHDGH]LYH3RVWLWODQGHPQ6HOLYUHD]FXXQVHWGHQRWLH=1RWHV
JDOEHQH'LPHQVLXQL[PP
Cod
3M110039

Produs

Culoare file

dispenser + 1 rezerv

galben

Notie autoadezive Post-it Z-Notes

Z-Notes

([FHOHQWHSHQWUXFRPXQLFDUHDPHVDMHORULPSRUWDQWHLQWRWGHDXQDODQGHPQ
SULQGLVSXQHUHDQ]LJ]DJLQGXRUGHIRORVLWFXRVLQJXUPQ
$GH]LYXOSHUPLWHUHSR]LLRQDUHDQRWLHORU1RWLHOHVXQWUH]HUYHSHQWUXGLVSHQVHU
'LPHQVLXQL[PP8QLWDWHGHYQ]DUH[OHEXFDW
Cod
3M767600

Nr file

Culoare file

500 + 100 bonus galben/mov/roz/


portocaliu/verde neon

3M11065

100

roz/galben neon

3M1076763

100

galben neon

Post-it Z-Notes.
Notiele adezive mereu la ndemn!

242

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

notie autoadezive

05

Notie autoadezive liniate Post-it


Canary Yellow

Notie autoadezive liniate Post-it neon

1RWLHDXWRDGH]LYHOLQLDWHSHQWUXPHVDMHOXQJLDGQRWUL
'LPHQVLXQL[PP&XORDUH&DQDU\<HOORZ
8QLWDWHGHYQ]DUHOHEXFDW

,GHDOHSHQWUXPHVDMHVWUXFWXUDWHSHUPLWFLWLUHDUDSLGDLQIRUPDLHL
QIRUPDWFODUSODQLFDWPULQGHFLHQDODELURXLSHWHUHQ
'LYHUVHFXORUL'LPHQVLXQL[PP

Cod
3M11028

Cod
3M11051

Unitate de vnzare

Culori

100 file/bucat

 verde/galben/roz

ARTICOLE DIN HRTIE

SUPER
CALITATE

Notie autoadezive liniate


1RWLHDXWRDGH]LYHJDOEHQHOLQLDWXUGLFWDQGRDOEDVWUFHDMXWOD
VFULHUHDQJULMLWXQLIRUPLRUJDQL]DWDPHVDMHORU
'LPHQVLXQL[PP8QLWDWHGHYQ]DUHOHEXFDW
Cod
AL013370

Notie autoadezive Post-it


cu forme pretiate
'HVFRSHUFRPELQDLDLGHDOQWUHPHVDMFXGHGLFDLHFXORDUHLGLPHQVLXQH
FDUHWHDMXWVFRPXQLFLHFLHQWLSOFXW'IUXOLEHULPDJLQDLHLWDOHLODV
PHVDMHOHVLDVGLQWLSDUH8QLWDWHGHYQ]DUHOHEXFDW'LYHUVHFXORUL
Cod
3M11018

Form

3M11020

idee

3M1102746

floare

sgeat

Notie autoadezive
forme pretiate
8QPRGLQHGLWGHWUDQVPLWHUHDLQIRUPDLLORU$GH]LYSXWHUQLFUHSR]LLRQDELO
)RUPHYDULDWHGLYHUVHFXORUL
8QLWDWHGHYQ]DUHOHEXFDW
Cod
KS879031

Form

KS879032

sgeat

KS879033

inim

idee

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

CALITATE
PRE

243

notie autoadezive
Cub notie autoadezive Post-it
*DPDGHFXORULDQRWLHORUDGH]LYH3RVWLWHYROXHD]RGDWFXPRGDLJXVWXULOH
FRQVXPDWRULORU&XORULOHSOFXWHPELQHPRLRQDOXOLIXQFLRQDOLWDWHD
3DOHWDODUJGHFXORULSHUPLWHFRGLFDUHDPHVDMHORU
'LPHQVLXQL[PP
8QLWDWHGHYQ]DUHOHEXFDW

ARTICOLE DIN HRTIE

05

PASTEL

Cod
3M110133

Culoare

3M110134

verde pastel

3M110135

albastru pastel

3M110131

roz/galben/portocaliu/verde, culori neon

3M110132

verde/galben/albastru, culori neon

roz pastel

NEON

1XWRDWHQRWLHOHDGH]LYHVXQWODIHO
$OHJHQRWLHDGH]LYHRULJLQDOH3RVWLW

3M000470

3M000471

3M000472

3M000473

Notie autoadezive Post-it


neon asortate
&XORULHQHUJL]DQWHDVRUWDWHSRWULYLWHSHQWUXPHVDMHOHLPSRUWDQWHGHPHPRUDW
VDXFRPXQLFDW$OHJHOHSHFHOHFDUHVHSRWULYHVFFHOPDLELQHPHVDMHORUL
SHUVRQDOLWLLWDOH'LPHQVLXQL[PPOHEXFDW

244

Cod
3M000470

Sortiment

Unitate de vnzare

culori neon

EXFLVHW

3M000471

culori neon

EXFLVHW

3M000472

culori pastel

EXFLVHW

3M000473

culori pastel

EXFLVHW

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

notie autoadezive
Minicub notie autoadezive Post-it
0LFLGDUYL]LELOHQFXORULSXWHUQLFHFXQXDQHGHUR]LJDOEHQOPLH
0HVDMHOHFKHLHLHVQHYLGHQ
'LPHQVLXQL[PP
8QLWDWHGHYQ]DUHOHEXFDW
Cod
3M110136

Culoare
galben/verde

ARTICOLE DIN HRTIE

05
TIAI C?
6SHQFHU6LOYHURPXOGHWLLQ0UHVSRQVDELO
SHQWUXDGH]LYXOUHSR]LLRQDELOXQLFXWLOL]DW
SHQWUXSURGXVH3RVWLWVDUHWUDVGHOD0
QFXPDLPXOWGHGHEUHYHWH68$SH
QXPHOHVX

Cub notie autoadezive


&XEQRWLHDGH]LYHVWUXFWXUDWHQFXORULSHQWUXPHVDMHDPX]DQWHLSOLQHGH
FXORDUH8QLWDWHGHYQ]DUHOHEXFDW'LPHQVLXQL[PP
Cod
AL010972

Culoare

AL010974

 nuane intense, roz/galben/verde/portocaliu

nuane pastel, roz/galben/verde/bleu

Cub notie autoadezive


&XEQRWLHDGH]LYHVWUXFWXUDWHQFXORULSHQWUXPHVDMHDPX]DQWHLSOLQHGH
FXORDUH8QLWDWHGHYQ]DUHOHEXFDW'LPHQVLXQL[PP
Cod
AL011596

Culoare
 nuane intense, roz/magenta/galben/
verde/portocaliu

Cub notie autoadezive


0DLPXOWHFXORULSHQWUXPHVDMHWUDQVPLVHQWRWGHDXQDSOFXW
'LPHQVLXQL[PP8QLWDWHGHYQ]DUHOH
Cod
AY000806

Culoare

CALITATE
PRE

 roz/galben/verde/portocaliu

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

245

notie autoadezive
Notie autoadezive
,GHDOHSHQWUXDDWUDJHDWHQLDFXXXULQDVXSUDLQIRUPDLLORULPSRUWDQWH
)DEULFDWHGLQKUWLHGHFDOLWDWHFHQXVHRQGXOHD]LDGH]LYQHSHUPDQHQW
'LPHQVLXQH[PP8QLWDWHGHYQ]DUHOHVHW
Cod
AL011896

ARTICOLE DIN HRTIE

05

Culoare
portocaliu

AL011897

galben

AL011898

magenta

AL011899

verde

Notie autoadezive neon


1RWLHFRORUFDUHDWUDJFXXXULQDWHQLDDVXSUDPHVDMHORULPSRUWDQWH
$GH]LYSXWHUQLFUHSR]LLRQDELO'LPHQVLXQL[PP
8QLWDWHGHYQ]DUHOHEXFDW
Cod
KS879041

Culoare

KS879042

magenta

KS879043

galben

KS879044

verde

portocaliu

Notie autoadezive
1RWLHFRORUSHQWUXPHVDMHLPSRUWDQWHFHVLJXUYRUUHPDUFDWH
'LPHQVLXQL[PP&XORULDVRUWDWHJDOEHQUR]YHUGH
8QLWDWHGHYQ]DUHOHEXFDW
Cod
AY000805

Notie autoadezive galben pastel


&XORDUHJDOEHQSDVWHOOHEXFDW
Cod
KS878050

40 x 50

3 buci/set

KS878075

75 x 75

1 bucat

KS878125

125 x 75

1 bucat

?
246

Dimensiuni (mm)

Unitate de vnzare

TIAI C?
$VW]LH[LVWPDLPXOWGH
GHSURGXVH3RVWLWYQGXWHQ
SHVWHGHUL

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

notie autoadezive
Notie autoadezive Post-it
Canary Yellow
&XORDUHDJDOEHQWUDGLLRQDODQRWLHORUDGH]LYH3RVWLWGHSHVWHGHDQL
&DQDU\<HOORZHVWHPDUFQUHJLVWUDW0
&XORDUHJDOEHQSDVWHOOHEXFDW
38 x 51

Dimensiuni (mm)

Unitate de vnzare
3 buci/set

3M1051760

[

1 bucat

3M1076760

[

1 bucat

3M107676

[

12 buci + 4 CADOU

3M1127760

[

1 bucat

3M1127763

[

12 buci + 4 CADOU

05

SUPER
CALITATE

ARTICOLE DIN HRTIE

Cod
3M10385101

Notie autoadezive galben pastel


1RWLHDXWRDGH]LYHSR]LLRQDELOHSHQXPHURDVHVXSUDIHHGDWRULWDGH]LYXOXLGH
FDOLWDWH1XVHFXUEHD]LSRWUHSR]LLRQDWH
&XORDUHJDOEHQSDVWHOOHEXFDW
Cod
AL010975

38 x 51

Dimensiuni (mm)

Unitate de vnzare
3 buci/set

AL010976

75 x 75

1 bucat

AL010977

125 x 75

1 bucat
CALITATE
PRE

Notie autoadezive galben pastel


&XORDUHJDOEHQSDVWHOOHEXFDW
Cod
AY000800

75 x 75

1 bucat

AY000801

75 x 125

1 bucat

AY000802

50 x 40

3 buci/set

AY000803

75 x 100

1 bucat

AY000804

50 x 75

1 bucat

Dimensiuni (mm)

Unitate de vnzare

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

247

cuburi din hrtie

SUPER
CALITATE

05
ARTICOLE DIN HRTIE

Suport pentru cub


de hrtie Vegas

Suport pentru cub de hrtie Mesh

'HVLJQPRGHUQIDFHSDUWHGLQJDPD9HJDV6HOLYUHD]PSUHXQFXGH
OHIRUPDW[PPIULQVWUXPHQWGHVFULV%D]GLQFDXFLXFSHQWUX
VWDELOLWDWHVSRULWLVXSRUWSHQWUXLQVWUXPHQWGHVFULV
'LPHQVLXQL[[PP
Cod
DB900009

6XSRUWIDEULFDWGLQPHWDOSHQWUXKUWLHIRUPDW[PP
6HOLYUHD]IUKUWLH
Cod
BV012131

Culoare

Culoare
negru

BV012132

argintiu

negru

CALITATE
PRE

CALITATE
PRE

Cub din hrtie cu suport


6XSRUWWUDQVSDUHQWSUHY]XWFXGHOHKUWLHFRORUGHGLPHQVLXQL[PP
+UWLHRVHWJPS

Cub din hrtie

Cod
FA073

GHOHGLPHQVLXQL[PP+UWLHRVHW

Rezerv pentru suport: 400 file color.


Cod
FA0741

Cod
FL696

Tip hrtie

Gramaj

alb

70 g/mp

FL6961

colorat

80 g/mp

CALITATE
PRE

CALITATE
PRE

248

Suport pentru cub din hrtie Star

Cub din hrtie

)DEULFDWGLQSODVWLF3HQWUXFXEGHKUWLHIRUPDW[PP6HOLYUHD]IUKUWLH

GHOHKUWLHEURDWH+UWLHRVHWJPS
'LPHQVLXQL[PP

Cod
AS006001

Tip
transparent

Culoare
incolor

AS006002

transparent

fumuriu

Cod
PA6297

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

caiete i blocnotesuri

povestea unei mrci

2[IRUGDUHDOL]DWLQRYDLLFDUHD]LDXDMXQVVWDQGDUGSULQWUHDOWHOHVLVWHPXOFXVSLUGXEOLFRSHUWDIRDUWHVROLGGLQPDWHULDOSODVWLF$FHVWHD
GRYHGHVFOLPSHGHFXQRWLQHOHHQHUJLDLFUHDWLYLWDWHDGHVLJQHULORUFDLHWHORUEORFQRWHVXULORULDJHQGHORU2[IRUG
'LQDQXOFDLHWHOHLEORFQRWHVXULOH2[IRUGVXQWSUH]HQWHQWRDWHYDULDQWHOHFDLHWHGHFRDOFDLHWHGHELURXEORFQRWHVXULUHJLVWUHL
QXPHURDVHDOWHSURGXVHSHQWUXFRDOVDXELURX'DWRULWJDPHLODUJLGHSURGXVHLSURPRYULLQVHPQDWHPDUFD2[IRUGHVWHDVW]LOLGHUGHSLD
HXURSHDQ,QLLDWLYD2;)25'$&76)257+(3/$1(7FDUHLQFOXGHWRDWHSURGXVHOHGHFRDOLELURXLOXVWUHD]OLPSHGHDQJDMDPHQWXOQYHGHUHD
SURWHMULLPHGLXOXLQFRQMXUWRULWUDQVPLWHULLDFHVWXLPHVDMQFGLQSULPXODQGHFRDO
AVANTAJELE MRCII

H[SHULHQDXQXLSURGXFWRUOLGHUHXURSHDQ
SURGXVHGHFDOLWDWHSULQSURFHGHXO237,.3$3(5 XWLOL]DUHDGHKUWLHGHPLQLPJODHFDUHSURGXV2[IRUGH[FHSLHIFQGGRDUXQHOHSURGXVH
GLQJDPD,QWHUQDWLRQDO
RIHUWODUJLVHJPHQWDW FDOLWDWHGHVLJQIRUPLGLPHQVLXQLGHWRDWHWLSXULOHGHODDFHODLSURGXFWRU
LQRYDUHDFRQWLQXDSURGXVHORUQVFRSXOPEXQWLULLFDOLWLLJHQHUDOHH[LVWHQWHSHSLD

05
ARTICOLE DIN HRTIE

&DLHWHOHLEORFQRWHVXULOH2[IRUGDXIRVWFRPHUFLDOL]DWHSHQWUXSULPDRDUQDQLL$VW]LFRODULLOLFHHQLLVWXGHQLLLSHUVRQDOXOGHELURXULGLQ
QWUHDJD(XURSXWLOL]HD]PLOLRDQHGHFDLHWHLEORFQRWHVXUL2[IRUG6XFFHVXOFDLHWHORULEORFQRWHVXULORU2[IRUGFRQVWQIDSWXOFVHULGLFPHUHX
ODQOLPHDDWHSWULORUFXPSUWRULORU
&HLFDUHFUHHD]SURGXVHOH2[IRUGFUHGFXFRQYLQJHUHFHFDUHSHUVRDQPHULWXQFDLHWXQEORFQRWHVVDXRDJHQGGHFDOLWDWHFDUHVDVLJXUH
FHOHPDLEXQHUH]XOWDWHODFRDOVDXQELURX$YHPQHYRLHGHPXOWQFUHGHUHQQRLGDFYUHPVDYHPVXFFHVODFRDOVDXGHDOXQJXOFDULHUHL
SURIHVLRQDOH3URGXVHOH2[IRUGQHDMXWRIHULQGVROXLLLQWHOLJHQWHLXRUGHXWLOL]DWSHFDUHVOHIRORVLPEXFXURLQHFDUH]L

CALITATEA ESTE PTRUNZTOARE, NU CERNEALA


2;)25'DFUHDWSURSULXOVXVWDQGDUGSHQWUXKUWLHDOFUXLQXPHHVWH237,.3$3(5$FHDVWKUWLHVSHFLDOSHUPLWHFDGDWRULWQHWH]LPLL
VFULVXOGHPQVGHYLQRDGHYUDWSOFHUH0XOXPLWKUWLHLGHFDOLWDWHVSHFLDOSXWHPVFULHSHambele pri ale filei, fr ca
cerneala s strbat prin hrtie. OPTIK PAPERYDVLJXUFRQGLLLSHUIHFWHSHQWUXOXFUXLVFULV

GAMA OFFICE

GAMA INTERNATIONAL

N MOD EXCLUSIV,
doar la caietele de
birou OFFICE:

PAGINI CU INFORMAII
INTERNAIONALE
x Prefixe telefonice, zone temporale

INDICAII N 10 LIMBI
x Obinei toate informaiile de

care avei nevoie din gama de


produse International.

STILURI DE LINIATUR
x Paginile sunt liniate inteligent,

Rigl-semn
de carte

cu margini duble i antet, pentru


notarea ntlnirilor, adreselor,
msurilor de luat.

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

249

caiete i blocnotesuri

INTERNATIONAL
*DPDSUHIHUDWGHRDPHQLLGHDIDFHULGLQQWUHDJDOXPH

ARTICOLE DIN HRTIE

05

CARACTERISTICI
EXCLUSIVE
VALABILE PENTRU
INTREAGA GAM
INTERNATIONAL

*URVLPHDLQHWH]LPHDKUWLHL
SHUPLWVFULHUHDFXUDWSHILHFDUH
SDJLQFKLDULFXVWLORXVDXUROOHU
IUDH[LVWDULVFXOFDFHUQHDODV
VWUEDWKUWLD

(UJRQRPLFHLUREXVWHQ
DFHODLWLPSFRSHULOHDVLJXU
RUH]LVWHQDSURGXVXOXL
QGHOXQJDWQWLPS

&RPELQDUHDLQWHOLQJHQWD
OLQLDWXULORUGHSHSDJLQDMXWOD
VWUXFWXUDUHDIDFLODQRWLHORU

7RDWHILOHOHDXSHUIRUODWHUDOFH
SHUPLWGHVSULQGHUHXRDUL
SHUIRUDLLSHQWUXQGRVDULHUH

Caietul business nr. 1 n Europa!

80

80

Oxford International Notebook


&DLHWGHFDOLWDWHVXSHULRDUQXPUXOQ(XURSDODFDWHJRULDFDLHWHORUGHDIDFHUL
HVWHUHDOL]DWFXFRSHULGLQFDUWRQUH]LVWHQWKUWLH2SWLN3DSHUGHJPS
SUHY]XWFXSHUIRUDLLODWHUDOHSHQWUXQGRVDULHUHOHJDWFXVSLUPHWDOLFGXEO
9DULDQWD$HVWHSUHY]XWFXSHUIRUDLLSHQWUXQGRVDULHUHFDUHSHUPLW
WUDQVIHUDUHDQRWLHORULQWUXQRUJDQL]HU
Cod
COX014
COX015
COX016
COX017

Format

Coperta

Legare

Nr. coli Liniatur

A5+
A5+
A4+
A4+

solid
solid
solid
solid

spir dubl
spir dubl
spir dubl
spir dubl

80
80
80
80

matematic
dictando
matematic
dictando

protecie i
siguran
uor de
pstrat i
utilizat
semn de
carte

80

80

Oxford International Meetingbook


&DLHWGHFDOLWDWHVXSHULRDUDYQGFRSHULGLQSROLSURSLOHQPDSFXFODSHSH
FRSHUWDGLQVSDWHQFKLGHUHFXEDQGHODVWLF&ROLGLQKUWLHGHJPS2SWLN
3DSHUSUHY]XWHFXPLFURSHUIRUDLL6SLUGXEOGHFROL GHSDJLQL 
PDWHPDWLFVDXGLFWDQGR)RUPDW$FXRULFLLSHQWUXQGRVDULHUH

250

Cod
COX001
COX002
COX0010
COX0020

Format

Coperta

Legare

Nr. coli Liniatur

A4+
A4+
A5+
A5+

PP
PP
PP
PP

spir dubl
spir dubl
spir dubl
spir dubl

80
80
80
80

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

matematic
dictando
matematic
dictando

caiete i blocnotesuri

BUZUNAR DE DOCUMENTE
Pentru pstrarea notielor,
crilor de vizit, chitanelor,
ordinei de zi, etc.

Oxford International Activebook

SEMN DE CARTE
SEPARATOR
Pentru gsirea rapid
a unei pagini

&DLHWGHFDOLWDWHVXSHULRDUDYQGFRSHULGLQSROLSURSLOHQVHSDUDWRDUHGLQ
SODVWLFUHSR]LLRQDELOHLEX]XQDUSHQWUXGRFXPHQWH&ROLGLQKUWLHGHJPS
2SWLN3DSHUSUHY]XWHFXPLFURSHUIRUDLL6SLUGXEOGHFROL GHSDJLQL 
PDWHPDWLFVDXGLFWDQGR)RUPDW$FXJXULVDX$FXJXULSHQWUX
QGRVDULHUH
Cod
COX041
COX042
COX043
COX044

Format

Coperta

Legare

Nr. coli Liniatur

A4+
A4+
A5+
A5+

PP
PP
PP
PP

spir dubl
spir dubl
spir dubl
spir dubl

80
80
80
80

80

matematic
dictando
matematic
dictando

ARTICOLE DIN HRTIE

05

80

Oxford International Notepad


%ORFQRWHVGHFDOLWDWHVXSHULRDUFDSVDWQSDUWHDGHVXVFRSHUWDGLQVSDWHIRDUWH
ULJLGFDSVHFRPSOHWDVFXQVHQVSDWHOHFRSHULL&ROLGLQKUWLHGHJPS2SWLN
3DSHUPDWHPDWLFVDXGLFWDQGRKUWLHDOEVDXJDOEHQ)RUPDW$
Cod
COX024
COX025
COX026

Format

Coperta

Legare

Nr. coli

Ruling

A4+
A4+
A4+

flexibil
flexibil
flexibil

capsat
capsat
capsat

80
80 (alb)
80 (galben)

matematic
dictando
dictando

80

80

capsele complet
ascunse nu
ncomodeaz la
scriere i nici nu
zgrie

coperta spate
este din carton
foarte rigid care
permite scrierea
i n picioare

INTERNATIONAL NOTEBOOKS
Gama preferat de oamenii de afaceri din ntreaga lume

PAGINI DE INFORMAII
INTERNAIONALE

SFATURI I RECOMANDRI

LINIATUR

Prefixe telefonice i
fusuri orare

Gseti cele mai bune


informaii doar folosind
gama International

Combinarea intelingent
a liniaturilor de pe pagin
ajut la structurarea facil
a notielor

T H E I N K D O E S N T G O T H R O U G H
Oxford has developed its own exclusive paper called
OPTIK PAPER. With this special paper, handwriting is
smooth and becomes a real pleasure for young students.
Due to the unique quality of the paper, both sides can
be used as the ink doesn`t go through.

The Paper by Nature - certificare ce garanteaz


impactul sczut asupra mediului al materiilor
prime selectate n procesul de producie.
www.paperbynature.com

ITS IN YOUR HANDS

www.my-oxford.com

Oricare ar fi meseria ta, avem produsul potrivit.

251

caiete i blocnotesuri

Office
Range

ARTICOLE DIN HRTIE

05

Cele mai bine vndute caiete din Europa sunt produse de noi!
A avea success n viaa colar i n cea profesional presupune s ai ncredere n
tine dar s dispui i de mijloacele potrivite care s te ajute s atingi perfeciunea.
Suntem convini c meritm cu toii s utilizm produse de calitate superioar
care s asigure o scriere impecabil i care s ajute att n viaa colar ct i n
cea profesional. Caietele Oxford ajut utilizatorii prin punerea la dispoziie a
mijloacelor eficiente i uor de folosit n toate activitile zilnice.
JURVLPHDLQHWH]LPHDKUWLHL
SHUPLWVFULHUHDFXUDWSHILHFDUH
SDJLQFKLDULFXVWLORXVDX
UROOHUIUDH[LVWDULVFXOFD
FHUQHDODVVWUEDWKUWLD

The Paper by Nature - certificare ce garanteaza


impactul sczut asupra mediului al materiilor
prime selectate in procesul de producie.
www.paperbynature.com

VHPQGHFDUWH
GHWDDELO

EXCLUSIV LA
GAMA OFFICE

semn de carte
tip rigl

Oxford Essentials
&DLHWGHFDOLWDWHVXSHULRDUFRSHULGLQFDUWRQODPLQDWVSLUGXEOGHFXORDUHQHDJU
LULJOGLQSODVWLFFHSRDWHIRORVLWFDVHPQGHFDUWH&ROLGLQKUWLHGHJPS
2SWLN3DSHUFROL SDJLQL PDWHPDWLFVDXGLFWDQGR)RUPDW$
Cod
COX010
COX011

Format

Coperta

Legare

Nr. coli

Liniatur

A4+
A4+

flexibil
flexibil

spir dubl
spir dubl

90
90

matematic
dictando

pagini perforate care uureaz


ndosarierea coninutului

spir dubl acoperit


cu plastic

3 separatoare din PP care


ajut la structurarea
notielor

Oxford Europeanbook
&DLHWGHFDOLWDWHVXSHULRDUFXFRSHULGLQFDUWRQUH]LVWHQWODPLQDW&ROLGLQKUWLH
GHJPS2SWLN3DSHUSUHY]XWHFXPLFURSHUIRUDLL0DUJLQLOHSDJLQLORUVXQW
FRORUDWHQFXORULGLIHULWH%X]XQDUSHQWUXGRFXPHQWHLVHSDUDWRDUHGHVXELHFWH
6SLUPHWDOLFGXEOFROL SDJLQL PDWHPDWLFVDXGLFWDQGR)RUPDW$FX
JXULSHQWUXQGRVDULHUH
Cod
COX005
COX006

252

copert flexibil

Format

Coperta

Legare

Nr. coli

Liniatur

A4+
A4+

solid
solid

spir dubl
spir dubl

120
120

matematic
dictando

perforaiile n form de U
asigur ndosarierea facil

4 subiecte, fiecare
subiect fiind marcat
printr-o culoare unic

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

separatoare repoziionabile

caiete i blocnotesuri
EXCLUSIV LA
GAMA OFFICE

semn de carte
tip rigl

&DLHWGHFDOLWDWHVXSHULRDUFXFRSHULGLQSROLSURSLOHQWUDQVSDUHQWQFXORULYLL
VSLUGXEOLVHPQGHFDUWH&ROLGLQKUWLHGHJPS2SWLN3DSHU
FROL SDJLQL PDWHPDWLFVDXGLFWDQGR)RUPDW$VDX$
Cod
COX018
COX019
COX020
COX021

Format

Copert

Legare

Nr. coli

Liniatur

A5
A5
A4
A4

PP
PP
PP
PP

spir dubl
spir dubl
spir dubl
spir dubl

90
90
90
90

matematic
dictando
matematic
dictando

copert transparent
din PP

spir dubl acoperit


cu plastic

ARTICOLE DIN HRTIE

05

Oxford My Colours

Oxford Woman
&DLHWGHFDOLWDWHVXSHULRDUFRSHULGLQFDUWRQODPLQDWVSLUGXEOLULJOGLQ
SODVWLFFHSRDWHIRORVLWFDVHPQGHFDUWH&ROLGLQKUWLHGHJPS2SWLN3DSHU
FROL SDJLQL PDWHPDWLFVDXGLFWDQGR)RUPDW$VDX$
Cod
COX045
COX046
COX047
COX048

Format

Copert

Legare

Nr. coli

Liniatur

A5
A5
A4
A4

flexibil
flexibil
flexibil
flexibil

spir dubl
spir dubl
spir dubl
spir dubl

90
90
90
90

matematic
dictando
matematic
dictando

EXCLUSIV LA
GAMA OFFICE

semn de carte
tip rigl

spir dubl acoperit


cu plastic

culori n vog

ACUM NT RE AGA COLEC IE DE C AIE T E ARE UN S T IL


PR OPRIU: A L TU!

URBAN MIX
Realizat din PP
inovativ, foarte
solid, care rezist
unui stil de via
activ

COPERI PP

MY COLOURS
Un cocktail
energizant de
culori pentru acele
persoane care vor
s ias n eviden

SPIR DUBL

flexibile si rezistente spir dubl,


la ap
acoperit cu
plastic

WOMAN
O colecie
de nuane
surprinztoare care
ilustreaz esena
farmecului feminin

ESSENTIALS
Combinaia
perfect dintre
perfoman i
pragmatism
prin inflexiuni
cromatice ale
culorilor clasice

COPERI
LAMINATE

rezistente i uor
de intreinut

semn de
carte tip
rigl

GA M A OFFICE C AIE T E PEN T RU PROFE SIONI T I.


Avem caietul care s se asorteze personalitii tale!
Gama Office, prezentat de Oxford, este atotcuprinztoare
prin gama de culori, varietatea detaliilor inovative i a
tuturor materialelor utilizate. Tu decizi care este caietul
care i definete cel mai bine personalitatea/modul de
lucru i de via!

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

253

caiete i blocnotesuri

Arat-i adevrata personalitate


i difereniaz-te cu Leitz WOW!

www.leitz.com

05
ARTICOLE DIN HRTIE

Caiet de birou Leitz WOW Be Mobile


,GHDOSHQWUXDOXDQRWLHDWXQFLFQGHWLQPLFDUH
 FRSHUWGLQSROLSURSLOHQ
 GHOHKUWLHJPSFHUWLFDW)6&
 VHSDUDWRDUHUHSR]LLRQDELOHLSDJLQGHVXPDU
 PDSFXFODSHDWDDWSHFRSHUWDGLQVSDWHFDSDFLWDWHGHFROL
Cod
SL0206x

Format

Tip

A4

dictando

SL0206y

A4

matematic

Culori metalizate

[FXORDUHDOEDVWUXSRUWRFDOLXPRYUR]WXUFRD]YHUGH
\FXORDUHDOEDVWUXSRUWRFDOLXPRYUR]WXUFRD]YHUGH

margine
pre-perforat

3 separatoare
repoziionabile

3 seturi de
indeci adezivi

nchidere cu elastic
i suport pentru pix

Caiete de birou Leitz WOW cu spir


 FRSHUWGLQSROLSURSLOHQ
 GHOHKUWLHJPSFHUWLFDW)6&
Culori metalizate
 ULJOJUDGDWFHSRDWHIRORVLWLFDVHPQGHSDJLQ
 EX]XQDUSHFRSHUWDGLQVSDWHSHQWUXVWRFDUHDWHPSRUDUDGRFXPHQWHORU

A4

A5

Cod
SL0201x

Format

Tip

A4

dictando

SL0202y

A4

matematic

SL0207x

A5

dictando
SL0208x
A5
matematic
[FXORDUHDOEDVWUXSRUWRFDOLXPRYUR]WXUFRD]YHUGH
\FXORDUHDOEDVWUXSRUWRFDOLXPRYUR]WXUFRD]YHUGH

margine pre-perforat

rigl detaabil

buzunar pe coperta din spate

Caiete de birou Leitz WOW


&DLHWGHELURXFXXQGHVLJQPRGHUQLDWUDFWLYQGLYHUVHFXORUL&RSHUWGXU
ODPLQDWODH[WHULRULFXQLVDMOXFLRV6HFRPSOHWHD]SHUIHFWFXFHOHODOWHSURGXVH
GLQJDPD/HLW]:2:

A4

 GHFROLKUWLHJPS
Culori metalizate
 FRSHUWDVROLGSHUPLWHOXDUHDGHQRWLHQPLFDUH
 KUWLHFHUWLFDW1RUGLF6ZDQFXFRQLQXWUHGXVGHOLJQLQ
 FROLOHVXQWFXVXWHLOLSLWHODFRWRUSHQWUXDUH]LVWDXWLOL]ULLSHWHUPHQOXQJ

A5

Cod
SL0205x

Format

Tip

A4

dictando

SL0205y

A4

matematic

[FXORDUHUR]DOEDVWUXSRUWRFDOLXYHUGHPRYWXUFRD]
\FXORDUHUR]DOEDVWUXSRUWRFDOLXYHUGHPRYWXUFRD]

254

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

caiete i blocnotesuri

copert
embosat

05
ARTICOLE DIN HRTIE

7 separatoare
din plastic

DISCOVERY
NOTEBOOK

Caiet Discovery
'HVFRSHULQRYDLDQPDWHULHGHFDLHWHRFH
&DLHWFXVSLUPHWDOLFGXEOVXELHFWHKUWLHDOEGHJPSFXFRSHUWGLQ
39&QGLYHUVHFXORUL(VWHSUHY]XWFXDPRUVGHUXSHUHLFXSHUIRUDLLSHQWUX
QGRVDULHUH&RQLQHOHGLQWUHFDUHGHPDWHPDWLFLGHGLFWDQGR

50 file
dictando

Cod
CI805703

125 file
matematic

Dimensiuni (mm)
210 x 297

separatoare
color n partea
superioar

Caiet Assistant

25 file
dictando

256

75 file
matematic

(VWHFDLHWXOLGHDOSHQWUXELURX5HDOL]DWFXVSLUPHWDOLFGXEOLSUHY]XWFXDPRUV
GHUXSHUH&RSHUWFDUWRQDWLKUWLHGHLQWHULRUGHJPSDOE
&RQLQHVHSDUDWRDUHDSOLFDWHQSDUWHDVXSHULRDUDFDLHWXOXLGLIHUHQLLQGXVHGH
FHOHODOWHFDLHWHRFH&RQLQHOHGLQWUHFDUHGHPDWHPDWLFLGLFWDQGR
Cod
CI805803

Dimensiuni (mm)
210 x 297

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

caiete i blocnotesuri

ARTICOLE DIN HRTIE

05

Caiet 4 subiecte copert PP


&DLHWFXVSLUPHWDOLFVLPSOKUWLHDOEGHJPS3UHY]XWFXDPRUVGHUXSHUH
LSHUIRUDLLSHQWUXQGRVDULHUH&RSHULGLQSROLSURSLOHQGLYHUVHFXORUL
,QWHULRUOH
Cod
CI9301501

Dimensiuni (mm)

Tip

225 x 300

dictando

CI9301502

225 x 300

matematic

margini color

coperi din
polipropilen

Caiet Tranz
&DLHWHOHJDQWSUHY]XWFXVSLUOH8QLFSULQFRSHUWD33FRORUDWSDO
WUDQVSDUHQWFDUHRIHURQRWGHFXORDUHQRWLHORUYRDVWUH'LVSRQLELOQYDULDQWH
GLFWDQGRLPDWHPDWLF$L$
Cod
CI9201001

Dimensiuni (mm)

Tip

225 x 300

dictando

CI9201002

225 x 300

matematic

CI9201003

170 x 240

dictando

CI9201004

170 x 240

matematic

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

257

caiete i blocnotesuri

amors de
rupere

05
ARTICOLE DIN HRTIE

copert rigid

Caiet Kraft
&DLHWFXVSLUPHWDOLFGXEOLFRSHULGLQFDUWRQULJLGQGLYHUVHFXORUL,QWHULRU
GLQKUWLHDOEGHJPS)LOHSUHY]XWHFXDPRUVGHUXSHUHSHUIRUDLLSHQWUX
QGRVDULHUHLEX]XQDUSHQWUXFROL'LPHQVLXQL[PP

Blocnotes Kraft

Cod
CI9364001

Dimensiuni (mm)

Tip

Nr. file

230 x 297

dictando

140

CI9364002

230 x 297

matematic

140

170 x 240

dictando

100

Cod
CI9365001

Tip

CI935003
CI935004

170 x 240

matematic

100

CI9365002

matematic

%ORFQRWHVSUHY]XWFXVSLUPHWDOLFGXEOGHOHKUWLHDOEGHJPS
&RSHULGLQFDUWRQULJLGGLYHUVHFXORUL'LPHQVLXQL[PP
dictando

Caiet Fines
&DLHWFXVSLUPHWDOLFGXEOOH3UHY]XWFXDPRUVGHUXSHUHLSHUIRUDLL
SHQWUXQGRVDULHUH&RSHULGLQFDUWRQGXUKUWLHLQWHULRUGHJPSPDWHPDWLF
Cod
CI834010

coperi din
carton dur

Dimensiuni (mm)

Culoare

225 x 300

gri

CI834011

225 x 300

portocaliu

CI834012

225 x 300

rou

CI834013

225 x 300

verde

coperi din
carton, diverse
culori

258

Caiet Manilla

Blocnotes Manilla

&DLHWFXVSLUPHWDOLFVLPSOOHKUWLHDOEGHJPS&RSHULGLQFDUWRQ
GLYHUVHFXORUL

%ORFQRWHVFXVSLUPHWDOLFVLPSOKUWLHDOEGHJPS
&RSHULGLQFDUWRQGHGLYHUVHFXORUL

Cod
CI9412001

Dimensiuni (mm)

Tip

Tip

Numr file

dictando

Cod
CI9414001

Dimensiuni (mm)

170 x 240

150 x 210

dictando

70

CI9412002

170 x 240

matematic

CI9414002

150 x 210

matematic

70

CI9411001

210 x 297

dictando

CI9413001

210 x 297

dictando

90

CI9411002

210 x 297

matematic

CI9413002

210 x 297

matematic

90

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

caiete i blocnotesuri

CALITATE
PRE

ARTICOLE DIN HRTIE

05
amors de rupere
i perforaii pentru
ndosariere

Blocnotes Concord Plus


Caiet Red Block

%ORFQRWHVFXVSLUGXEOOH+UWLHGHFXORDUHJDOEHQGHJPS

&DLHWFXVSLUPHWDOLFVLPSOOHKUWLHRVHWJPS3UHY]XWFXDPRUVGH
UXSHUHLSHUIRUDLLSHQWUXQGRVDULHUH&RSHULGLQFDUWRQ

Cod
CI120151

Dimensiuni (mm)

Tip

150 x 210

dictando
matematic

Cod
CI101112

Dimensiuni (mm)

Tip

CI120152

150 x 210

210 x 297

dictando

CI120141

210 x 297

dictando

CI101111

210 x 297

matematic

CI120142

210 x 297

matematic

Caiet Trendy Office


&DLHWGHELURXFXVSLUPHWDOLF&RSHUWGLQFDUWRQGHFXORDUHDOEDVWUFROL
UDSRUWLGHDOFDOLWDWHSUH
Cod
CI770004

Dimensiuni (mm)

Tip

148 x 210

matematic

CI770005

148 x 210

dictando

CI770016

210 x 297

matematic

CI770017

210 x 297

dictando

CALITATE
PRE

Registru
&RSHULGLQFDUWRQULJLG
)RUPDW$
Cod

Numr file

Tip

DL3000



dictando

DL3001



matematic

DL3002

192

dictando

DL3003

192

matematic

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

259

caiete i blocnotesuri

ARTICOLE DIN HRTIE

05

Gama (Rec) Note

Hrtie interior
ivory

Copert spate
cu burduf

Stickere pentru
organizarea
nsemnrilor

Copert tare,
buretat, ce poate
fi personalizat

&DLHWGHELURXDJHQGFXFRSHUWHPERVDWEXUHWDWFDUHSRDWH
SHUVRQDOL]DWFXWLPEUXVHF&RSHUWWDUHFDUHDMXWODVFULHUHDSHRULFHWLS
GHVXSUDIDGLVSRQLELOQYDULDQWHGHFXORDUHDOEQHJUXSRUWRFDOLX
UR]JULOLODURXDOEDVWUX
+UWLHLQWHULRULYRU\SDJLQLFRSHUWDVSDWHSUHY]XWSHLQWHULRU
FXEXUGXIGLQFDUWRQLYRLUHLVXSRUWSHQWUXLQVWUXPHQWGHVFULV'RX
SDJLQLFXSODQQHUDQXDOSDJLQLSHQWUXLQIRUPDLLJHQHUDOHVWLFNHUH
XWLOHSHQWUXRUJDQL]DUHDQVHPQULORUDVWIHOWUDYHOZDUQLQJLGHHD
HQWHUWDLQPHQWWRGROLVWPRQH\QFKLGHUHFXHODVWLF
Cod
CI83301x

Dimensiuni (mm)

Tip

Culoare

130 x 210

dictando



CI83310x

90 x 140

dictando



CI833020

130 x 210

matematic

negru

CI833120

90 x 140

matematic

negru

CI833021

130 x 210

velin

negru

CI833121

90 x 140

velin

negru

[FXORDUHQHJUXDOESRUWRFDOLXJULUR]URX
DOEDVWUXPRY

260

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

6. Comunicare i prezentare
flipcharturi

262

sisteme de afiare

266

table mobile

271

table de conferin

272

videoproiectoare

278

ecrane de proiecie i accesorii

279

accesorii pentru table

280

sisteme de prezentare

284

ecusoane

287

flipcharturi

brae laterale ajustabile

COMUNICARE I PREZENTARE

06
Flipchart mobil
Deluxe

CALITATE
PRE

unghi de nclinare reglabil pn la 15

Suprafa magnetic (permite scrierea cu markere


speciale). Baz rotund din plastic, prevzut
cu 5 rotile ce ofer o mobilitate sporit. Uor de
manevrat, cu posibilitatea de blocare n poziia
dorit de utilizator.
Prevzut cu brae laterale, ce permite extinderea
suprafeei de expunere a colilor, precum i folosirea
diferitelor formate de hrtie pentru flipchart.
Dispune de tvi pentru markere pe toat
lungimea tablei. Mod de prindere a hrtiei cu
clem rabatabil. Posibilitate de reglare pe nlime
ntre 182-200 cm. Dimensiuni tabl: 95 x 67 cm.
Greutate: 1o kg.

sistem de blocare a hrtiei

Cod
AY150700

tvi pentru markere

CALITATE
PRE
CALITATE
PRE

sistem de blocare a hrtiei

tvi pentru markere

Flipchart mobil

sistem de prindere a hrtiei

Suprafa magnetic (permite scrierea cu markere speciale). Mobilitate sporit,


oferit de un sistem de 5 rotile. Uor de manevrat, cu posibilitatea de blocare n
poziia dorit de utilizator. Dispune de tvi pentru markere pe toat lungimea
tablei. Mod de prindere a hrtiei cu clem rabatabil.
nlime fix de 190 cm. Dimensiuni tabl: 95 x 67 cm. Greutate: 9.8 kg.

Flipchart mobil Easy


Suprafa magnetic. Ideal pentru traininguri, prezentri, conferine. Reglare pe
nlime ntre 180 - 200 cm. Suport pentru instrumentele de scris. Greutate: 13 kg.
Dimensiuni tabl: 105 x 68 cm.
Cod
AY150100

Cod
AY150701

262

tvi pentru markere

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

flipcharturi

povestea unei mrci


Legamaster este divizia de comunicare vizual din cadrul
Edding AG, lider n producia de instrumente de scris i
marcare de nalt clas.
Pe o perioad de peste 50 de ani, Legamaster i-a adaptat
n mod activ gama la ultimele trenduri i inovaii din
tehnologia comunicrii. Cele dou fabrici de producie
din Europa si America de Sud reacioneaz rapid i precis
la cerinele actuale ale pieei.
Ergonomia, durabilitatea, inovaia, calitatea i designul
funcional sunt elemente de baz n filosofia Legamaster.

COMUNICARE I PREZENTARE

06

Legamaster - numele pentru comunicarea vizual profesional i-a ocupat cu succes locul su n pia
printr-o gam larg de produse, foarte practice, dar i moderne. Prin produsele oferite, cum ar fi table, aviziere,
flipcharturi, sisteme i ecrane de proiecie, Legamaster creeaz un mediu ce permite utilizatorilor obinerea
succesului n activitatea la birou.

SUPER
CALITATE

bra inclus

GARANIE

bra extensibil ce asigur mrirea


spaiului de expunere a informaiei

sistem de prindere a hrtiei

tvi pentru markere cu expunere pe


ntreaga suprafa

Flipchart Universal Triangle


Suprafa magnetic. nlime reglabil pn la 187 cm.
Tvi pentru markere pe toat lungimea tablei.
Greutate: 11.5 kg. Dimensiuni tabl: 105 x 68 cm.
Cod
PS152900

sistem de prindere a hrtiei

tvi pentru markere cu expunere


pe ntreaga suprafa

Flipchart Economy Triangle


Suprafa magnetic. nlime reglabil pn la
180 cm. Dispune de tvi pentru markere pe toat
lungimea tablei.
Greutate: 9.6 kg. Dimensiuni tabl: 101 x 66 cm.
Cod
PS152800

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

263

flipcharturi

SFATUL SPECIALISTULUI
UTILIZAREA EFICIENT A FLIPCHARTULUI
Alegei culori nchise, saturate, pentru a maximiza vizibilitatea.
Folosii alte culori, dect cea de baz, pentru a evidenia informaiile importante.
Poziionai flipchartul astfel nct s ofere vizibilitate maxim pentru public.
Punei accentul pe grafice, diagrame, tabele.

06
COMUNICARE I PREZENTARE

Flipchart cu tripod
Flipchart cu tripod, cu suprafa de scris magnetic. Tvi pentru
markere i ram de aluminiu. Greutate: 11 kg.
Dimensiuni tabl: 100 x 70 cm.
Cod
AY150101

tvi pentru markere

sistem de prindere a hrtiei

TIAI C?

Flipchartul aa cum l tim astzi, a fost


inventat de Peter Kent n anii '70 pentru
a-l ajuta ntr-o prezentare. Peter a fondat
una dintre cele mai importante firme
din piaa de produse de comunicare i
prezentare.

Hrtie pentru flipchart


Hrtie alb pentru flipchart.
Dimensiuni: 100 x 65 cm, 80 g/mp.
Unitate de vnzare: 100 coli/cutie.
Cod

SUPER
CALITATE

PS0080
PS0081

Tip hrtie

Unitate de vnzare

velin

top (20 coli)

velin

cutie (100 coli)

matematic

top (20 coli)

matematic

cutie (100 coli)

Hrtie pentru flipchart


Hrtie alb pentru flipchart.
Dimensiuni 100 x 65 cm, 70 g/mp.
Unitate de vnzare: 20 coli/top.

CALITATE
PRE

Cod
PS0082
PS0083

264

Tip hrtie

Unitate de vnzare

velin

top (20 coli)

velin

cutie (100 coli)

matematic

top (20 coli)

matematic

cutie (100 coli)

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

flipcharturi
Magic Chart
Ader la aproape orice suprafa, fr a fi nevoie de adeziv. Practic i uor de
transportat, transform orice suprafa ntr-un flipchart, tabl alb sau tabl
colar. Dimensiuni folie: 80 x 60 cm. Rol cu 25 de folii electrostatice, perforaii la
fiecare 80 cm.
JDWDGHXWLOL]DUHVROXLDLGHDOSHQWUXHGLQHVSRQWDQHVDX
planificate
SRLFUHDLQVWDQWRVXSUDIDGHVFULVFKLDULDWXQFLFQG
o tabl sau flipchart nu sunt disponibile
IROLHHOHFWURVWDWLFFHVHOLSHWHFXXXULQSHDSURDSHRULFHVXSUDID
(lemn, beton, sticl, tapet)
GXUDWGHYLDOXQJDSURSULHWLORUHOHFWURVWDWLFH
(pn la 5 ani!)
QXQHFHVLWDGH]LYQXODVXUPH
IRLOHSRWILUHSR]LLRQDWHXRU
HFRORJLFFRPSOHWUHFLFODELOH
PDUNHULQFOXV
JUHXWDWHJ
Magic-Chart Flipchart
Cod
Produs
Magic-Chart Flipchart

PS159100

Magic-Chart Whiteboard

PS159200

Magic-Chart Blackboard

COMUNICARE I PREZENTARE

PS159000

06

Magic-Chart Whiteboard

Magic-Chart Blackboard
SUPER
CALITATE

uor de transportat, doar 760 g

electrostatic

Magic-Chart Flipchart
FRPSOHWOLQLDWHIHFWGHIOLSFKDUW
FVXHGHFP
SRDWHILVFULVFXPDUNHUHSHUPDQHQWHVDXSHQWUXWDEO

Magic-Chart Whiteboard
IRDLHDOEHIHFWGHWDEOGHVFULV
DVSHFWOXFLRV
SRDWHILVFULVFXPDUNHUHSHUPDQHQWH
sau pentru tabl
VHSRDWHWHUJHGDFHVWHVFULVFX
markere pentru tabl, putand fi folosit
pe pn la 10 ori

aplicabil pe perete sau pe sticl

Magic-Chart Blackboard

scris vizibil i n lumina soarelui

IRDLHQHDJUHIHFWGHWDEOGHVFULVFRODU
SRDWHILVFULVFXPDUNHUHSHUPDQHQWHVDXSHQWUXWDEO
SURSULHWLHOHFWURVWDWLFHVXSHULRDUH
QXSHUPLWHSWUXQGHUHDUD]HORUVRODUHVFULVXOUPQH
lizibil

Oricare ar fi meseria ta, avem produsul potrivit.

265

sisteme de afiare
Avizier din metal
Avizier de perete cu design elegant, cadru foarte rezistent realizat din aluminiu.
Poate fi montat la exterior fiind 100% rezistent la ap. Ua poate fi deschis la 900 i
este realizat din plexiglas rezistent la intemperii. Prevzut cu sistem de nchidere cu
cheie. Interior metalic ce permite folosirea de magnei pentru prinderea documentelor.
Poate fi aezat att pe vertical ct i pe orizontal. Include elemente de fixare
(uruburi i dibluri).

COMUNICARE I PREZENTARE

06

Cod
AY150900

Capacitate
4 x A4

Dimensiuni (H x L x l cm)
68 x 51 x 3

AY150901

6 x A4

73 x 68 x 3

pentru exterior
CALITATE
PRE

sistem de nchidere cu cheie

u din plexiglas rezistent

Avizier din fetru


Avizier de perete cu design elegant, cadru foarte rezistent realizat din aluminiu.
Poate fi montat la interior. Ua poate fi deschis la 900 i este realizat din plexiglas
rezistent la intemperii. Prevzut cu sistem de nchidere cu cheie. Interior din fetru ce
permite folosirea de ace pentru prinderea documentelor.
Poate fi aezat att pe vertical ct i pe orizontal.
Include elemente de fixare (uruburi i dibluri).
Cod
AY150800

Capacitate
4 x A4

Dimensiuni (H x L x l cm)
68 x 51 x 3

AY150801

6 x A4

73 x 68 x 3

pentru interior

CALITATE
PRE

Clip Frame
Ideale pentru afiarea posterelor, informaiilor, etc. Rame din profil aluminiu de 25
mm, care permit nlocuirea uoar i sigur a documentelor. Folie din PVC pentru
protejarea coninutului. Produsul este nsoit de un flyer cu instruciuni.
Culoare: argintiu mat. Se livreaz cu accesoriile de fixare (4 uruburi i 4 dibluri).
Cod
AY151000

Format

Dimensiuni (H x L x l cm)

A4

32.6 x 23.9 x 1.2

AY151001

A3

45 x 32.7 x 1.2

pentru interior

sistem click pentru fixarea documentelor

CALITATE
PRE

266

poate fi utilizat att vertical ct i orizontal

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

sisteme de afiare

DURAFRAME

Modalitatea profesionist i avantajoas


de afiare a informaiilor!
DuraFrameTM
Sistem de afiare autoadeziv, cu ram frontal magnetic.
nchiderea magnetic asigur susinerea ferm a inserturilor i
schimbarea acestora rapid i uor. Adezivul rezist pe suprafee
netede, iar repoziionarea multipl se poate realiza foarte simplu.
Lipit pe sticl, se poate citi pe ambele fee.
Unitate de vnzare: 2 buci/set.

AUTOADEZIV

06

REPOZIIONABIL

Cod
DB487023

COMUNICARE I PREZENTARE

LIPIRE PE ORICE
SUPRAFA NETED

RAM MAGNETIC

SCHIMBARE UOAR I
RAPID A INSERTULUI

Format

Culoare

A6

gri

DB487123

A5

gri

DB487223

A4

gri

DB487201

A4

negru

DB487203

A4

rou

DB487205

A4

verde

DB487207

A4

albastru

DB487323

A3

gri

DB487301

A3

negru

RAM COLORAT VIZIBIL


PE AMBELE FEE

SUPER
CALITATE

ndeprteaz folia

fixeaz rama n poziia dorit

ridic rama magnetic i insereaz printul

Asta e tot! Duraframe poate fi ndeprtat


i reutilizat cu uurin.

diverse forme i culori, posibiliti extinse de aplicaii la birou sau n spaii


comerciale: orare de lucru, semnalizri reduceri, atenionri clieni, meniuri etc

FORMATE MARI

DuraFrameTM Poster
Ofer un mod profesionist de afiare a campaniilor promoionale
n magazine, vitrine sau centre de service. Ramele adezive pentru
afie i postere ader uor i ferm pe suprafeele lucioase sau pe
sticl. Datorit formatelor mari, va atrage cu uurin atenia.
Folie non-reflexiv, rezisten la UV i vizibilitate pe ambele pri.
Unitate de vnzare: 1 bucat/set.

VIZIBILITATE SPORIT

Cod
DB499501

Format

Culoare

A2

gri

Db499523

A2

negru

DB499601

50 x 70 cm

gri

DB499623

50 x 70 cm

negru

DB499701

A1

gri

DB499723

A1

negru

SUPER
CALITATE

268

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

sisteme de afiare

SUPER
CALITATE

Duraframe SecurityTM
autoadeziv
Sistem de afiare autoadeziv colorat n dou nuane, conform ISO 3894 4, pentru
diverse instruciuni i indicatoare de securitate. Informaia afiat poate fi nlocuit
cu uurin. Lipit pe sticl se poate citi pe ambele fee. Poate fi folosit att n format
portrait, ct i landscape. Unitate de vnzare: 2 buci/set.
Format

Culoare

A4

negru/ galben

DB494131

A4

alb/ verde

DB494132

A4

alb/ rou

06
COMUNICARE I PREZENTARE

Cod
DB494130

Duraframe SecurityTM Magnetic

magnetic

Sistem de afiare magnetic colorat n dou nuane conform ISO 3894 4, pentru
diverse instruciuni i indicatoare de securitate. Poate fi montat cu usurin pe
suprafee metalice. Informaia afiat poate fi nlocuit cu uurin.
Poate fi folosit att n format portrait, ct i landscape.
Unitate de vnzare: 5 buci/set.

Cod
DB945130

Format

Culoare

A4

negru/ galben

DB945131

A4

alb/ verde

DB945132

A4

alb/ rou

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

269

sisteme de afiare

Buzunar magnetic
Ideal pentru prezentarea informaiilor n format A4 sau A5.
Poate fi montat cu uurin pe suprafee metalice.
Unitate de vnzare: 2 buci/set.

06

Cod
DB487419

Format

DB487519

A5

A4

COMUNICARE I PREZENTARE

SUPER
CALITATE

magnetice
afiare uoar a documentelor

Info sign
Sisteme de informare i atenionare realizate din aluminiu. Calitate excelent.
Partea frontal este fabricat din plexiglas anti-reflexie. Se pot fixa pe u sau
pe perete cu ajutorul diblurilor incluse.

DB4800

SUPER
CALITATE

Cod
DB4800

Dimensiuni (mm)

DB4804

149 x 297

DB4805

210 x 148.5

149 x 52.5

Practice i elegante, atrag cu uurin atenia. Pot fi


montate n holurile de acces n cldiri, la intrarea n
birouri, cabinete medicale etc.
DB4805

270

DB4804

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

table mobile
Tabl mobil multifuncional

tabl magnetic
flipchart

06

avizier

COMUNICARE I PREZENTARE

Tabl 3 n 1: tabl magnetic, flipchart, avizier.


Tabl magnetic: suprafaa este emailat, de nalt calitate ce rezist la
zgrieturi
Flipchart: pe partea magnetic este montat un suport magnetic care poate
susine hrtia i tranform tabla n flipchart.
Avizier: partea din spate a tablei magnetice este prevzut cu un panou
din fetru ce permite prinderea cu ace
GHVLJQFRPSDFWHFRQRPLHGHVSDLX
JUHXWDWHUHGXVXRUGHDVDPEODWLGHPDQHYUDW
PRELOLWDWHVSRULWVWDWLYXOHVWHSUHY]XWFXURLDXWREORFDQWH
GLPHQVLXQLWDEO[FP
GLPHQVLXQLWRWDOH[FP
JUHXWDWHNJ
Cod
PS210500

sistem magnetic de prindere a hrtiei ce


transform tabla n flipchart

spate din fetru ce poate fi folosit ca avizier

SUPER
CALITATE

tabl magnetic

Tabl rotativ
Suprafa metalic, magnetic. Tabla poate fi rotit la 3600
i poate fi blocat n poziia dorit. Stativul este prevzut
cu roi autoblocante, ce faciliteaz deplasarea. Dispune de
tvi pentru markere.
Cod
PS103654

Dimensiuni (cm)
90 x 120

informaia poate fi citit din orice unghi

Permite rotirea la 3600 cu


blocare n unghiul dorit.
sistem ce permite blocarea
tablei n poziia dorit

roi autoblocante

tvi pentru markere

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

271

table de conferin
Tabl magnetic
Tabl magnetic cu ram din profil de aluminiu. Suprafa magnetic tratat special,
rezistent la aciunea acizilor i la zgrieturi. Pentru scriere se folosesc markere
lavabile i pentru tergere burete uscat. Se livreaz cu accesorii pentru montare pe
perete i tvi pentru markere. Sistem de prindere cu dibluri n cele 4 coluri.

06
COMUNICARE I PREZENTARE

CALITATE
PRE

Cod
AY150600

Dimensiuni (cm)

AY150601

90 x 120

AY150602

100 x 150

AY150603

120 x 180

60 x 90

garanie 25 ani pentru


suprafaa de scris*
* dac sunt folosite accesoriile pentru table Franken
suprafa emailat magnetic,
ram din aluminiu

Tabl de conferin
Universal
Suprafa magnetic tratat special, rezistent la aciunea acizilor i la zgrieturi.
Ram alb din aluminiu. Tvi pentru markere, lungime 30 cm. Se livreaz cu
accesoriile necesare montrii pe perete. Poate fi montat orizontal sau vertical.
Greutate: 12 kg/mp.
Cod
PS10223

Dimensiuni (cm)

PS10224

100 x 150

PS10225

100 x 200

90 x 120

Tabl de conferin Basic


Suprafa magnetic metalic, ram din aluminiu, tvi pentru markere.
Se livreaz cu accesoriile necesare montrii pe perete. Poate fi montat orizontal sau
vertical.

ram din aluminiu

272

Cod
DH961510

Dimensiuni (cm)

DH961520

90 x 120

DH961540

100 x 150

DH961580

100 x 200

suprafa emailat magnetic

60 x 90

tvi pentru markere

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

table de conferin

COMUNICARE I PREZENTARE

06

Tabl triptic de
conferin Plus
Tabl cu ram din aluminiu, suprafa magnetic de scris, emailat. Include
dou ui: 90 x 60 cm i suprafaa principal de scris: 90 x 120 cm. Se livreaz
cu accesoriile necesare montrii pe perete, suport pentru markere i un marker
pentru tabl. Greutate: 13 kg.
Cod
PS100554

Dimensiuni (cm)
90 x 240*

*include dou ui de 60 cm i suprafaa principal de scris: 90 x 120 cm

garanie 10 ani pentru


suprafaa de scris*

suprafa magnetic

laboratoare colare

suprafa de scris
rezistent la zgrieturi

SUPER
CALITATE

laboratoare medicale
suprafa ce poate fi
tears uor

Suprafa mai mare de scriere. Prile laterale


se pliaz pentru a economisi spaiul.

* dac sunt folosite accesoriile pentru table Legamaster

Tabl magnetic
Suprafa magnetic, ram din aluminiu i tvi pentru markere. Se livreaz cu
accesoriile necesare montrii pe perete.
Cod
AY150102

Dimensiuni (cm)

AY150103

90 x 120

AY150104

100 x 150

AY150105

120 x 180

60 x 90

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

273

Table magnetice din sticl artverum


Prezentarea general a sortimentului:
Table magnetice din sticl artverum
Incl. magnei SuperDym i material de fixare
Format n cm
150 x 100
120 x 90
100 x 65
78 x 48
48 x 48

150 x 100 cm // negru, super-alb

COMAND
SPECIAL

negru
SG100101
SG100201
SG100301
SG100401

super-alb
SG100000
SG100100
SG100200
SG100300
SG100400

rou
SG100402

Format n cm Design val alb Design diamant negru


48 x 48
SG101000
SG102000

100 x 65 cm // negru, super-alb

120 x 90 cm // negru, super-alb

48 x 78 cm //
negru, super-alb

negru

48 x 48 cm //
negru, super-alb, rou, Design diamant negru, Design val alb

Design val alb

super-alb

rou

Design diamant negru

Accesorii
Magnei SuperDym C5 Strong cub
10 x 10 x 10 mm (susine pn la 8 foi DIN A4, 80 g)
Cod: SG100500 // 4+2 buci
Cod: SG100501 // 10 buci

Magnei SuperDym C5 Strong cilindru


10 x10 mm (susine pn la 8 foi DIN A4, 80 g)
Cod: SG100503 // 10 buci

COMAND
SPECIAL

COMAND
SPECIAL

Marker cu cret 50 (vrf teit 1-5 mm)


Poate fi ters, pentru sticl i suprafee netede, asemntoare
cu sticla (cret lichid pe baz de ap)
Cod: SG100800 // negru // 1 bucat
COMAND
Cod: SG100801 // alb // 1 bucat
SPECIAL
Cod: SG100802 // roz, verde, galben // 3 buci

Marker pentru tabl din sticl


Vrf rotund 2-3 mm, non-permanent
Cod: SG100600 // negru // 5 buci
Cod: SG100601 // 2 negru, 1 albastru,
1 verde, 1 rou // 5 buci

COMAND
SPECIAL

Board-Eraser, magnetic
pentru curarea uscat a tablelor
Dimensiuni: 130 x 60 x 26 mm
Cod: SG100700 // 1 bucat

Tvi pentru markere


pentru curarea uscat a tablelor, transparent ca sticla
Dimensiuni: 170 x 75 x 70 mm
Cod: SG100900 // 1 bucat
COMAND
SPECIAL

COMAND
SPECIAL

artverum Table Magnetice din sticl

Alternativa modern
pentru table
Produsele artverum au ctigat numeroase premii internaionale

Tabla modern Artverum este folosit pentru organizare i reprezint o alternativ elegant pentru birou, sala
de sedine sau pentru biroul de acas - este produsul n care premiile internaionale de design obinute ating
perfeciunea absolut.
Se folosete pentru a scrie i pentru a terge sau poate fi folosit ca panou de informaii n combinaie cu
magneii extra-strong.
Produsele artverum au ctigat numeroase premii internaionale

// Design remarcabil
projection

YEAR
GUARANTEE

FOR MAGNETIC GLASS BOARD SURFACE

Magnei SuperDym

Marker tip cret

// Cel mai nalt nivel de siguran


// Calitate desvrit

Aspect 3D

rtc: o zi bun la birou!

Accesorii de montaj

www.sigel.eu

table de conferin

Tabl din fetru


Tabl cu suprafa din fetru i ram din aluminiu. Se pot folosi pioneze pentru
prinderea documentelor. Un mod eficient de prezentare i comunicare pentru sli de
conferin, prezentri, training-uri, instituii de nvmnt etc.
Se livreaz cu accesoriile necesare montrii pe perete.

COMUNICARE I PREZENTARE

06

Cod
AY151100

Dimensiuni (cm)

AY151101

90 x 120

60 x 90

CALITATE
PRE

Tabl Combiboard
Panou de afiaj alctuit din dou buci: plut + tabl magnetic. Design
deosebit, foarte practic. Se pot evidenia prioritile, dar i detaliile. Ram din
aluminiu, tvi pentru markere. Se livreaz cu accesoriile necesare montrii pe
perete.

2 n 1

Cod
PS102443

Dimensiuni (cm)

PS102454

90 x 120

60 x 90

Uor de manipulat i fixat pe peretele biroului tu. Tablele formate


din dou suprafee, plut i magnetic, i ofer o uoar expunere
a informaiilor, fie c sunt prinse cu ace sau cu magnei.

Stativ mobil* pentru


table de conferin
Recomandat pentru table de conferin cu dimensiuni cuprinse ntre 90 i 120 cm.
Flexibil, cu nlime reglabil pn la 80 cm. Nu include tabla.
Cod
PS4305

SUPER
CALITATE

sistem de blocare a roilor


*nu include tabla

276

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

table de conferin
Tabl din plut Universal
Suprafa din plut natural. Ideal pentru prinderea cu ace a mesajelor sau
a diverselor informaii. Ram din aluminiu, cu coluri din material plastic de
culoare gri. Se livreaz cu accesoriile necesare montrii pe perete.
Cod
PS14202

Dimensiuni (cm)

PS14204

100 x 150

60 x 90

SUPER
CALITATE

COMUNICARE I PREZENTARE

06

colare pentru mascarea sistemului


de prindere

Tabl din plut


Suprafa din plut natural, ram din lemn. Sistem de prezentare folosit ndeosebi
n birouri. Foile se prind cu uurin n ace pentru tabl, fr s deterioreze
suprafaa panoului. Conine accesorii necesare montrii pe perete.
Cod
AY150106

Dimensiuni (cm)

AY150107

60 x 80

AY150108

60 x 100

40 x 60

Hart cu suport de plut


Hart Romnia, rutier-administrativ. Se folosete cu ace pentru tabl din plut,
stegulee. Dimensiuni: 100 x 140 cm, scara: 1:550.000.
Cod
PS710

Hart pe suport magnetic


Hart Romnia, se poate scrie cu markere nepermanente. Se livreaz cu accesoriile
necesare montrii pe perete. Scara: 1:550.000.
Cod
PS810

Tip

Dimensiuni (cm)

administrativ-rutier

100 x 140

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

277

videoproiectoare
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet,


contacteaz consultantul tu de vnzri.

Videoproiector Educaional D557


Tehnologia de afiare: DLP
Luminozitate: 3.000 lumeni
Contrast: 15.000:1
Rezoluie recomandat: WXGA (1.280 x 800 px)
Rezoluie maxim: VXGA (1.600 x 1.200 px)
Durata de via a lmpii: 5.000/6.000/10.000 ore
Compatibilitate formate video: SDTV(480i, 576i), EDTV (480p, 576p), HDTV (720p,
1080i/p), NTSC (M, 3.58/4.43 MHz), PAL (B, D, G, H, I, M, N), SECAM (B, D, G, K, K1, L)
Dimensiuni: 274.6 x 212 x 100 mm
Greutate: 2.3 kg

COMUNICARE I PREZENTARE

06

Cod
VP000103

Videoproiector portabil Vivitek Qumi Q5


Tehnologia de afiare: DLP
Luminozitate: 500 lumeni
Contrast: 10.000:1
Rezoluie recomandat: WXGA (1.280 x 800 px)
Rezoluie maxim: UXGA (1.600 x 1.200 px)
Durata de via a lmpii: 20.000 - 30.000 ore
Compatibilitate formate video: SDTV(480i), EDTV (480p), HDTV (720p,1080i/p),
NTSC/NTSC 4.43, PAL B/G/H/I/M/N 60, SECAM
Dimensiuni: 160 x 120.4 x 32.3 mm
Greutate: 490 g
Cod
VP000101

nivel nalt de portabilitate

Videoproiector Vivitek D552


Tehnologia de afiare: DLP
Luminozitate: 3.000 lumeni
Contrast: 15.000:1
Rezoluie recomandat: SVGA (800 x 600 pixeli)
Rezoluie maxim: UXGA (1.600 x 1.200 pixeli)
Durata de via a lmpii: 5.000/6.000/10.000 ore
Compatibilitate formate video: SDTV(480i, 576i), EDTV (480p, 576p), HDTV (720p,
1080i/p), NTSC (M, 3.58/4.43 MHz), PAL (B, D, G, H, I, M, N), SECAM (B, D, G, K, K1, L)
Dimensiuni: 275 x 100 x 212 mm
Greutate: 2.3 kg
Cod
VP000102

Videoproiector Epson EB-X02 3LCD


Tehnologia de afiare: 3 LCD
Luminozitate: 2.600 lumeni
Contrast: 3.000:1
Rezoluie recomandat: XGA (1024 x 768 pixeli)
Putere lamp: 200 W
Durata de via a lmpii: 4.000 - 5.000 ore
Dimensiuni: 295 x 228 x 77 mm
Greutate: 2.3 kg
Cod
VP000201

278

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ecrane de proiecie i accesorii

COMAND
SPECIAL

Produse disponibile la comand


special. Pentru gama complet,
contacteaz consultantul tu de vnzri.

Ecran de proiecie

Ecran de proiecie
cu tripod

Ideal pentru prezentri sau proiecii cinema. Ecranul dispune de un toc de


dimensiuni reduse, foarte uor de instalat pe perete sau tavan. Extinderea pnzei
de proiecie se face prin roll-up manual. Dispune de o mecanic rezistent i de
calitate.

Ideal pentru prezentri i proiecie cinema, foarte mobil i uor


de folosit. nlimea pnzei de proiecie este reglabil i n partea
superioar i n partea inferioar, dispunnd de un mecanism de
calitate i durabil.

Cod
PS544754

Dimensiuni (cm)

Cod
PS531554

Dimensiuni (cm)

150 x 200

PS544760

180 x 240

PS531560

180 x 240

COMUNICARE I PREZENTARE

06

150 x 200

Presenter cu laser pentru videoproiector


Indicator cu laser
Compact, cu receiver USB i laser pointer pentru a controla prezentrile ntr-un mod
profesionist. Raz de aciune 10 m, tehnologie Power Saving, pad direcional,
4 butoane de control.
Cod
TU050109

Indicator cu laser, elegant, modern i uor de folosit, carcas metalic


neagr. Lungimea razei: 100 m, diametrul razei: 4 mm. Baterie inclus.
Cod
PS10343

lantern led

receptor USB retractabil inclus n capac indicator laser

vrf pentru touch screen

Pix Leitz Stylus Pro Presenter


Multifuncional: control PC wireless, indicator laser pentru prezentri, pix rencrcabil
i vrf din silicon pentru ecran tactil. Sistem plug-and-play pentru Windows i Mac,
nu necesit software. Pix de calitate, cerneal neagr (rezerv tip D1, lungime 67 mm).
UHFHSWRU86%QLQWHULRUXOFDSDFXOXLDSDVLJOLVHD]
EXWRDQHSHQWUXFRQWUROSDJLQVXVMRVLLQGLFDWRUODVHU
LQGLFDWRUODVHUURXSHUIHFWSHQWUXPDUFDUHQFDGUXOSUH]HQWULL
YUILQWHUVFKLPEDELOSHQWUXGLVSR]LWLYHFXHFUDQWDFWLO
UD]GHDFLXQHSQODP

indicator laser

Pix multifuncional Leitz Stylus 4 n 1


Rencrcabil, dotat cu indicator laser pentru prezentri, vrf pentru touch screen i
lantern LED integrat. Evitai lsarea amprentelor, zgrierea i murdrirea ecranului
cu ajutorul vrfului de silicon. Raza de aciune a indicatorului laser ajunge pn la
100 m. Include baterii.

Cod
SL647701

Culoare

Cod
SL641401

Culoare

alb

SL647702

negru

SL641402

negru

alb

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

279

accesorii pentru table

Set accesorii Starter Kit


pentru tabl
Conine:
4 markere TZ100 pentru table de conferin (negru, rou, albastru, verde)
1 suport pentru markere
1 burete
10 erveele pentru burete
1 spray pentru curat tabla (125 ml)
10 magnei de susinere cu diametrul de 30 mm

06
COMUNICARE I PREZENTARE

Cod
PS1038

Set accesorii Basic Kit pentru tabl


Conine:
4 markere TZ100 (negru, rou, albastru, verde)
1 burete
1 spray pentru curat tabla (125 ml)
4 magnei cu diametrul de 30 mm
Cod
PS125100

Set accesorii Standard


Kit pentru tabl
Conine: 1 set rezerve burete magnetic (12 buci), 1 set 4 markere colorate,
1 soluie curat tabla 250 ml, 20 magnei colorai pentru tabl.
Cod
DH095138

Set accesorii tabl


Conine:
4 markere
1 burete
1 spray soluie pentru curat tabla (125 ml)
5 magnei colorai pentru tabl
Cod
AY160008

280

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

accesorii pentru table

Soluie pentru curare table


Pe baz de detergent i alcool, soluia pentru curat
table ajut la protejarea suprafeei de scris.
Cantitate

SUPER
CALITATE

125 ml

Soluie pentru curare table


Spray conceput special pentru a cura table, ajut la prelungirea duratei de utilizare
a tablei i o menine n stare bun pentru o perioad ndelungat.
Cod
AL11305

06
COMUNICARE I PREZENTARE

Cod
PS10300

Cantitate
250 ml

Soluie pentru curare table


Spray conceput special pentru curarea tablelor. nltur perfect urmele de scriere.
Cantitate: 250 ml.
Cod
AY160010

Serveele pentru curare table


Impregnate cu soluie de curare pentru tabl, fr alcool.
Unitate de vnzare: 100 erveele cu dispenser.
Cod
DB575902

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

281

accesorii pentru table

Burete magnetic
Burete ce asigur o foarte bun curare a tablei magnetice sau nemagnetice.
Magnet ncorporat pentru susinere pe tabla magnetic.
tergere uoar i rapid. Calitate superioar. Dimensiuni: 7.5 x 4.5 x 16 cm.
CALITATE
PRE

Cod
AY151200

06

Rezerv hrtie (100 file/set)

COMUNICARE I PREZENTARE

Cod
AY151201

Burete magnetic pentru


curare table
Design modern, asigur o curare rapid i uoar a tablei. Magnet integrat pentru
o susinere perfect pe tabl. Dimensiuni: 17 x 7 cm. Hrtia de tergere poate fi
nlocuit cu uurin.

Cod
PS1032

Rezerv hrtie (100 file/set)


Cod
PS1033

Set Magic Wipe


Ideal pentru toate tablele de conferin. terge chiar i urmele de marker
permanent. Se folosete cu ap. Fiecare pachet conine doi burei i un erveel.
Cod
PS121500

lavabil

SUPER
CALITATE

Burete pentru ters tabla


Asigur o curare rapid a tablei. Este compus din mai multe straturi ce se pot
ndeprta n cazul deteriorrii.
Cod
AY160009

Burete
Utilizat n special pentru table magnetice.
Cod
BV021111

282

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

accesorii pentru table

COMUNICARE I PREZENTARE

06
Magnei de susinere
Unitate de vnzare: 10 buci/set.
Cod
AY150201

Diametru (mm)

Mas susinut

Culoare

13

100 g

rou

AY150202

13

100 g

verde

AY150203

13

100 g

albastru

AY150204

13

100 g

alb

AY150205

13

100 g

negru

AY150301

24

300 g

rou

AY150302

24

300 g

verde

AY150303

24

300 g

albastru

AY150304

24

300 g

alb

AY150305

24

300 g

negru

AY150401

32

800 g

rou

AY150402

32

800 g

verde

AY150403

32

800 g

albastru

AY150404

32

800 g

alb

AY150405

32

800 g

negru

Band magnetic
Band magnetic autoadeziv. Prin simpla ataare a unei fii de band, orice
obiect poate deveni magnetic. Dimensiuni: 12.5 mm x 3 m/rol.
Cod
PS186100

transform orice obiect


ntr-unul magnetic
SUPER
CALITATE

Ace pentru table


Cod
BV021211

Culoare

Unitate de vnzare

divers colorate

50 buci/cutie

Oricare ar fi meseria ta, avem produsul potrivit.

283

sisteme de prezentare
Sistem de prezentare
Sherpa Motion
Cuprinde: 1 suport modular de birou pentru 10 display-uri i 10
display-uri A4 din polipropilen. Permite rotirea complet, precum
i un unghi de citire cuprins ntre 25 i 70o.
Cod
DB558737

COMUNICARE I PREZENTARE

06

pentru birou
SUPER
CALITATE

GARANIE

posibiliti multiple de utilizare: birou, recepii, showroom-uri etc

unghi de citire ntre 25o i 70o

poate fi rotit la 360o

display-urile se pot ataa


cu uurin

Sistem de prezentare
Sherpa Soho
Proiectat special pentru birourile n care spaiul este limitat.
Capacitate fix pentru 5 display-uri, baz compact i foarte
stabil. Conine: 1 suport de birou pentru 5 display-uri i
5 display-uri din polipropilen, cu ram neagr.
Cod
DB554001

SUPER
CALITATE

GARANIE

pentru birou

scaneaz cu
telefonul!

acces facil la informaia prezentat

display-urile se pot ataa cu uurin

Sisteme care se adapteaz perfect nevoilor tale.


- design modern i atrgtor, practice i deosebit de utile pentru birou i sli de prezentare, recepii, trguri, ateliere, agenii de turism
- asigur o prezentare remarcabil oricrui tip de informaie (liste de preuri, pagini de catalog, informaii generale etc.)
- mai multe detalii pe www.durable-live.com. Scaneaz cu telefonul codul QR alturat!

284

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

sisteme de prezentare

Sistem de prezentare
Sherpa 10
Cuprinde: 1 suport de fixare pe perete i 10 display-uri A4. Suportul
de perete este fabricat din metal i are o capacitate de 10 display-uri
A4. Display-urile sunt din polipropilen transparent, 5 cu ram
roie i 5 cu ram neagr, 10 indeci cu etichet alb. Se livreaz cu
accesoriile necesare montrii pe perete.
Cod
DB563100

pentru perete

06

SUPER
CALITATE

COMUNICARE I PREZENTARE

GARANIE

suport de prindere pe perete

acces facil la informaia prezentat

display-urile se pot ataa cu uurin

indeci laterali cu etichet pentru o cutare uoar

Sistem de prezentare
Vario Pro 10

SUPER
CALITATE

Poate fi folosit ca sistem de prezentare de birou sau de perete, att


n format landscape, ct i portrait. Setul conine: 1 suport pentru
display-uri, 10 display-uri, cu cte dou buci din culorile negru,
rou, galben, verde, albastru i 10 indeci cu etichet alb.

GARANIE

Cod
DB557900
pentru birou i perete

display portrait pentru perete

display landscape pentru perete

display portrait pentru birou

display landscape pentru birou

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

285

sisteme de prezentare
pentru birou

Sistem de prezentare
Function 10 pentru birou
Conine: 1 suport de birou i 10 display-uri A4. Suportul de birou: din
metal, stabil, capacitate 10 display-uri A4. Display-urile: format A4,
din polipropilen transparent, 5 cu ram roie i 5 cu ram albastr,
10 indeci cu etichet alb, perforaii standard pentru ndosariere n
bibliorafturi sau caiete mecanice.

COMUNICARE I PREZENTARE

06

Cod
DB569300

SUPER
CALITATE

GARANIE

indeci laterali cu etichet pentru o cutare uoar

perforaii pentru ndosariere

Sistem de prezentare
Function 10/20 pentru perete
Conine: 1 suport de fixare pe perete i 10 display-uri A4 (Function
10)/20 display-uri A4 (Function 20). Suportul de perete: din metal,
capacitate 10 sau 20 display-uri A4 n funcie de model. Se livreaz
cu accesoriile necesare montrii pe perete.
Display-urile: format A4, din polipropilen transparent. Function
10: 5 cu ram roie, 5 cu ram albastr i 10 indeci cu etichet alb.
Function 20: 5 buci din fiecare culoare (rou, verde, galben i
albastru) i 20 indeci cu etichet alb. Sunt prevzute cu perforaii
standard pentru ndosariere n bibliorafturi sau caiete mecanice.

pentru perete

Cod
DB569100

Model

DB569200

Function 20

Function 10

SUPER
CALITATE

GARANIE

indeci laterali cu etichet pentru o cutare uoar

286

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ecusoane

DURACARD
Cardurile tale personalizate
printate mai uor ca oricnd!
Doreti s creezi i s imprimi carduri din plastic profesionale din confortul propriului birou? Acum
poi realiza acest lucru cu noua imprimant DURACARD 300 pentru cri de identitate din plastic,
carduri de membru, carduri de acces, carduri de fidelitate i multe altele. Imprimi carduri din plastic
de nalt calitate, rapid i fr cheltuieli suplimentare.

creeaz-i propriul design


folosind softul inclus

printeaz-i cardurile

protejeaz-i i
accesorizeaz-i cardurile

nlocuire uoar a ribonului

Set printare
+

ULERQFRORUVLFDUGXULVWDQGDUG
grosime 0.76 mm
FRGDB891300

sistem simplu de crcare a cardurilor

Imprimant DURACARD ID 300


Folosite pe scar larg pentru fidelizare i identificare / acces, imprimantele de
carduri au posibilitatea de a tipri full-color imagini i text pe carduri PVC, de a
encoda band magnetic, cip-uri sau de a lamina carduri. Imprimanta DuraCard
ID300 reprezint o alegere inteligent n materie de realizare legitimaii i carduri de
fidelitate.
LPSULPFDUGXULFXGLPHQVLXQL[FP
SULQWDUHPRQRFURPFRORULWUDQVIHUWHUPLF
SULQWDUHSHKUWLHIRWROHUH]ROXLH[GSL
SUPER
PHPRULH0%
CALITATE
FRPSDWLELOLWDWH86%
Imprimanta DURACARD ID 300 precum
Cod
i consumabilele sunt disponibile la
COMAND
DB891000
SPECIAL
comand special.

COMUNICARE I PREZENTARE

06

Ribon color

Ribon monocrom

SHQWUXSULQWXUL
FRGDB891122

SHQWUXSULQWXUL
FRGDB891201

Carduri lucioase

Carduri standard

FDUGXULVHW
JURVLPHPP
FRGDB891402

FDUGXULVHW
JURVLPHPP
FRGDB891502

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

287

ecusoane

Suport card acces


Ideal pentru cei ce doresc s i protejeze cartela de acces,
cardul sau legitimaia. Fabricat din PVC fiind rezistent la uzur.
Cod
DB80051925

Dimensiuni (mm)

Unitate de vnzare

54 x 85

25 buci/cutie

COMUNICARE I PREZENTARE

06

Ecusoane transparente cu clip


Fabricate din PVC. Clipul rotativ asigur poziia vertical a ecusonului.
Conin un carton alb care poate fi nlocuit cu uurin. Culoare: transparent.
Cod
DB800219
DB8003190

Dimensiuni (mm)

Unitate de vnzare

90 x 60 (vertical)

bucat

90 x 60 (vertical)

cutie (25 buci)

60 x 90 (orizontal)

bucat

60 x 90 (orizontal)

cutie (25 buci)

Ecusoane Click Fold


Sistem inovator ce permite nlocuirea rapid i simpl a cartonaelor.
Fabricate din polipropilen, foarte rezistente.
Dimensiuni: 54 x 90 mm.
Cod
DB82141925

SUPER
CALITATE

288

Sistem de ataare

Unitate de vnzare

cu ac i clip

25 buci/cutie

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

ecusoane
Etichete textile de identificare
Etichetele de identificare sunt realizate dintr-un material textil, ce prezint
un aspect impecabil. Adezivul folosit este special i nu atac estura pe care
sunt aplicate, excepie fcnd pielea natural, catifeaua i mtasea. Se pot
scrie de mn sau imprima. Sunt ideale pentru traininguri, convenii, congrese
sau teambuildinguri. Etichetele de identificare sunt varianta economic a
ecusoanelor. Format: A4. Unitate de vnzare: 20 coli/top.
Cod: AL12252
63.5 x 29.6 mm
540 etichete

Pentru gama
complet de
etichete consult
paginile 238-241

Nu utilizai etichetele pe
materiale din mtase,
piele sau catifea.

06

A4

Ecusoane simple

20
COLI

COMUNICARE I PREZENTARE

Cod
AL12252

Realizate din PVC, transparente. Nu sunt prevzute cu clip de prindere.


Cod
CP2006
CP2007

Dimensiuni (mm)

Unitate de vnzare

60 x 90 (orizontal)

bucat

60 x 90 (orizontal)

cutie (100 buci)

63 x 85 (vertical)

bucat

63 x 85 (vertical)

cutie (100 buci)

Ecusoane de birou
Culoare: transparent.
Unitate de vnzare: 25 buci/cutie.
Cod
DB900022

Dimensiuni (mm)

DB900021

61 x 150

DB900023

105 x 297

52 x 100

Ideale pentru conferine, seminarii, recepii, birouri, restaurante. Se pot utiliza i


pentru descrierea produselor, afiarea preurilor n vitrine sau standuri din expoziii.
Conin etichete albe, interschimbabile (acestea pot fi inserate pe ambele pri).

nur textil pentru ecusoane


Prevzut cu sistem de nchidere ce se deschide dac ecusonul este agat.
Lungime: 44 cm, lime: 2 cm.
Cod
DB813701
DB813707

Culoare

Unitate de vnzare

negru

bucat

negru

cutie (10 buci)

albastru

bucat

albastru

cutie (10 buci)

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

289

ecusoane
nur textil pentru ecusoane
Prevzut cu sistem de nchidere, uor de desfcut n caz de blocare, prevzut cu o
clem din plastic ce permite o schimbare rapid a ecusonului.
Lungime: 42 cm, lime: 1.5 cm.
Unitate de vnzare: 10 buci/set.
Cod
PV010404

Culoare
negru

COMUNICARE I PREZENTARE

06
nur retractabil
pentru ecusoane
Ecusonul se ataeaz cu ajutorul sistemului de prindere cu caps. Clip metalic
pe spate pentru ataarea la buzunar sau curea. Lungime: 80 cm.
Culoare: negru.

SUPER
CALITATE

Cod
DB815219

Unitate de vnzare
bucat
cutie (10 buci)

nur retractabil pentru ecusoane


Ecusonul se ataeaz cu ajutorul sistemului de prindere cu caps. Clip metalic pe
spate pentru ataarea la buzunar sau curea. Lungime: 70 cm. Culoare: negru.
Unitate de vnzare: 10 buci/cutie.
Cod
PV010402

Lnior pentru ecusoane


Lungime: 70 cm.
Cod
AT407600
PV010403

Unitate de vnzare
bucat
cutie (100 buci)
set (10 buci)

Clips pentru ecuson


Fabricat din metal.
Unitate de vnzare: 25 buci/cutie.
Cod
PV010401

Clipsuri pentru ecusoane


Fabricate din metal.
Unitate de vnzare: 100 buci/cutie.
Cod
AT210002

290

Unitate de vnzare
bucat
cutie (100 buci)

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

7. Tehnic de birou
notebook

292

accesorii pc i laptopuri

312

geni pentru laptop

293

medii de stocare

314

sisteme pc

298

produse curare IT

316

monitoare

299

calculatoare de birou

320

imprimante

300

ghilotine

322

tablete

306

trimmere

323

smartphone

307

distrugtoare de documente

324

maini de numrat bani

308

aparate de ndosariat

330

boxe i telefoane

309

aparate de laminat

332

kituri i tastaturi

310

accesorii ndosariere i laminare

335

mouse

311

notebook
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

Notebook HP ProBook 450


Ecran: HD BrightView iluminat din fundal cu LED-uri,
cu diagonal de 39.6 cm (15.6)
Procesor: Intel Core i5
Memorie: SDRAM DDR3L de 8 GB, 1600 MHz (2 x 4 GB)
HDD: 1 TB 5400 rpm SATA
Video: ATI Radeon R5 M255
(memorie dedicat DDR3 de 2 GB)
Dimensiuni: 38.56 x 25.8 x 2.26 cm
Greutate: 2.3 kg

TEHNIC DE BIROU

07

Cod
NB000500

Notebook Lenovo ThinkPad E534


Ecran: HD Antiglare (1366 x 768)
(200 NITS) de 15.6
Procesor: Intel Core i5
Memorie: SDRAM DDR3L de 4 GB,
1600 MHz (1 x 4 GB)
HDD: 1 TB 5400 rpm SATA + SSD 128 GB
Video: NVIDIA GeForce GFZ40M
2 GB VRAM
Dimensiuni: 37.7 x 25 x 2.5 cm
Greutate: 2.44 kg
Cod
NB000600

Notebook Dell Latitude E5440


Ecran: Afiaj antireflex HD (1366 x 768) cu LED-uri, de 15.6
Procesor: Intel Core i3
Memorie: SDRAM DDR3L de 4 GB, 1600 MHz (1 x 4 GB)
HDD: 500 GB 5400 rpm SATA
Video: plac grafic integrat Intel HD 4600
Dimensiuni: 25 x 33.4 x 37.9 cm
Greutate: 2.6 kg
Cod
NB000700

Notebook Toshiba Tecra 250-A-180


Ecran: Full HD (1900 x 1080, 16:9) non-reflective High Brightness display, 15.6
Procesor: Intel Core i7-4800MQ
Memorie: 16GB DDR3 1600 MHz (max 32 GB)
HDD: 1 TB 5400 rpm SATA + SSD 512 GB
Video: Intel HD
Dimensiuni: 38.9 x 25.39 x 3.49 cm
Greutate: 2.7 kg
Cod
NB000800

292

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

geni pentru laptop


Geant Yukon pentru laptop
Geant cu un compartiment de protecie, potrivit pentru majoritatea laptopurilor
de 17. Prevzut cu un compartiment tip organizer, buzunar Quik Pocket i
buzunar pentru accesorii detaabil. Mner ergonomic ranforsat i curea de umr
rezistent la rupere. Respect restriciile marilor companii aeriene privind bagajele
de mn pentru genile de laptop. Dimensiuni: 432 x 318 x 102 mm. Greutate: 1.5 kg.
Cod
WG000102

07
TEHNIC DE BIROU

buzunar detaabil
pentru accesorii

Geant Legacy pentru laptop


Geant cu un compartiment de protecie, potrivit pentru majoritatea laptopurilor
de 16. Prevzut cu un compartiment tip organizer, buzunar Quik Pocket i
buzunar detaabil pentru accesorii. Mner ergonomic ranforsat i curea de umr
rezistent la rupere. Respect restriciile marilor companii aeriene privind bagajele
de mn pentru genile de laptop. Dimensiuni: 413 x 305 x 114 mm. Greutate: 1.5 kg.
Cod
WG000100
buzunar detaabil
pentru accesorii

Geant Rhea pentru notebook


Geant de laptop pentru dame, potrivit pentru majoritatea laptopurilor de 15.6.
Prevzut cu buzunar detaabil pentru accesorii, mnere prindere moi, model slim.
Respect restriciile marilor companii aeriene privind bagajele de mn pentru
genile de laptop.
Dimensiuni: 406 x 305 x 114 mm. Greutate: 1.1 kg.
Cod
WG000105

Rucsac Pegasus pentru laptop


Potrivit pentru majoritatea laptopurilor cu ecran lat de 17. Prevzut cu buzunar
SWISSGUARD pentru computer, buzunar tip organizer, buzunar Quik Pocket i
buzunar pentru iPod/MP3 player. Platform stabilizare baz, sistem de spate
anatomic i curele pentru umr cu absorbie a ocurilor. Respect restriciile marilor
companii aeriene privind bagajele de mn pentru genile de laptop.
Dimensiuni: 380 x 510 x 165 mm. Greutate: 1.9 kg.
Cod
WG000103

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

293

geni pentru laptop


www.leitz.com/complete

Geni Smart Traveller


Proiectate avnd n minte ateptrile i nevoile
oamenilor de business moderni, care cltoresc
frecvent n interes de serviciu. Genile sunt uoare,
spaioase, realizate din materiale de calitate
superioar i cu un design ingenios ce faciliteaz
organizarea eficient.

TEHNIC DE BIROU

07

Clasa business se regsete n fiecare detaliu.


Toate genile Smart
Traveller au fost
premiate cu IF
Design Award.

Geant Smart Traveller pentru laptop


Poliester uor i robust, pentru confortul zilnic.
Compartimentul frontal permite accesul rapid la telefon, paaport, cri de vizit,
instrumente de scris etc.
Buzunar frontal pentru acces rapid la mini-tablet sau eBook reader.
Buzunar principal pentru laptop, cu cptueal moale, pentru protecia ecranului.
Cu sistem de fixare pe troler, mnere scurte din piele i curea de umr
13 buzunare spaioase.

buzunare din plas

Cod
SL999941

Display

Compartiment principal (mm)

15.6

410 x 310 x 100

SL999938

13.3

370 x 270 x 75

lavet pentru ecran

ecuson de identificare

LEITZ COMPLETE
ACCESORII PENTRU PROFESIONITII MOBILI

Hus Power
Cu fermoar metalic pentru protecia dispozitivului mobil i buzunar frontal separat,
ce permite ncrcarea bateriei folosind ncrctorul Leitz Complete cu USB.

294

Cod
SL999996

Display

Compartiment principal (mm)

15.6

400 x 280 x 30

SL999997

13.3

345 x 250 x 25

SL999947

10

290 x 220 x 20

Hus Organizer pentru Tablet 10


Cu buzunare pentru caiet/blocnotes A4, stilou, cri de vizit, cabluri i ncrctor.
Destinat tabletelor de 10.
Cod
SL991000

Display

Compartiment principal (mm)

10

290 x 220 x 20

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

geni pentru laptop


www.leitz.com/complete
Geant Smart Traveller pentru tablet
Pentru transportul tabletei i al altor dispozitive mobile,
documente A5 etc.
Include curea de umr.
10 buzunare, inclusiv acces rapid la buzunarul frontal
pentru smartphone.
Compartiment principal (mm)
230 x 280 x 50

Geant Messenger Smart Traveller


Pentru transportul dispozitivelor mobile,
al documentelor A4 etc.
Dotat cu mner scurt din piele i curea de umr.
Cu sistem de fixare pe troler.
Cod
Display
SL999943 15.6

Compartiment principal (mm)


380 x 280 x 130

07
TEHNIC DE BIROU

Cod
Display
SL999946 10

Rucsac Smart Traveller


Expandabil, pentru a crea spaiu suficient pentru dispozitive mobile,
documente A4, dosare, biblioraft etc.
Prevzut cu sistem de ventilaie pentru spate.
20 de buzunare, inclusiv buzunare pentru laptop i tablet cu
cptueal moale pentru protecia ecranului i buzunare latelare
pentru sticl i umbrel.
Hus detaabil separat, pentru cablul de alimentare i adaptorul
de priz.
Cod
SL999942

Display

Compartiment principal (mm)

15.6

310 x 400 x 150

Geant Shopper Smart Traveller


Pentru transportul dispozitivelor mobile i al documentelor A4.
Dotat cu mnere lungi din piele.
Cu sistem de fixare pe troler.
Hus detaabil separat, pentru cablul de alimentare i adaptorul
de priz.
Cod
SL991001

Display

Compartiment principal (mm)

13.3

380 x 280 x 130

Geant Smart Traveller cu dou rotile

Geant Smart Traveller cu patru rotile


Dimensiune potrivit pentru cabina avionului i sistem
multidirecional pe 4 roi.
Pentru laptop, documente A4 i mbrcminte.
Mner superior i lateral pentru o manevrare uoar.
Cod
SL999998

Compartiment principal (mm)

Dimensiune potrivit pentru cabina avionului. Pentru transportul


unui schimb de haine i al documentelor A4.
Mner superior din metal, extensibil.
Cu sistem de fixare pe troler.
Alte dotri utile, precum suport de chei.
Compartiment separat pentru mbrcminte.
Cod
SL999999

Compartiment principal (mm)


420 x 370 x 200

380 x 550 x 225

Oricare ar fi meseria ta, avem produsul potrivit.

295

geni pentru laptop


Geant Index pentru notebook
Geant subire pentru laptop de 16, cu buzunar pentru tablet/eReader. Conine
buzunar de organizare, curea de umr reglabil, buzunar interior pentru tablet
i breloc. Respect restriciile marilor companii aeriene privind bagajele de mn
pentru genile de laptop.
Dimensiuni: 420 x 320 x 80 mm.
Greutate: 1.2 kg.

07
TEHNIC DE BIROU

Cod
WG000106

Rucsac Rio pentru laptop


Rucsac troller pentru laptop de 16 cu compartiment pentru laptop i haine.
Prevzut cu roi i mner metalic pentru o deplasare mai uoar.
Dimensiuni: 220 x 350 x 550 mm.
Greutate: 2.1 kg.
Garanie: 3 ani.
Cod
TU050111

GARANIE

special conceput
pentru deplasri

Geant Rio pentru laptop


Geant pentru laptop de 16, buzunar interior pentru tablet i buzunar exterior
pentru documente.
Dimensiuni: 400 x 280 x 100 mm.
Greutate: 1.6 kg.
Garanie: 3 ani.

GARANIE

Cod
TU050110

296

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

geni pentru laptop

Geant Sydney pentru laptop


Geant premium pentru laptopuri cu monitor de pn la 17.3 i periferice.
Dimensiuni compartiment principal: 420 x 298 x 50 mm. Compartimente extra.
Materiale rezistente, de calitate superioar. Curea ajustabil pentru umr.
Cod
TU050102

TEHNIC DE BIROU

07

Geant Oslo pentru laptop


Geant casual pentru a purta cu stil laptopuri cu monitor de pn la 16.
Dimensiuni compartiment principal: 385 x 266 x 44 mm. Material textil rezistent
i finisri de nalt calitate. Compartimente extra. Curea ajustabil pentru umr.
Mnerele pot fi pliate n interiorul genii.
Cod
TU050100

mnere pliabile n interior

Geant Classic pentru laptop


Geant premium pentru laptopuri i periferice. Interior buretat, pentru protecie de
calitate. Compartimente extra. Curea ajustabil pentru umr.
Cod
Dimensiuni display
TU050107 15.6
TU050108 17

Dimensiuni compartiment principal (mm)


385 x 315 x 45
420 x 325 x 45

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

297

sisteme pc

TEHNIC DE BIROU

07
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

Sistem PC HP Pavilion All-in-One


Procesor: Intel Core i5
Memorie: SODIMM DDR3 de 8 GB
HDD: 1 TB 7200 rpm SATA
Video: plac grafic Intel HD 4400
Surs: adaptor de alimentare de c.a. de 90 W
Sistem de operare: Windows 8.1 64
Tastatur: inclus
Mouse: inclus
Monitor: IPS WVA FHD de 58.4 cm (23), iluminat din
fundal cu LED-uri (1920 x 1080)
Cod
SI000401

Sistem PC IdeaCentre
Procesor: Intel Core i7
Memorie: SODIMM DDR3 de 8 GB
HDD: 1 TB 7200 rpm SATA
Video: plac video nVIDIA GF820 2 GB
Surs: adaptor de alimentare de c.a. de 90 W
Sistem de operare: Windows 8.1 64
Tastatur: inclus
Mouse: inclus
Monitor: ecran LCD de 21.5 cu panou de
iluminare LED de fundal (1600 x 900) (250 NIT)
Cod
SI000501

Sistem PC Office Business RTC


Procesor: Intel Core i5
Memorie: 4 GB PC3-10600 DDR3-1600 MHz
HDD: 1 TB 7200 rpm SATA
Video: NVIDIA GeForce GT 620 PCI Express 2.0 DDR3 1 GB
Surs: 450 W
Sistem de operare: Linux
Tastatur: inclus
Mouse: inclus
Cod
SI000601

298

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

monitoare

07
Produse disponibile la comand special. Pentru gama complet, contacteaz
consultantul tu de vnzri.

TEHNIC DE BIROU

COMAND
SPECIAL

Monitor LG 24M47H-P

Monitor Samsung S22C200B


Diagonal: 21.5 W
Tip ecran: LED TN
Aspect imagine: 16:9
Timp de rspuns: 5 ms
Rezoluie optim: 1920 x 1080 px (FHD)
Unghi vizibilitate: 170/160

Contrast tipic: 1000:1


Luminozitate: 250 cd/m
Conectori: D-sub, USB, HDMI
Dimensiuni: 504 x 385 x 185 mm
Greutate: 3.4 kg

Cod
MO000501

Diagonal: 24 W
Tip ecran: LED IPS
Aspect imagine: 16:9
Timp de rspuns: 5 ms
Rezoluie optim: 1920 x 1080 (FHD)
Unghi vizibilitate: 170/160

Contrast tipic: 1000:1


Luminozitate: 250 cd/m
Conectori: D-sub, USB, DVI, HDMI
Dimensiuni: 555 x 339 x 195 mm
Greutate: 2.8 kg

Cod
MO000601

Monitor AOC M2870VQ

Monitor Philips 234E5QDAB


Diagonal: 23 W
Tip ecran: LED
Aspect imagine: 16:9
Timp de rspuns: 5 ms
Rezoluie optim: 1920 x 1080 (FHD)
Unghi vizibilitate: 178/178

Contrast tipic: 1000:1


Luminozitate: 250 cd/m
Conectori: VGA, DVI-D, HDMI
Dimensiuni: 532 x 414 x 213 mm
Greutate: 19.3 kg

Diagonal: 28 W
Tip ecran: MVA
Aspect imagine: 16:9
Timp de rspuns: 5 ms
Rezoluie optim: 1920 x 1080 (FHD)
Unghi vizibilitate: 178/178

Contrast tipic: 3000:1


Luminozitate: 300 cd/m
Conectori: D-sub, DVI-D, HDMI, audio
Dimensiuni: 652 x 566 x 254 mm
Greutate: 4.8 kg

Cod
MO000801

Cod
MO000701

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

299

imprimante
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet,


contacteaz consultantul tu de vnzri.

Imprimant monocrom
Xerox Phaser 3260

TEHNIC DE BIROU

07

de la complex
la simplu

pre avantajos

rezultate excelente

Xerox Phaser 3260 pe scurt:


&RQHFWLYLWDWH:L)LLQWHJUDW
9LWH]GHLPSULPDUHGHSQODSSP$
5H]ROXLHGH[GSL[GSLODFDOLWDWHPEXQWLW
3URFHVRUSXWHUQLFGH0+]
,PSULPDUHUDSLGDSULPHLSDJLQLQQXPDLVHFXQGH

Imprimare rapid
Viteza de pn la 28 ppm i timpul de imprimare a primei pagini de numai 8,5 secunde
v permit s petrecei mai puin timp n preajma dispozitivului i s v concentrai n
schimb pe activitile mai importante.
Economisii mai mult dect bani
Imprimarea standard automat fa-verso face economie de timp preios i hrtie,
iar modurile de economisire a energiei i a tonerului i driverul de imprimare Earth
Smart v permit s cheltuii mai puin pentru energie electric i consumabile.
Puternic i productiv
Memoria standard de 256 MB i procesorul de 600 MHz asigur imprimarea rapid i
precis a lucrrilor, chiar i atunci cnd conin un numr mare de elemente grafice.
Impact vizual
Imprimarea la calitatea mbuntit a imaginii de 4800 x 600 dpi, asociat cu
emulrile PCL i PostScript, asigur un nivel constant de claritate a textului i o mare
precizie a elementelor grafice.
Wi-Fi Direct
Telefoanele mobile, tabletele i laptopurile se pot conecta acum n siguran direct
la imprimant sau la echipamentul multifuncional, chiar n absena unei reele
wireless existente.
Nu e complicat. Xerox Easy Wireless Setup v permite s v conectai rapid i uor la
reeaua Wi-Fi.
Accesibilitate
Aceste dispozitive, caracterizate prin funcionare silenioas, conectivitate wireless
integrat i design compact, se potrivesc exact acolo unde avei nevoie de
productivitate maxim.
Multiple opiuni pentru suporturi de imprimare
Imprimai uor pe o varietate de dimensiuni personalizate i o gam larg de
suporturi, inclusiv folii transparente, carton, plicuri i cri potale.
Cod
XC710700

Imprimant laser color


Xerox Phaser 6022
Calitate superioar a imaginilor
Calitatea mbuntit de 1200 x 2400 dpi, asigurat de sistemul de imprimare
Hi-Q LED, nseamn imprimare color de nalt rezoluie, cu aliniere exact a
imaginilor i detalii extraordinare.
Conectivitate simplificat
Cu Wi-Fi Direct, telefoanele mobile, tabletele i laptopurile pot fi conectate n
siguran direct la imprimant sau la echipamentul multifuncional, chiar dac
nu dispunei de o reea wireless. n plus, prin soluiile de imprimare mobil
Apple AirPrint, Xerox PrintBack, i Google Cloud Print imprimarea direct de pe
dispozitivele mobile nu a fost niciodat mai simpl.
Mai multe rezultate, timp de ateptare redus
Echipat cu un procesor de 525 MHz i memorie standard de 256 MB, echipamentul
Phaser 6022 asigur o vitez de imprimare de 18 ppm color i alb-negru, producnd
prima pagin color n mai puin de 13 secunde.
cloud

comunicare

simplificare

Cod
XC710101

Xerox Phaser 6022 pe scurt:


9LWH]DGHLPSULPDUHGHSQODSSPFRORULDOEQHJUX$
[GSLODFDOLWDWHPEXQWLWDLPDJLQLL
9ROXPGHOXFUXUREXVWGHSQODSDJLQLSHOXQ
6LVWHPXOGHLPSULPDUHDYDQVDW+L4/('L7RQHU;HUR[ EA-Eco
6LPXOULGHFXORDUHFDOLEUDWH3$1721(
&RQHFWLYLWDWHZLUHOHVVLQWHJUDW:L)L'LUHFW
6ROXLLGHLPSULPDUHPRELO$SSOH AirPrint, Xerox
PrintBack, Google Cloud Print

300

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

imprimante
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet,


contacteaz consultantul tu de vnzri.

Multifuncional monocrom
Xerox WorkCentre 3225

Cod
XC611100

07
TEHNIC DE BIROU

Compact, silenios i uor


Echipamentul WorkCentre 3225 se potrivete perfect n spaii nguste i aglomerate.
Calitatea mbuntit a imaginii, de 4800 x 600 dpi, permite producerea de
imagini i text clare, cu redare perfect a detaliilor.
Economisii timp copiind i scannd documente cu mai multe pagini prin dispozitivul
automat de alimentare pentru 40 de coli.
Scanarea ctre e-mail
Permite transmiterea documentelor de pe hrtie direct ctre destinatarii e-mailurilor,
de la panoul frontal fr s fie nevoie de deplasri repetate la computer.
Gama cuprinztoare de funcii de copiere include micorare/mrire, tergerea
automat a fondului, controlul luminozitii n 3 trepte, colaionarea, copierea
cardurilor de identitate i dispunerea mai multor pagini pe o singur coal.
Varietate larg de funcii
Asigur securitatea datelor dumneavoastr confideniale, aici regsindu-se
protocoalele de securitate de reea SNMPv3 i IPv6, precum i recepionarea securizat
a faxurilor, care reine un fax pn cnd un utilizator autorizat se conecteaz pentru
a-l recupera. Echipamentul se livreaz mpreun cu software pentru managementul
documentelor scanate i OCR: Nuance Paperport, Image Retriever i ABBYY FineReader
Professional.
Wi-Fi Direct
Telefoanele mobile, tabletele i laptopurile se pot conecta acum n siguran direct
la imprimant sau la echipamentul multifuncional, chiar n absena unei reele
wireless existente. Xerox Easy Wireless Setup v permite s v conectai rapid i uor
la reeaua Wi-Fi.
Accesibilitate
Aceste dispozitive, caracterizate prin funcionare silenioas, conectivitate wireless
integrat i design compact, se potrivesc exact acolo unde avei nevoie de
productivitate maxim.

de la complex
la simplu

pre avantajos

rezultate excelente

Xerox WorkCentre 3225 pe scurt:


9LWH]GHLPSULPDUHLFRSLHUHGHSQODSSP$
&RQHFWLYLWDWH:L)LLQWHJUDW
5H]ROXLHGHLPSULPDUHGHSQOD[GSL[OD
calitate mbuntit
3URFHVRUSXWHUQLFGH0+]
,PSULPDUHUDSLGDSULPHLSDJLQLQQXPDLVHFXQGH
5H]ROXLHGHVFDQDUHGHSQOD[GSLDOEQHJUXLFRORU

Multifuncional color
Xerox WorkCentre 6027
Calitate superioar a imaginilor
Calitatea mbuntit de 1200 x 2400 dpi, asigurat de sistemul de imprimare Hi-Q
LED, nseamn imprimare color de nalt rezoluie, cu aliniere exact a imaginilor i
detalii extraordinare.
Conectivitate simplificat
Reeaua wireless ncorporat permite amplasarea dispozitivului oriunde n birou, iar
accesarea asistentului de instalare Wi-Fi direct de pe interfa faciliteaz conectarea
rapid.
Soluii de imprimare mobil
Cu Apple AirPrint, Xerox PrintBack, si Google Cloud Print imprimarea se face
direct de pe dispozitivele mobile nu a fost niciodat mai simpl. Portul USB amplasat
frontal permite utilizatorilor s imprime de pe sau s scaneze ctre orice memorie
portabil USB standard.
Mai multe rezultate, timp de ateptare redus
Economisii timp prin copierea i scanarea mai multor pagini cu ajutorul dispozitivului
automat de alimentare cu capacitate de 15 coli. Interfaa intuitiv cu ecran tactil color
de mari dimensiuni (4,3 inchi) a echipamentului WorkCentre 6027 simplific i cele
mai complicate sarcini.
Eficientizai procesele
Funciile de copiere includ copierea cardurilor de identitate, ajustarea luminozitii,
micorarea/mrirea, tergerea automat a fondului, colaionarea i multe altele.
Scanarea convertete rapid informaia de pe hrtie n documente electronice care pot
fi salvate n reea sau trimise direct destinatarilor prin e-mail, la o rezoluie de pn
la 600 x 600 dpi, color sau n nuane de gri.
Cod
XC610301

cloud

comunicare

simplificare

WorkCentre 6027 pe scurt:


9LWH]DGHLPSULPDUHGHSQODSSPFRORULDOEQHJUX$
&RSLHUHOD[GSLLPSULPDUH[GSLODFDOLWDWH
mbuntit a imaginii
3URFHVRU0+]PHPRULH0%
6LVWHPXOGHLPSULPDUHDYDQVDW+L4/('L7RQHU;HUR[ EA-Eco
6LPXOULGHFXORDUHFDOLEUDWH3$1721(
&RQHFWLYLWDWHZLUHOHVVLQWHJUDW:L)L'LUHFW
6ROXLLGHLPSULPDUHPRELO$SSOH AirPrint, Xerox
PrintBack, Google Cloud Print

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

301

imprimante
Imprimant laser mono HP Laserjet Pro M201dw

TEHNIC DE BIROU

07

Specificaii:
7LSLPSULPDQWPRQR
)XQFLLLPSULPDUH
7HKQRORJLHGHLPSULPDUHODVHU
,PSULPDUHDXWRPDWIDYHUVR
&RQHFWLYLWDWHVWDQGDUG86%GHPDUHYLWH](WKHUQHW:L)LEJQ
'LPHQVLXQHPD[LPKUWLH$
0HPRULH0%
9LWH]GHLPSULPDUH$VWDQGDUGSQODGHSDJLQLSHPLQXW
5H]ROXLHSQOD[GSL
7LPSSHQWUXLHLUHDSULPHLSDJLQLLPSULPDWHVHFXQGH
(FUDQ/&'JUDILF[SL[HOL
9ROXPOXQDUUHFRPDQGDWQWUHGHSDJLQL
&HUWLILFULHFRORJLFH%OXH$QJHO(QHUJ\6WDU(3($7
6ROXLLGHLPSULPDUHPRELO+3H3ULQW$SSOH$LU3ULQWLPSULPDUH:LUHOHVV'LUHFW

Cretei productivitatea cu imprimarea duplex automat, fiabil i cu vitezele mari de


imprimare. Imprimai de la smartphone-uri, tablete sau laptopuri, cu opiunile de
imprimare mobil.
Caracteristici intuitive, pentru o finalizare rapid
Economisii timp i reducei costurile cu hrtia, utiliznd imprimarea fiabil
automat fa-verso. Accelerai lucrrile de imprimare utiliznd panoul de control
simplu. Lucrai mai rapid. Mrii productivitatea cu viteze mari de imprimare, de
pn la 25 de pagini pe minut.
ncepei s lucrai imediat dup scoaterea din cutie: avei inclus un cartu de toner
de capacitate maxim, de 1.500 pagini.
Doar imprimai protejat i conectat
Conectai-v, gestionai i meninei datele n siguran, cu funciile ncorporate.
Imprimai simplu, practic oriunde n birou, prin conexiuni Ethernet i wireless.
Conectai-v prin USB i accesai instrumente de la PC pentru a gestiona imprimanta
i consumabilele.
Bucurai-v de imprimarea mobil
Trimitei simplu lucrrile de imprimare, n mod wireless.
Imprimai rapid de pe iPhone, iPad i iPod touch, utiliznd Apple AirPrint
fr configurare, fr aplicaii.
Reducei impactul asupra mediului nconjurtor
Contribuii la economisirea energiei cu tehnologia HP Auto-On/Auto-Off.
Imprimai sigur pe o gam larg de tipuri de hrtie, inclusiv pe hrtii de birou,
pornind de la numai 60 g/mp. Contai pe reciclarea simpl i gratuit a cartuelor
prin programul HP Planet Partners. Conservai resursele cu o imprimant certificat
ENERGY STAR i compatibil Blue Angel.
Cod
HP711600

COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet,


contacteaz consultantul tu de vnzri.

Multifuncional laser mono HP Laserjet M225dw

Specificaii:
7LSLPSULPDQWPRQR
)XQFLLLPSULPDUHFRSLHUHVFDQDUHID[
7HKQRORJLHGHLPSULPDUHODVHU
,PSULPDUHDXWRPDWIDYHUVR
&RQHFWLYLWDWHVWDQGDUG86%GHPDUHYLWH]SRUWUHHDQFRUSRUDW)DVW(WKHUQHW
10/100Base-TX, port linie telefon (intrare/ieire), WiFi 802.11b/g/n
'LPHQVLXQHPD[LPKUWLH$
0HPRULH0%
9LWH]GHLPSULPDUH$VWDQGDUGSQODGHSDJLQLSHPLQXW
5H]ROXLHSQOD[GSL
7LPSSHQWUXLHLUHDSULPHLSDJLQLLPSULPDWHVHFXQGH
(FUDQWDFWLO/&'GHFP JUDILFFRORU
9ROXPOXQDUUHFRPDQGDWQWUHGHSDJLQL
&HUWLILFULHFRORJLFH%OXH$QJHO(QHUJ\6WDU(3($7
6ROXLLGHLPSULPDUHPRELO+3H3ULQW$SSOH$LU3ULQWFHUWLILFDW0RSULD
imprimare Wireless Direct, aplicaii mobile

302

Acest echipament multifuncional puternic v ajut s cretei productivitatea,


oferindu-v imprimare automat fa-verso, un ecran tactil intuitiv cu opiuni
scanare ctre, conectivitate wireless simpl, conectivitate de reea ncorporat i
opiuni de imprimare mobil.
Un multifuncional conceput pentru productivitate
Economisii timp i reducei costurile cu hrtia, utiliznd imprimarea fiabil
fa-verso automat. Scanai i trimitei fiiere digitale direct ctre o unitate USB, n
cloud, ctre e-mail sau foldere din reea. Lucrai mai inteligent accesai coninut
i lansai rapid lucrrile de la ecranul color tactil, de 7,6 cm. mbuntii eficiena
biroului cu alimentatorul automat de documente inclus i cu cartuul de toner
pentru 1.500 de pagini.
Conectai i protejai echipamentul
Conectai-v, gestionai i profitai din plin de caracteristicile integrate ale
echipamentului multifuncional. ncepei s imprimai, s scanai i s copiai
imediat, dup o configurare simpl. Partajai simplu acest multifuncional, utiliznd
opiunile de reea i wireless, pentru a imprima practic oriunde n birou.
V conectai prin USB, accesai instrumente de la PC i gestionai echipamentul i
consumabilele.
Bucurai-v de imprimarea mobil
Trimitei lucrri de imprimare rapid i eficient n mod wireless, fr reea.
Imprimai rapid de pe iPhone, iPad i iPod touch, utiliznd Apple AirPrint
fr configurare, fr aplicaii. Mergei la acest multifuncional i imprimai din
dispozitivul USB, utiliznd portul USB uor accesibil.
Reducei impactul asupra mediului nconjurtor
Contribuii la economisirea energiei, cu tehnologia HP Auto-On/Auto-Off.
Imprimai fiabil pe o gam larg de tipuri de hrtie, inclusiv pe hrtie de birou
uoar, de numai 60 g/m2. Contai pe reciclarea simpl i gratuit a cartuelor prin
programul HP Planet Partners.
Conservai resursele cu un echipament multifuncional certificat ENERGY STAR i
compatibil Blue Angel.
Cod
HP611600

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

imprimante

Garanie extins pn la 3 ani prin


nregistrarea pe website-ul productorului.

3 ani

GARANIE
prin nregistrarea pe
www.brother.ro

Tiprirea mono la rezoluie nalt asigur obinerea unor documente cu detalii clare, bine
definite. Noua gam de imprimante Brother v ajut s reducei consumul de hrtie cu ajutorul
funciei de duplex integrate.
Specificaiile echipamentelor asigur costuri reduse de utilizare. Tonerul de capacitate mare,
alturi de cilindrul separat pstreaz un nivel minim al costurilor de exploatare. Noile
imprimante Brother sunt compatibile cu o gam larg de soluii mobile i v permit astfel s
tiprii dintr-un numr mare de aplicaii i fiiere.
iPrint&Scan v permite s tiprii i s scanai de pe iPhone, iPad, iPod touch, Android,
Kindle Fire, dispozitive mobile cu Windows Phone 7 i Windows Phone 8 atunci cnd
suntei conectat n reeaua din care face parte imprimanta.
Tehnologie Google Cloud Print, prin care putei conecta imprimanta la Internet. Imprimanta
devine astfel disponibil pentru dumneavoastr i avei acces la ea din aplicaiile pe care le
folosii zilnic.
Google Cloud Print funcioneaz pe telefon tablet i orice alt dispozitiv conectat la Internet de
pe care dotii s tiprii.
AirPrint v permite s tiprii documente, pagini web i e-mailuri. Nu trebuie s instalai un
software, nu trebuie s descarcai drivere dedicate i nu avei nevoie de cabluri.
Viteza este o trstur deosebit pentru imprimantele Brother. Prima pagin este tiprit n
mai puin de 8,5 secunde, iar viteza pentru tiprirea standard este de pn la 30 de pagini pe
minut.

COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama


complet, contacteaz consultantul tu de vnzri.

Imprimant laser mono Brother HLL2360DN

Multifuncional laser mono Brother MFC-L2720DW

Manevrai sarcinile de imprimare cu uurin. HL-L2360DN este o imprimant


accesibil cu viteze mari de imprimare i conexiune de reea, care ofer printuri de
calitate de fiecare dat.

Proiectat s gestioneze sarcinile de imprimare cu uurin, multifuncionalul


profesional MFC-L2720DW este alegerea ideal pentru orice birou.

Specificaii:
7LSLPSULPDQWPRQR
)XQFLLLPSULPDUH
7HKQRORJLHODVHU
,PSULPDUHDXWRPDWIDYHUVR
&RQHFWLYLWDWHUHHDFDEODW%DVH7%DVH7;
'LPHQVLXQHPD[LPKUWLH$
0HPRULH0%
9LWH]GHLPSULPDUH$VWDQGDUGSQODSDJLQLSHPLQXW
5H]ROXLH[GSL+4 [GSL
7LPSSHQWUXLHLUHDSULPHLSDJLQLLPSULPDWHPDLSXLQGHVHFXQGH
'LPHQVLXQHDILDM/&'OLQLH[FDUDFWHUH
9ROXPOXQDUUHFRPDQGDWQWUHGHSDJLQL
&HUWLILFULHFRORJLFH%OXH$QJHO(QHUJ\6WDU1RUGLF6ZDQ
6ROXLLVXSRUWDWH$LU3ULQWEJXDUG&RUWDGR&ORXG3ULQW*RRJOH&ORXG3ULQW
iPrint&Scan
Cod
BR710400

07
TEHNIC DE BIROU

BROTHER REDEFINETE PERFORMANA

Specificaii:
7LSLPSULPDQWPRQR
)XQFLLLPSULPDUHFRSLHUHVFDQDUHID[
7HKQRORJLHODVHU
,PSULPDUHDXWRPDWIDYHUVR
&RQHFWLYLWDWHUHHDFDEODW%DVH7;:LUHOHVV,(((EJQ
,QWHUIDORFDO+L6SHHG86%
:L)L'LUHFW LPSULPDLZLUHOHVVIUDDYHDQHYRLHGHXQSXQFWGHDFFHVZLUHOHVV
'LPHQVLXQHPD[LPKUWLH$
0HPRULH0%
9LWH]GHLPSULPDUH$VWDQGDUGSQODSDJLQLSHPLQXW
5H]ROXLHLPSULPDUH[GSL+4 [GSL
7LPSSHQWUXLHLUHDSULPHLSDJLQLLPSULPDWHPDLSXLQGHVHFXQGH
'LPHQVLXQHDILDMHFUDQWDFWLOFRORUFP
9ROXPOXQDUUHFRPDQGDWQWUHGHSDJLQL
&HUWLILFULHFRORJLFH%OXH$QJHO(QHUJ\6WDU1RUGLF6ZDQ
6ROXLLVXSRUWDWH$LU3ULQWEJXDUG%R[%U'RFV&RUWDGR&ORXG3ULQW'URSER[
(YHUQRWH(YHUQRWH%XVLQHVV)DFHERRN)OLFNU*RRJOH&ORXG3ULQW*RRJOH'ULYH
iPrint&Scan, Managed Print Services, OneDrive, OneNote, Picasa
Cod
BR610500

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

303

imprimante
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet,


contacteaz consultantul tu de vnzri.

Multifuncional GELJET
SG 3100SNw / SG 3110SFNw*
Cu conectivitate wireless ca dotare standard, echipamentele compacte SG 3100SNw
i SG 3110SFNw sunt ideale pentru birouri mici i persoane care lucreaz de acas,
avnd nevoie de o un echipament multifuncional versatil. SG 3110SFNw ofer, de
asemenea, funcionalitate de fax G3 i memorie extins de 128MB.
UDQGDPHQWGHSQODSSPQIRUPDW$
FRORUODDFHOHDLFRVWXULFDDOEQHJUX
PHPRULHGH0E0E
GXSOH[FDVWDQGDUG

TEHNIC DE BIROU

07

Cod
RC610001

Multifuncional laser
SP 311SFN / SP 311SFNw
Datorit faptului c funciile de imprimare, copiere, scanare i fax reprezint dotare
standard, aceste echipamente multifuncionale compacte sunt soluia de prelucrare
a documentelor ideal pentru grupuri de lucru solicitante. Modelul SP 311SFN ofer
USB 2.0 i conectivitate la reea, n timp ce modelul SP 311SFNw dispune de WiFi
pentru flexibilitate total.
UDQGDPHQWGHSQODSSPQIRUPDW$
UH]ROXLHGHSQOD[GSL
FRSLHUH,'SULQWURRSHUDLHVLPSO
VFDQDUHFRORUQFWHYDVHFXQGH
Cod
RC610000

Multifuncional laser
SP C250SF / SP C252SF
Cu viteze de imprimare mari, imprimare fa-verso i conectivitate wireless, plus
beneficiile suplimentare oferite de copiere, scanare, fax i imprimare wireless,
modelele SP C252SF i SP C252SF reprezint multifuncionale color excepionale
pentru grupuri de lucru aglomerate i profesioniti care au nevoie de fiabilitate i
performane absolute.
UDQGDPHQWGHSQODSSPQIRUPDW$FRORULDOEQHJUX
UH]ROXLHGHSQOD[GSL
SULPDFRSLHUHHVWHUHDOL]DWQVHFXQGH
LPSULPDUHGXSOH[DXWRPDW
Cod
RC610101

304

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Imprimare laser pentru biroul


dumneavoastr de la domiciliu

Tehnologia inovatoare GELJET

Ricoh ofer o gam extins


de imprimante i produse
multifuncionale pentru a
ndeplini necesitile fiecrei
afaceri.

Soluii multifuncionale pentru


grupuri de lucru

Echipamente high-end
destinate afacerilor

Toate dispozitivele noastre integreaz cea mai avansat tehnologie de


prelucrare a documentelor pentru a mri productivitatea afacerilor. Gama
extins de dispozitive Ricoh include att soluii autonome, ct i soluii de
reea care imprim n alb-negru i color. De asemenea, putei alege dintre
tehnologiile de imprimare cu laser i inovatoarea soluie Ricoh GELJET.

Marca MFP numrul 1 n Europa

www.ricoh-international.com

305

tablete
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

Tablet iPAD MINI 3


Procesor: Dual-Core 1 GHz (A7)
Accelerator grafic: PowerVR G6430
Memorie intern: 16 GB, 1 GB RAM
Slot memorie extern: pn la 32 GB (micro SD)
Ecran: 7.9, iOS LCD
Rezoluie: 1536 x 2048 pixeli
Difuzor: Integrat
Baterie: Li-Po 4400 mAh
Conectivitate: Wi-Fi 802.11 b/g/n, Wi-Fi Direct
Sistem de operare: iOS 8

07
TEHNIC DE BIROU

Cod
TI000701

Tablet Samsung TAB A Wifi


Procesor: Intel Atom Quad Core (1.2 Ghz)
Accelerator grafic: Marvell PXA1088
Memorie intern: 16 GB, 1.5 GB RAM
Slot memorie extern: pn la 32 GB (micro SD)
Ecran: 9.7, ecran tactil capacitiv TFT, 16M culori
Rezoluie: 1024 x 768 pixeli
Difuzor: Stereo
Baterie: Li-Po 6000 mAh
Conectivitate: Wi-Fi 802.11 a/b/g/n, dual-band, Wi-Fi Direct, Wi-Fi hotspot,
Bluetooth
Sistem de operare: Android OS,
5.0 Lolipop
Cod
TI000401

Tablet LENOVO YOGA 2 4G


Procesor: Intel Atom z3745
Accelerator grafic: Integrat
Memorie intern: 16 GB, 2 GB RAM
Slot memorie extern: pn la 32 GB RAM
Ecran: 10.1, Ecran Full HD de 1920 x 1200, cu ecran tactil n 10 puncte i unghi larg
de vizualizare, de 178 de grade
Rezoluie: 1920 x 1200 pixeli
Difuzor: Integrat
Baterie: Li-Po 9600 mAh
Conectivitate: Bluetooth 4.0 integrat, conectivitate WiFi 802.11 a/b/g/n i 4G GPS3
Sistem de operare: Microsoft Windows 8.1, cu BING

4g

Cod
TI000501

Tablet Asus Fone Pad Note


Procesor: Dual-Core 2.0 GHz
Accelerator grafic: SGX 544
Memorie intern: 16 GB, 2 GB RAM
Slot memorie extern: pn la 32 GB (micro SD)
Ecran: 6 inch, IPS cu ecran tactil capacitiv
Rezoluie: WXGA 1920 x 1080 (FHD)
Difuzor: Integrat
Baterie: 3200 mAh Lithium
Conectivitate: Wi-Fi 802.11 a/b/g/n, 3G dual-band, Wi-Fi Direct, Wi-Fi hotspot,
Sistem de operare: Android OS, 4.2 JellyBean

4g

Cod
TI000601

306

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

smartphone
COMAND
SPECIAL

Produse disponibile la comand special. Pentru gama complet, contacteaz


consultantul tu de vnzri.

Smartphone iPHONE 6

Cod
TM000701

07
TEHNIC DE BIROU

Reea: 2G, 3G, LTE (4G)


Ecran: 4.7, ecran tactil capacitiv IPS LCD, 16M culori
Rezoluie: 750 x 1334 pixeli
Procesor: Dual-Core 1.4 (A8)
Memorie: 16 GB, 1 GB RAM
Camer: 8 MP, 3264 x 2448 pixeli, autofocus
Baterie: Li-Ion 1880 mAh
Sistem operare: BlackBerry 10.2 OS
Dimensiuni: 138 x 67 x 6.9 mm
Greutate: 129 g

Smartphone Samsung Galaxy S6 EDGE


Reea: 2G, 3G, 4G
Ecran: 5.1, ecran tactil capacitiv Super AMOLED, 16M culori
Rezoluie: 1440 x 2560 pixeli
Procesor: Octa-Core 2.5 GHz
Memorie: 32 GB, 3 GB RAM
Camer: 16 MP, 5312 x 2988 pixeli
Baterie: Li-Ion 2600 mAh
Sistem operare: Android OS, v 5.0.1 (Lolipop)
Dimensiuni: 142 x 70 x 7 mm
Greutate: 132 g
Cod
TM000401

Smartphone Microsoft Lumia 640 XL


Reea: 2G, 3G, LTE (4G)
Ecran: 5.7, ecran tactil capacitiv IPS LCD, 16M culori
Rezoluie: 1080 x 1920 pixeli
Procesor: Quad-Core, 2.2 GH (A7)
Memorie: 8 GB, 1 GB RAM
Camer: 13 MP, 4128 x 3096 pixeli
Baterie: Li-Ion 3000 mAh
Sistem operare: Windows Mobile 8.1
Dimensiuni: 157 x 81 x 9 mm
Greutate: 171 g
Cod
TM000501

Smartphone LG G3
Reea: 2G, 3G, 4G
Ecran: 5.5, ecran tactil capacitiv True HD-IPS + LCD, 16 M culori
Rezoluie: 1440 x 2560 pixeli
Procesor: Octa-Core 1.44+1.8 GHz
Memorie: 32 GB, 3 GB RAM
Camer: 6 MP, 5312 x 988 pixeli
Baterie: Li-Ion 3000 mAh
Sistem operare: Android OS, v 4.4.2 ( KitKat cu update Lollipop)
Dimensiuni: 148 x 76 x 6.3 mm
Greutate: 155 g
Cod
TM000601

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

307

maini de numrat bani


3

GARANIE

Verific i autenticitatea crilor de credit


i a documentelor de identitate

Afieaz valoarea
i suma total

TEHNIC DE BIROU

07

Verificator bancnote Safescan 155S


Detecie de top a bancnotelor false
Safescan 155S folosete tehnologii de ultim generaie pentru a detecta apte
elemente avansate de securitate integrate n bancnotele de astzi: cerneal
UV, cerneal magnetic, band magnetic, lungime, grosime, watermark i
culoare. Tehnologia permite chiar i detectarea jumtilor de bancnot sau a
bancnotelor dublate. n doar jumtate de secund, vei ti cu siguran dac
bancnota pe care o testai este sau nu autentic.
Un produs pe care v putei baza
Safescan 155S este supus constant la teste riguroase n marile bnci, folosind
cele mai recente calupuri de bancnote autentice i contrafcute, livrnd de
fiecare dat rezultate precise.
ntodeauna actualizat
Marile bnci i actualizeaz permanent bancnotele pentru a ncorpora cele
mai recente elemente de securitate i pentru a-i descuraja pe cei care plaseaz
bancnote contrafcute. Echipa Safescan v trimite notificri atunci cand sunt
disponibile actualizri, iar procesul de update este foarte uor, folosind portul
USB sau slot-ul microSD de pe aparat.
Uor i rapid de folosit
Safescan 155S este echipat cu un panou de control intuitiv i cu un ecran clar,
de dimensiuni mari. Accesul la funcii se face prin trei butoane etichetate
corespunztor. Ecranul LCD v ofer informaiile de care avei nevoie: tipul i
numele bancnotei, numrul bancnotelor validate i valoarea total (atunci
cnd selectai funcia add). Mai mult, bancnota este verificat n mai puin
de o secund.

Verificator bancnote Safescan 45


Identificai elementele de securitate bancnotelor
Bancnotele prezint elemente de securitate UV integrate care sunt vizibile
doar n lumina cu ultraviolete la o frecven specific. Safescan 45 v
ajut s verificai aceste elemente i s identificai posibilele bancnote
contrafcute.
Verificai cu uurin crile de identitate
Safescan 45 ilumineaz instant elementele de securitate UV integrate n
crile de credit, n paapoarte i n alte documente de identitate, precum
i cerneala UV aplicat pentru a proteja bunurile de valoare mpotriva
jafurilor sau pentru a confirma accesul la anumite evenimente.
Putere UV dubl
Lampa UV puternic proiecteaz lumina pe bancnot sau pe cartea de
identitate, elementele UV devenind astfel mai uor de identificat n
comparaie cu condiiile normale de iluminare.

Cod
SF700007

Cod
SF700000

Beneficiai de garanie extins prin nscrierea pe website-ul productorului. Pentru detalii, v rugm s contactai reprezentantul de vnzri alocat.

Main de numrat bancnote Safescan


Numrai rapid i corect bancnotele
Economisii timp i eliminai erorile. Safescan 2210 are o capacitate de ncrcare de
pn la 300 de bancnote i numr pn la 1000 de uniti pe minut, iar Safescan
2610 pna la 1500 uniti pe minut.
Sistem de detecie n dou puncte
Bancnotele de astzi prezint elemente de securitate sofisticate care le ngreuneaz
munca celor care vor s plaseze variante contrafcute. Safescan 2210 verific automat
dou elemente: nsemnele UV i dimensiunea. Atunci cnd gsete o bancnot
suspect, aparatul se oprete i emite un semnal sonor. Tot ce trebuie s facei mai
departe este s nlturai bancnota suspect i s apasai butonul de pornire pentru
reluarea procesului de numrare.

SF700002

Economisii timp cu ajutorul funciei de adugare automat i a gruprii n serii


Prin apsarea butonului add, aparatul nregistreaz toate bancnotele introduse n
serii individuale.
Apsai butonul batch i selectai numrul de bancnote dorite, iar aparatul se va
opri de fiecare dat cnd atinge acest numr. Mai repede de att nu se poate.
Ecran de dimensiuni mari, uor de folosit
Aparatul este echipat cu un panou de control intuitiv i cu un ecran clar, de
dimensiuni mari. Cu ajutorul celor ase butoate etichetate corespunztor, avei acces
la funciile aparatului. Ecranul LCD luminat v ofer informaiile de care avei nevoie:
numrul de bancnote i setrile specifice pe care le-ai selectat.

308

Cod

SF000005

SF700002

Model

2210

2610

Viteza de numrare

1000 / min

1500 / min

SF000005

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Funcie de grupare
pentru a crea
teancuri egale de
bancnote

boxe i telefoane
Mini-difuzor portabil Leitz Complete cu Bluetooth
Ascult muzica preferat oriunde i oricnd prin tehnologia fr fir cu Bluetooth, prin
conectare la dispozitiv cu cablul cu mufa jack clasic sau direct din mp3 player-ul
integrat. Ideal pentru conferine telefonice, datorit microfonului ncorporat. Design
compact, ce permite transportul n geant. Rencrcabil prin portul USB.
culoare: negru
dimensiuni: 60 x 54 x 60 mm
putere: 5 W
alimentare cu energie: 5 V / 400mAh (USB)
cabluri incluse: 1 cablu cu micro USB cu muf standard pentru cti
utilizare pentru: PC, smartphone-uri i tablete PC
greutate: 0.23 Kg

conexiune bluetooth

07
TEHNIC DE BIROU

Cod
SL999937

conexiune prin muf jack

conexiune prin Bluetooth

Telefon DECT TG-2511


Tip: DECT.
LCD: 16 caractere i 3 linii.
Agend: 50 numere cu nume.
Receptoare multiple: da.
Caller ID: da.
Numr tonuri (preinstalate): 10.
Volum sonerie: 6 trepte + nchis.
Trepte volum sonerie: 6 pai + oprit.
Ceas: da.
Apel tip conferin: da.
Baterii rencrcabile Ni-Mh (AAA x 2).
Timp ncrcare: 7 ore.
Timp ateptare: pn la 170 ore n standby.
Timp vorbire: pn la 18 ore de convorbire.
Montare pe perete: da.
'LPHQVLXQL '[+[:PP ED][[UHFHSWRU[[
Cod
PN010200

Telefon KX-TS500
Design compact.
Reformarea ultimului numr de telefon (redial) printr-o singur apsare.
Buton Recall ce permite utilizarea facilitilor speciale ale centralelor
telefonice.
Reglaj volum sonerie n 3 pai.
Reglaj volum receptor n 6 pai.
Comutare n modul tone printr-o singur apsare.
Posibilitate de montare pe perete.
Cod
TL1218

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

309

kituri i tastaturi

TEHNIC DE BIROU

07

Kit wireless KB-8000X


Tip tastatur: fr fir
Numr taste: 103, dintre care 12 programabile
Conectivitate: USB
Tip mouse: fr fir, optic
Interfa mouse: USB
Rezoluie mouse: 1200 dpi
Alimentare: dou baterii AAA
Alte caracteristici: form ergonomic, tehnologie anti-interferene wireless 2.4Ghz

TIAI C?
Tastatura este cel mai vechi
dispozitiv de intrare din structura
computerelor moderne, ea
aprnd naintea mouse-ului i
a monitorului.

pentru gama de
baterii consultai
paginile 74-75

Cod
GN020204

comenzi rapide pentru control media i utilizare a Internetului

Tastatur multimedia KB-M200


Tastatur KB-110X
Tip: cu fir.
Conectivitate: USB
Numr taste: 104
Alte caracteristici: taste gravate cu laser, rezistent la ap, design confortabil.

Cod
GN020205

Cod
GN020206

Tastatur multimedia K-2015

Tastatur K-1016

Tip: cu fir.
Conectivitate: USB.
Numr de taste: 104 + 20 taste multimedia
Alte caracteristici: full size, rezistent.

Tip: cu fir.
Conectivitate: USB.
Numr de taste: 107
Alte caracteristici: fabricat dintr-un material rezistent, cablu 1.4 m.

Cod
AJ510001

310

Tip: cu fir
Conectivitate: USB
Numr taste: 103 + 8 taste programabile
Alte caracteristici: taste silenioase, gravate cu laser, rezistent la ap, nlime
ajustabil.

Cod
AJ510000

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

mouse

Mouse DX-6810

Cod
GN010214

Mouse DX-150
Tip: cu fir, optic.
Interfa: USB
Rezoluie: 1200 dpi
Alte caracteristici: design elegant i compact, plug and play, nu necesit instalarea
unui software.
Cod
GN010105

Mouse AMY-010

Mouse AMY-012

Tip: fr fir, optic. Interfa: USB. Rezoluie: 1000 dpi.


Alimentare: o baterie AA.

Tip: cu fir, optic. Interfa: USB. Rezoluie: 1000 dpi.


Alte caracteristici: rezistent la pn la 5 milioane de click-uri.

07
TEHNIC DE BIROU

Tip: fr fir, optic


Interfa: USB
Rezoluie: 1200 dpi
Alimentare: o baterie AA sau AAA
Alte caracteristici: tehnologie anti-interferene wireless 2.4 Ghz, dispozitivul de
prindere Stick-N-Go pstreaz mouse-ul n siguran n timp ce v micai prin
birou, butoane laterale pentru navigarea pe Internet (next, back), indicator luminos
pentru starea bateriei.

Cod
AJ510002

Cod
AJ510003

Mouse Traveler 6000Z pentru notebook


Tip: fr fir, optic
Interfa: USB
Rezoluie: 1000 dpi
Alimentare: o baterie AAA
Alte caracteristic: ideal pentru notebook-uri, tehnologie anti-interferene wireless
2.4 Ghz

Mouse Micro Traveler pentru notebook


Tip: cu fir, optic
Interfa: USB
Rezoluie: 1200 dpi
Alte caracteristici: ideal pentru notebook-uri, cablu retractabil cu lungime de 74 mm.
Cod
GN010104

Cod
GN010213

Mouse pad
Mouse pad

Mouse pad colorat. Ultra subire,


cu suprafa antiderapant.

Diverse culori.

Cod
TN060002

Cod
CM5013

Oricare ar fi meseria ta, avem produsul potrivit.

311

accesorii pc i laptopuri

PREVINE TENSIUNEA SPATELUI


ederea fr un sprijin adecvat
poate duce la o circulaie proast,

07

MEDIU DE LUCRU

PROBLEMA

SOLUIA

dureri de spate i oboseal

Fellowes. Getting the nation working well


ACAS

N MICARE

TEHNIC DE BIROU

LA BIROU

SUPORT LOMBAR
AJUSTABIL PE
NLIME

Suport pentru picioare


Ultimate Professional

Suport standard pentru picioare


QOLPHUHJODELOQGRXSR]LLLPPVDXPP
VXSUDIDQFOLQDWLPDVDMDQWLVWUHVV
GLPHQVLXQLSURGXV +[/[OPP [[
Cod
FWS0002

Suport pentru spate cu plas

ULGLFDLSLFLRDUHOHSHQWUXDGLPLQXDSUHVLXQHDSH
spate
Slatform robust i design special, ce ofer o poziie
corect piciorului
nlime reglabil n 3 nivele: 100, 135, 165 mm
masaj suprafa
baz non-alunecare
Gimensiuni produs (H x L x l mm): 100 x 388 x 338
Cod
FW002001

Vuport lombar cu plas ce se adapteaz spatelui,


oferind suport maxim
Vistemul de fixare Tri-TensioningTM elimin
necesitatea de ajustri constante
Ve adapteaz cu uurin pe formatul oricrui scaun
dimensiuni produs (H x L x l mm): 536 x 460 x 160
Cod
FWS005

Culoare

Tip

negru

standard

FW002003

albastru

profesional

ELIMIN TENSIUNEA ARTICULAIILOR


Lucrul la tastatur sau laptop pentru o
perioad lung de timp poate provoca

MEDIU DE LUCRU

PROBLEMA

SOLUIA

dureri i presiune la nchietura minilor

Fellowes. Getting the nation working well


LA BIROU

ACAS

N MICARE

Mouse pad ergonomic Crystal


Fonfortabile i elegante, dau culoare mediului de lucru
suport confortabil, ce elibereaz presiunea la nivelul articulaiilor
fabricate din gel non-toxic, uor de curat cu o lavet umed
baz adaptabil oricrui tip de suprafa
Gimensiuni mouse pad (H x L x l mm): 32 x 202 x 230
Gimensiuni suport articulaie (H x L x l mm): 18 x 122 x 88

312

Cod
FWS0021

Produs
mouse pad

negru

FW002008

mouse pad

albastru

FWS0022

suport articulaie

negru

FWS0014

suport articulaie

albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

Culoare

accesorii pc i laptopuri

AMELIORAI DURERILE DE GT
nclinarea capului i micarea
MEDIU DE LUCRU

PROBLEMA

SOLUIA

07

calculatorului, v poate provoca


ncordri ale gtului i spatelui

Fellowes. Getting the nation working well


LA BIROU

ACAS

N MICARE

VENTILATOR
ULTRA
SILENIOS

Suport standard pentru monitor

Suport Office SuitesTM pentru laptop

UHJOHD]PRQLWRUXOODRQOLPHDGHFYDWSUHYHQLQG
ncordarea gtului
SRWULYLWSHQWUXPRQLWRDUHPDULSRDWHVXVLQHSQ
la 36 de kg
UHJODELOSHQOLPHSHGRXWUHSWHLFP
ED]SUHY]XWFXVSDLXSHQWUXGHSR]LWDUHD
laptopului
LQFOXGHVSDLXSHQWUXGHSR]LWDUH
GLPHQVLXQLSURGXV +[/[OPP [[

ULGLFHFUDQXOODSWRSXOXLODXQXQJKLRSWLPGH
vizionare
DMXVWDELOQSR]LLLQWUHFP
XQJKLGHDMXVWDUHr
GLVSR]LWLYXOGHEORFDUHPHQLQHODSWRSXOQSR]LLD
dorit
VHSRDWHXWLOL]DSHQWUXODSWRSXULGHSQODL
greutate maxim de 5 kg
GLPHQVLXQLSURGXV +[/[OPP [[
Cod
FWS0006

Cod
FWS0007

TEHNIC DE BIROU

gtului, pentru a vedea monitorul

Suport Maxi Cool pentru laptop


HFKLSDWFXXQYHQWLODWRUPDUHXOWUDVLOHQLRVSHQWUX
meninerea temperaturii de lucru
VHSRDWHXWLOL]DSHQWUXODSWRSXULGHSQOD
QFOLQDUHPPSHQWUXRSHUDUHFRQIRUWDELO
ED]QRQDOXQHFDUHFHPSLHGLFGHSODVDUHD
laptopului
GLPHQVLXQLSURGXV +[/[OPP [[
Cod
FW002007

MAXIMIZAREA SPAIULUI
Un spaiu de lucru
dezordonat afecteaz negativ

MEDIU DE LUCRU

PROBLEMA

SOLUIA

productivitatea i v poate
duna sntii

Fellowes. Getting the nation working well


LA BIROU

ACAS

N MICARE

Stand Office Suites


VHSRDWHIRORVLSHQWUX3&VDXGLVWUXJWRUGHKUWLH
UHJODELOSHQOLPHQWUHLFP
VXVLQHHFKLSDPHQWHFXRJUHXWDWHPD[LPGHNJ
URLSUHY]XWHFXVLVWHPGHEORFDUH
GLPHQVLXQLSURGXV +[/[OPP [[
Cod
FWS0100

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

313

medii de stocare
Verbatim

TEHNIC DE BIROU

07

Cod

Tip

Vitez

Capacitate

Unitate de vnzare

VB010104

CD-R

52x

700 MB

spindle 10 buci

VB0096

CD-R

52x

700 MB

spindle 25 buci

VB010102

CD-R

52x

700 MB

shrink 50 buci

VB00861

CD-R

52x

700 MB

set 10 buci slim case

VB00913

CD printabil

52x

700 MB

spindle 25 buci

VB010201

CD-RW

12x

700 MB

spindle 10 buci

VB10401

DVD-R

16x

4.7 GB

spindle 10 buci

CE435C

DVD+R

16x

4.7 GB

spindle 25 buci

VB020105

DVD-R

16x

4.7 GB

shrink 50 buci

VB020109

DVD-R

16x

4.7 GB

set 10 buci slim case

VB1013

DVD-R printabil

16x

4.7 GB

spindle 25 buci

VB020203

DVD+R double layer

8x

8.5 GB

spindle 10 buci

VB1022

DVD-RW

4x

4.7 GB

spindle 10 buci

VB030100

BD-R single layer

6x

25 GB

bucat jewel case

Omega

pentru file de
protecie consultai
pagina 110

Cod
Tip
OM010100 CD-R

Vitez

Capacitate

52x

700 MB

cake 10 buci

OM010104 CD-R

52x

700 MB

shrink 50 buci

OM010101 CD-R

52x

700 MB

set 10 buci slim case

OM020100 DVD-R

16x

4.7 GB

cake 10 buci

OM020103 DVD-R

16x

4.7 GB

shrink 50 buci

OM020101 DVD-R

16x

4.7 GB

set 10 buci slim case

TIAI C?
Poi prelungi viaa CD-urilor i
DVD-urilor, dac le fereti de lumina
direct a soarelui sau de ap.

Carcase CD
Carcas cu clap, realizat din plastic transparent.
Cod
CCS003

314

Unitate de vnzare

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

medii de stocare

SFATUL SPECIALISTULUI
SCOATEREA CORECT A MEMORIEI FLASH DIN COMPUTER
Este recomandat ca nainte de a deconecta memoria flash de la computer s
fie eliminat n condiii de siguran, prin opiunea Safely remove hardware.
Acest lucru dureaz doar cteva secunde i previne pierderea de date i extinde
durata de via a dispozitivului de stocare.

07
TEHNIC DE BIROU

Memorie flash Micro Plus


Unitatea USB PinStripe de la Verbatim are un capac glisant care protejeaz conectorul
USB ct timp unitatea nu este folosit, nemaifiind astfel necesar un capac detaabil,
care se poate pierde uor.
Avnd greutate redus i un design discret, disponibil ntr-o varietate de culori i
avnd o capacitate de pn la 64 GB, unitatea USB PinStripe este soluia de stocare
perfect pentru oricine.
Cod
ST300435

Descriere

Culoare

USB 2.0, 8 GB

negru

ST300436

USB 2.0, 16 GB

negru

ST300400

USB 2.0, 32 GB

negru

ST300402

USB 2.0, 64 GB

negru

Memorie flash V3 retractabil


Cod
ST300403

Descriere

Culoare

USB 3.0, 8 GB

negru

ST300407

USB 3.0, 16 GB

negru

ST300411

USB 3.0, 32 GB

negru

ST300425

USB 3.0, 64 GB

negru

Hard disk extern


V putei stoca i transporta fiierele digitale i cele pe care lucrai n fiecare zi pe
acest dispozitiv cu adevrat mobil. Prin designul su fin i elegant, el se asorteaz
bine cu un calculator desktop modern, fiind totodat i partenerul perfect pentru
laptopul dumneavoastr. Dispozitiv plug and play (fr a fi necesar o alt surs de
alimentare).
Cod
VB030501

Descriere

Culoare

500 GB

negru

VB050102

1 TB

negru

VB050201

2 TB

negru

Hard disk extern rezistent la ocuri


Hard disk extern portabil, conectivitate USB 3.0. Carcas dur, pentru o rezisten
sporit la loviturile suferite n timpul cltoriilor. Dispozitiv plug and play.
Posibilitate de setare a unei parole pentru protecia datelor. Capacitate: 1 TB.
Cod
FR050101

rezistent la ocuri

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

315

produse curare IT
Set curare Pro
ecran LCD/Plasm
Set curare pentru ecran laptop, palm, PDA, plasm, GPS i ecrane touch-screen.
Cur praful, amprentele i depune un strat protector, reducnd ncrcarea
electrostatic i protejnd ecranul. Antistatic, fr alcool, non-toxic i
hipo-alergenic. Conine: spray 25 ml cu lichid Screen Protector i 1 lavet
micro-fibr.
Cod
DB579819

TEHNIC DE BIROU

07

Set curare ecrane LCD


Set curare ecrane LCD
Set pentru curare ecrane LCD, TFT i plasm.
Conine spray 200 ml cu gel de curare i o lavet din microfibr (20 x 20 cm) plasat
n capac.
Cod
AY160012

Set pentru curare i protecie ecrane LCD.


Conine spray 25 ml cu lichid Screen Protector i lavet.
Cod
AY160002

Set curare PC
Kit curare general
Set pentru curare computer i echipamente de birou.
Conine: spray cu spum pentru diverse suprafee (150 ml), spray lichid pentru
curarea ecranelor (125 ml), 10 lavete absorbante, o lamel pentru curare
tastatur.

Cod
AY160006

Cod
DB583400

316

Conine: spray spum anti-static 150 ml, spray anti-static curare ecran 125 ml,
4 perechi de erveele umede/uscate, 20 de erveele uscate absorbante, o lamel
pentru curarea tastaturii.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

produse curare IT

Set Screenclean pentru


curare ecran monitor
Set pentru curat monitoare, filtre, suprafee din sticl. Antistatic ibiodegradabil.
Coninut: 1 flacon fluid SCREENCLEAN 125 ml, 20 lavete speciale (fr scame).
Cod
DB570700

erveele Screenclean Duo


curare ecran monitor
10 perechi erveele umede/uscate, ambalate individual: umed + uscat, pentru
curat ecrane monitor, filtre, laptop, PDA, suprafee de sticl, scannere,
fotocopiatoare. Antistatic.
Cod
DB572102

TEHNIC DE BIROU

07

erveele pentru
curare ecran
20 perechi erveele umede/uscate, ambalate individual. O modalitate
practic pentru a pstra ecranul laptopului curat, chiar i n timpul
cltoriilor. De asemenea, se pot folosi pentru monitoare LCD, TV sau
lentile camere foto.
Cod
AL11325

erveele pentru curare ecran


erveele umede/uscate, ambalate individual, pentru curarea ecranelor i a
lentilelor. Ambalare: 20 de perechi erveele umede/uscate.
Cod
AY160004

Spray pentru curare ecran


Soluia perfect pentru a scpa de cele mai dificile urme de murdrie,
garantnd corecta funcionare a ecranului sau a lentilelor.
Cantitate: 250 ml.

Spray pentru curare ecran


Spray anti-static pentru curare ecrane. Cantitate: 250 ml.

Cod
AL11324

Cod
AY160003

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

317

produse curare IT

erveele pentru
curare general
Dispenser cu 100 erveele umede pentru curat suprafee din plastic.
Conine BACT-O-CLEAN.
Cod
DB5708021

07
TEHNIC DE BIROU

BACT-O-CLEAN este un aditiv antibacterian


99.9% eficient mpotriva microbilor i virusurilor,
inclusiv gripa comun, gripa aviar H5N1, E-coli,
Salmonela, MRSA i Listeria.

erveele pentru
curare general
Rezerv 100 de erveele
Impregnate cu soluie de curare. Pachet refill cu 100 erveele pentru
dispenserul SUPERCLEAN (DB5708021). Conine BACT-O-CLEAN.
Cod
DB570902

Cod
AL11301

erveele pentru curare general


100 de erveele pentru curare general, ambalate ntr-un dispenser din plastic.
Rezerve: 100 buci.

318

100 de erveele de curare. Cel mai rapid i eficient produs pentru


curarea perifericelor. erveelele sunt ambalate ntr-un suport din
plastic.

Cod
AY160001

Produs

AY160005

rezerve

erveele

Lavet din microfibr


Lavet din microfibr, ideal pentru utilizarea mpreun cu soluiile de curare
(spray, lichid, gel).
Dimensiuni: 25 x 25 cm.
Cod
AY160011

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

produse curare IT

Spray Powerclean pentru


curare cu jet de aer
Spray cu aer pentru curarea zonelor inaccesibile din echipamentele de birou,
electronice, camere foto i video. Recipient sub presiune, neinflamabil.
Cod
DB571519

Cantitate

DB573819

400 ml

150 ml

Spray pentru curare


cu jet de aer
Ideal pentru eliminarea murdriei i prafului din tastatur sau de pe
capetele de printare ale imprimantelor. Cantitate: 400 ml.
Cod
AL11307

TEHNIC DE BIROU

07

Spray pentru curare cu spum


Spray pentru curare cu jet de aer
Ideal pentru eliminarea murdriei i prafului din tastatur. Cantitate: 400 ml.

Cod
AY160000

Cod
AY160007

Spray pentru
curare cu spum
Spray cu spum pentru curat suprafee din plastic: carcas computer,
tastatur, mouse, periferice, imprimante i multifuncionale.
Cantitate: 400 ml.
Cod
AL11300

Spray cu spum anti-static pentru curat suprafee din plastic: computer, periferice,
tastatur, mouse. Cantitate: 400 ml.

Lavete uscate
erveele fr scame, foarte absorbante, pentru curat suprafee din plastic i
ecrane monitor. Ideale pentru utilizare mpreun cu toate lichidele de curare
Durable. Dimensiuni: 145 x 197 mm. Unitate de vnzare: 50 buci/set.
Cod
DB573402

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

319

calculatoare de birou

GARANIE

GARANIE

07
TEHNIC DE BIROU

memorie independent dubl

Calculator AS-888

Calculator WST-1610T

Digii: 16, memorie: GT, surs alimentare baterie+solar, taste plastic, ecran nclinat.
Dimensiuni: 140 x 220 x 30 mm. Greutate: 240 g.

Digii: 16, memorie: 1 + GT, surs alimentare baterie+solar, taste plastic, ecran
nclinat. Dimensiuni: 198 x 150 x 38 mm. Greutate: 238 g.

Cod
CN000101

Cod
CN3160000T

taste cu apsare simultan

afiaj nclinat mare

GARANIE

GARANIE

Calculator WS-1210T

Calculator AS-120

Digii: 12, memorie: 1 + GT, surs alimentare baterie+solar, taste plastic, ecran
nclinat. Faciliti: calcul taxe. Dimensiuni: 198 x 150 x 38 mm. Greutate: 238 g.

Digii: 12, memorie: GT, surs alimentare baterie+solar, taste plastic, ecran nclinat.
Dimensiuni: 145 x 100 x 33.5 mm. Greutate: 108 g.
Cod
CN000100

Cod
CN3120010T

TIAI C?

n anul 1972 HP a lansat primul


calculator de buzunar, care costa
395$. Dup 3 ani de la apariia
lui pe pia, vnzrile pentru
calculatorul HP-35 au depit
300.000 de uniti. Forbes ASAP
a inclus calculatorul HP-35 n
topul 20 al produselor din toate
timpurile care au schimbat
lumea.

tastatur cu trei zecimale

Calculator SDC-660N
Digii: 16, memorie: 3, surs alimentare baterie+solar, taste plastic, ecran
nclinat. Dimensiuni: 159 x 156 x 32 mm. Greutate: 165 g.
Cod
CZ0102

320

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

calculatoare de birou

GARANIE

GARANIE

Calculator SDC-554S

Calculator SDC-444S

Digii: 14, memorie: 3, surs alimentare baterie+solar, taste plastic, ecran nclinat.
Dimensiuni: 199 x 153 x 30.5 mm. Greutate: 209 g.

Digii: 12, memorie: 3, surs alimentare baterie+solar, taste plastic, ecran nclinat.
Dimensiuni: 199 x 153 x 30.5 mm. Greutate: 209 g.

Cod
CZ0106

Cod
CZ014445

TEHNIC DE BIROU

07

GARANIE

convertor valutar

Calculator CPC-112V
Digii: 12, surs alimentare baterie+solar, taste plastic, ecran nclinat, diverse culori.
Dimensiuni: 120 x 72 x 9 mm. Greutate: 52 g.
Cod
CZ010112

Calculator de birou M12D

Calculator de birou M12

Digii: 12, memorie: 1, surs alimentare baterie+solar, taste plastic, ecran


nclinat. Faciliti: calcul taxe. Dimensiuni: 100 x 140 x 30 mm. Greutate: 140 g.

Digii: 12, memorie: 1, surs alimentare baterie, taste plastic, ecran


nclinat. Faciliti: calcul taxe. Dimensiuni: 80 x 110 x 25 mm. Greutate: 100 g.

Cod
BV061112

Cod
BV061111

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

321

ghilotine
Ghilotin Stellar
ghid reglabil pentru taiere precis

GARANIE

TEHNIC DE BIROU

07

Ghilotin manual profesional prevzut cu pat de tiere din aluminiu, suport


integrat anti-alunecare.
aprtoare SafeCut pentru protecie - ghilotina poate fi utilizat numai n cazul
n care aprtoarea este ridicat
lam din oel inoxidabil - ideal pentru solicitri intense
clem pentru fixarea hrtiei n timpul tierii
ED]GLQPHWDOpentru o durabilitate sporit
Cod

FW000902

FW000903

Model

Stelar A4

Stelar A3

Lungime maxim de tiere

380 mm

455 mm

Capacitate de tiere

20 coli

20 coli

Formate acceptate

A6-A4

A6-A3

Dimensiuni

275 x 600 mm

275 x 730 mm

A4

20
COLI

FW000902

A3

20
COLI

FW000903

aprtoare de protecie

Ghilotina Fusion
Ghilotin manual profesional prevzut cu pat de tiere din aluminiu, suport
integrat anti-alunecare.
aprtoare SafeCut pentru protecie - ghilotina poate fi utilizat numai n cazul
n care aprtoarea este ridicat
lam din oel inoxidabil - ideal pentru solicitri intense
ED]GLQPHWDOpentru o durabilitate sporit

Cod

FW000900

FW000901

Model

Fusion A4

Fusion A3

Lungime maxim de tiere

320 mm

455 mm

Capacitate de tiere

10 coli

10 coli

Formate acceptate

A6-A4

A6-A3

Dimensiuni

216 x 482 mm

216 x 588 mm

GARANIE

A4

10
COLI

FW000900
aprtoare transparent pentru protecie
A3

10
COLI

FW000901

Ghilotin 502
Dimensiunile reduse permit folosirea acestei ghilotine n orice birou. Este marcat n
cm i prezint scal de msur foto standard. Lungime maxim de tiere: 320 mm.
Formate acceptate: A6 - A4. Operaia de presare a hrtiei: manual.
Greutate: 1.2 kg. Dimensiuni L x l (mm): 420 x 175.
Cod
DH00502

A4

322

8
COLI

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

trimmere
Trimmer Electron
Trimmer profesional, confer siguran maxim datorit cartuelor interschimbabile
ce expun lama numai n timpul tierii.
ghid transparent i reglabil ce asigur alinierea documentelor i tiere precis
clem pentru fixarea hrtiei n timpul tierii
ED]GLQPHWDOFXJKLGJUDGDWpentru o durabilitate sporit
LQGLFDWRUFXOHGSHQWUXHYLGHQLHUHDOLQLHLGHWLHUH
WLSXULGHWLHUHGUHDSWSHUIRUDUHRQGXODWLELJXLW
FW001000

FW001001

Model

Electron A4

Electron A3

Lungime maxim de tiere

380 mm

455 mm

Capacitate de tiere

10 coli

10 coli

Formate acceptate

A6-A4

A6-A3

Dimensiuni

487 x 224 mm

662 x 214 mm

A4

GARANIE

4 tipuri de tiere

07
TEHNIC DE BIROU

Cod

indicator laser

10
COLI

FW001000

A3

10
COLI

FW001001
compartimente pentru lame de schimb

lame interschimbabile

ghid reglabil

Trimmer Neutron
Trimmer profesional, confer siguran maxim datorit cartuelor interschimbabile
ce expun lama numai n timpul tierii.
ghid transparent i reglabil ce asigur alinierea documentelor i tiere precis
clem pentru fixarea hrtiei n timpul tierii
ED]GLQSODVWLFFXJKLGJUDGDWLFRPSDUWLPHQWHSHQWUXODPHGHVFKLPE
WLSXULGHWLHUHGUHDSWSHUIRUDUHRQGXODWLELJXLW
IRUPDWH$$
OXQJLPHPD[LPGHWLHUHPP
FDSDFLWDWHGHWLHUHFROL
GLPHQVLXQL[PP

4 tipuri de tiere

Cod
FW000101
A4

10
COLI

Trimmer 507/508
Trimmer pe suport metalic, rigl transparent gradat pe ambele laturi n inch i cm,
dispozitiv de blocare automat a colilor pe linia de tiere, cuit ncorporat n carcas
de plastic.
Cod

DH00507

DH00508

Model

507

508

Lungime maxim de tiere

320 mm

460 mm

Greutate

1 kg

1.5 kg

Dimensiuni

440 x 211 mm

580 x 211 mm

Formate acceptate

A6-A4

A6-A3

A4

DH00507

8
COLI

A3

6
COLI

DH00508

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

323

distrugtoare de documente
Distrugtor Automax 300C

funcie auto-reverse

GARANIE

07
TEHNIC DE BIROU

alimentare automat

Distrugtor profesional cu tehnologie automat de tocare a hrtiilor, prevzut cu


funcia SilentShred ce minimizeaz zgomotul produs i tehnologie SureFeed ce
asigur o distrugere sigur a documentelor. Ideal pentru birourile cu uz intens,
3-5 utilizatori.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROLDXWRPDW FROLPDQXDO
FLFOXGHOXFUXPLQXWH
IXQFLHGHDXWRUHYHUVHQFD]XOEORFULL
IXQFLHVOHHSPRGHGXSPLQXWHGHLQDFWLYLWDWH
IXQFLH6PDUW/RFNFHEORFKHD]VHUWDUXOGHKUWLHQWLPSXOXWLOL]ULLSHQWUXD
mpiedica accesul la documente
Cod
FW000302
14

alimentare automat pentru distrugere

60
4

LITRI

co detasabil cu fereastr

Distrugtor Automax 200C

co detasabil cu fereastr

GARANIE

alimentare automat pentru distrugere

funcie auto-reverse

Distrugtor cu tehnologie automat de tocare a hrtiilor, prevzut cu funcia


SilentShred ce minimizeaz zgomotul produs. Distribuie uniform particulele tocate
pentru a mpiedica blocarea. Ideal pentru birourile mici sau pentru acas,
1-3 utilizatori.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROLDXWRPDW FROLPDQXDO
FLFOXGHOXFUXPLQXWH
IXQFLHGHDXWRUHYHUVHQFD]XOEORFULL
IXQFLHVOHHSPRGHGXSPLQXWHGHLQDFWLYLWDWH
Cod
FW000301
10

fant special pentru CD-uri

18
4

LITRI

alimentare automat

Distrugtor Automax 130C

co detasabil cu fereastr

GARANIE

funcie auto-reverse

Distrugtor cu tehnologie automat de tocare a hrtiilor, prevzut cu funcia


SilentShred ce minimizeaz zgomotul produs. Distribuie uniform particulele tocate
pentru a mpiedica blocarea. Ideal pentru birourile mici sau pentru acas, 1-3
utilizatori.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROLDXWRPDW FROLPDQXDO
FLFOXGHOXFUXPLQXWH
IXQFLHGHDXWRUHYHUVHQFD]XOEORFULL
IXQFLHVOHHSPRGHGXSPLQXWHGHLQDFWLYLWDWH
Cod
FW000300
8

alimentare automat pentru distrugere

32
4

alimentare automat

324

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

LITRI

distrugtoare de documente
Distrugtor Dahle DH22312
Cu un nivel redus de zgomot i un nivel ridicat de securitate, asigur economie de
timp i siguran n utilizare. Ideal pentru birou cu 1-3 utilizatori.
WLSWLHUHFURVVFXW
GLPHQVLXQHSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
IXQFLHDXWRPDWVWDUWVWRS
LQGLFDWRUSHQWUXFR

GARANIE

07

Cod
DH022312

26
4

TEHNIC DE BIROU

14

LITRI

fant separat pentru distrugere CD-uri

fant distrugere CD-uri

Distrugtor 70S
Distrugtor profesional prevzut cu sistem sigur de blocare, funii electronice
auto-start i reverse ce maximizeaz uurina utilizrii. Ideal pentru birouri medii
pn la 5 utilizatori.
WLSWLHUHVWUDLJKWFXW
GLPHQVLXQHSDUWLFXOHPP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FLFOXGHOXFUXPLQXWH
RSULUHDXWRPDWDWXQFLFQGFRXOHVWHSOLQ
Cod
FW000402

GARANIE

sistem antiblocaj

alimentare manual

GARANIE

cuite
14

27
2

LITRI

co detaabil cu fereastr

Distrugtor 99Ci
Distrugtor profesional prevzut cu sistem antiblocaj Jam Proof 100%, funcii
electronice auto-start i reverse ce maximizeaz uurina utilizrii. Funcie Safe Sense
ce oprete n mod automat distrugerea atunci cnd minile sunt n contact cu zona
de intrare a hrtiei. Ideal pentru birourile medii cu pn la 5 utilizatori.
WLSWLHUHFURVVFXW
GLPHQVLXQHSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FLFOXGHOXFUXPLQXWH
RSULUHDXWRPDWDWXQFLFQGFRXOHVWHSOLQ

sistem antiblocaj

GARANIE

alimentare manual

Cod
FW000400

GARANIE

cuite
18

34
4

LITRI

zgomot redus n timpul utilizrii


co detaabil cu fereastr

Oricare ar fi meseria ta, avem produsul potrivit.

325

distrugtoare de documente
Distrugtor 60CS

GARANIE

funcie Safe Sense

07

Distrugtor cu design compact, funcie manual de auto-start. Funcie Safe Sense ce


oprete n mod automat distrugerea atunci cnd minile sunt n contact cu zona de
intrare a hrtiei. Ideal pentru birourile mici sau acas, un utilizator.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FDSDFLWDWHPD[LPUHFRPDQGDWGHGRFXPHQWHGLVWUXVHFROL]L
IXQFLRQDUHWLPSGHPLQXWHFXPLQXWHSDX]
Cod
FW000403

GARANIE

cuite

TEHNIC DE BIROU

10

sistem antiblocare hrtie

22
3

LITRI

capac uor de scos, pentru curare facil

Distrugtor 90s

GARANIE

co detaabil cu fereastr

Distrugtor profesional cu funcii electronice auto-start i reverse ce maximizeaz


uurina utilizrii. Funcie Safe Sense ce oprete n mod automat distrugerea atunci
cnd minile sunt n contact cu zona de intrare a hrtiei. Ideal pentru birourile
medii cu pn la 5 utilizatori.
WLSWLHUHVWUDLJKWFXW
GLPHQVLXQHILLPP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FLFOXGHOXFUXPLQXWH
RSULUHDXWRPDWDWXQFLFQGFRXOHVWHSOLQ
Cod
FW000401

GARANIE

cuite

18

zgomot redus n timpul utilizrii

34
2

LITRI

alimentare manual

Distrugtor Dahle DH22092


Recomandat pentru uz ocazional n birou, fiind un echipament eficient i uor de
folosit, ce dispune de fant special pentru distrugerea CD-urilor.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
IXQFLHDXWRUHYHUVH
HFRQRPLHGHHQHUJLHQPRGXOVWDQGE\

GARANIE

Cod
DH022092
10

12
4

LITRI

fant pentru distrugerea CD-urilor

Distrugtor Dahle DH22022


Recomandat i pentru ocazional n birou.
Este un echipament uor de folosit datorit dimensiunilor reduse putnd fi amplasat
cu uurin n biroul utilizatorului.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
IXQFLHDXWRPDWVWDUWVWRS
IXQFLHPDQXDODXWRUHYHUVH

GARANIE

Cod
DH022022
7

co pentru colectarea deeurilor

326

12
4

LITRI

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

distrugtoare de documente
Distrugtor Fellowes H-8CD

GARANIE

capac uor de scos,


pentru curare facil

07

Distrugtor cu design compact, funcie manual de auto-start. Funcie Safe Lock ce


previne pornirea accidental. Fant separat pentru distrugere CD-uri. Ideal pentru
birourile mici sau acas, un utilizator.
WLSWLHUHFURVVFXW
GLPHQVLXQLSDUWLFXOH[PP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FDSDFLWDWHPD[LPUHFRPDQGDWGHGRFXPHQWHGLVWUXVHFROL]L
FLFOXGHOXFUXPLQXWH
Cod
FW000404

GARANIE

TEHNIC DE BIROU

cuite
8

12
4

LITRI

blocare pentru activare acidental


funcie Safe Lock

Distrugtor P28S
Distrugtor cu design compact, funcie manual de auto-start.
Ideal pentru birourile mici sau acas, un utilizator.
WLSGHWLHUHVWUDLJKWFXW
GLPHQVLXQLSDUWLFXOHPP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FDSDFLWDWHPD[LPUHFRPDQGDWGHGRFXPHQWHGLVWUXVHFROL]L
FLFOXGHOXFUXPLQXWHFXPLQXWHSDX]

GARANIE

Cod
FW000405

GARANIE

cuite
8

15
2

LITRI

Distrugtor P25S
Distrugtor cu design compact, funcie manual de auto-start.
Ideal pentru birourile mici sau acas, un utilizator.
WLSGHWLHUHVWUDLJKWFXW
GLPHQVLXQLSDUWLFXOHPP
QLYHOGHVHFXULWDWH
FDSDFLWDWHFROLFROL
FDSDFLWDWHPD[LPUHFRPDQGDWGHGRFXPHQWHGLVWUXVHFROL]L
FLFOXGHOXFUXPLQXWH

GARANIE

Cod
FW000406

GARANIE

cuite

11
2

LITRI

ultra portabil

Ulei pentru distrugtoare


Acest produs ajut la mbuntirea
performanelor distrugtorului tu, asigurnd
o mai bun funcionare i prelungind durata
de via. Ambalare: flacon 250 ml.
Cod
DH20790

328

Ulei pentru distrugtoare


FDQWLWDWHPO
Cod
FW000407

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

distrugtoare de documente
Tiere pe o singur direcie - Straight Cut

Fellowes 90S
FW000401
2
18
230
5.8
3.6
34
Capse, agrafe, CD, DVD
Auto-Start
592 x 288 x 442
14.6
2
5

Fellowes 70S
FW000402
2
14
230
5.8
3.6
27
Capse, agrafe, CD, DVD
Auto-Start
440 x 346 x 252
9.7
2
5

Fellowes P-28S
FW000405
2
8
220
6
1.8
15
Doar hrtie
Auto-Start
189 x 321 x 381
1.8
1
1

Fellowes P-25S
FW000406
2
5
200
7
1.8
11
Doar hrtie
Auto-Start manual
160 x 301 x 300
1.8
1
1

07
Straight Cut

Cross Cut

Distrugtoarele reprezint o
metod eficient pentru asigurarea
confidenialitii documentelor. Cu un
design atractiv, aceste aparate sunt
potrivite att pentru uz personal, ct i
pentru office. Toate distrugtoarele au
controlul pornit/oprit automat, mod
reverse pentru eliberarea colilor blocate,
cuite rezistente din oel i accept capse.

TEHNIC DE BIROU

MODEL
Cod
Nivel de securitate
Capacitate de tiere (coli)
Limea fantei de acces (mm)
Lime fie tiat (mm)
Viteza de tiere (m/min)
Capacitate co deeuri (litri)
Distruge
Comand operaii
Dimensiuni (mm) H x l x L
Greutate (kg)
Garanie motor (ani)
Garanie cuit (ani)

Tiere ncruciat - Cross Cut

MODEL
Cod
Nivel de securitate
Capacitate de tiere (coli)
Limea fantei de acces (mm)
Lime fie tiat
Viteza de tiere (m/min)
Capacitate co deeuri (litri)
Distruge
Comand
Dimensiuni (mm) H x l x L
Greutate (kg)
Garanie motor (ani)
Garanie cuit (ani)

MODEL
Cod
Nivel de securitate
Capacitate de tiere
Limea fantei de acces (mm)
Lime fie tiat
Viteza de tiere (m/min)
Capacitate co deeuri (litri)
Distruge
Comand
Dimensiuni (mm) H x l x L
Greutate (kg)
Garanie motor (ani)
Garanie cuit (ani)

Fellowes Automax 300C


FW000302
4
300 / 14
230
4 x 38
2
60
Capse, agrafe, CD, DVD, card
Automat
898 x 430 x 673
2
20

Fellowes 60CS
FW000403
3
10
230
4 x 50
3.3
22
Capse, agrafe, card
Auto-Start
371 x 233 x 407
5.8
2
5

Fellowes Automax 200C


FW000301
4
200 / 10
230
4 x 38
2
32
Capse, agrafe, CD, DVD, card
Automat
563 x 346 x 507
2
20

Dahle DH22092
DH022092
4
10
218
4.5 x 35
4
12
Capse, agrafe, card
429 x 320 x 195
6.6
2
-

Fellowes Automax 130C


FW000300
4
130 / 8
230
4 x 51
3.35
32
Capse, agrafe, CD, DVD, card
Automat
539 x 344 x 515
2
20

Dahle DH22312
DH022312
4
14
220
4 x 37
2.5
26
Capse, agrafe, CD, DVD, card
534 x 376 x 286
11
2
-

Dahle DH22022
DH022022
4
7
220
4 x 35
3
14
doar hrtie
395 x 310 x 170
3.8
2
-

Fellowes 99 Ci
FW000400
4
14
230
4 x 38
3.6
34
Capse, agrafe, CD, DVD, card
Auto-Start
442 x 288 x 392
16.5
2
5

Fellowes H-8CD
FW000404
4
8
220
4 x 35
1.8
12
Capse, agrafe, CD, DVD
Auto-Start
4.8
2
3

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

329

aparate de ndosariat
Aparat de ndosariat Quasar Wire
Aparat de ndosariat cu inele metalice. Sistem patentat de msurare a inelelor de
metal i a documentelor, perforare manual.
JKLGDMXVWDELOSHQWUXPDUJLQHDOLQLD]FROLOHFXSUHFL]LH
NLWGHED]LQFOXVSHQWUXGRFXPHQWH
PRGGHSHUIRUDUHPDQXDO
IRUPDW$$

TEHNIC DE BIROU

07

FW000803

Cod

Capacitate de perforare

15 coli (80 g/mp)

Capacitate de ndosariere

120 coli

Diametru maxim inel plastic

50 mm

Lungime maxim de legare

305 mm

Dimensiuni

132 x 470 x 412 (mm)

Greutate

7.4 kg

ndosariere cu spire metalice

GARANIE

tvi pentu deeuri

sistem patentat de msurare


a inelelor

Aparat de ndosariat
comBIND 500
Echipament de ndosariat profesional, util pentru legarea documentelor.
Confer un aspect profesional prezentrilor dumneavoastr.
PRGGHSHUIRUDUHPDQXDO
IRUPDW$$

GARANIE

SL101011

Cod
Capacitate de perforare

25 coli (80 g/mp)

Capacitate de ndosariere

500 coli

Diametru maxim inel plastic

51 mm

Lungime maxim de legare

305 mm

Dimensiuni

450 x 550 x 170 (mm)

Greutate

13 kg

ndosariere cu spire din plastic

alegerea dimensiunii
inelului pentru
ndosariere

330

introducerea inelului
pentru ndosariere

manet pentru
desfacerea inelului
pentru ndosariere

introducerea colilor i
coperilor n inel

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

aparate de ndosariat
Aparat de ndosariat Quasar 500+
Aparat de ndosariat cu inele de plastic, perforare manual.
Sistem patentat de msurare a inelelor de plastic i a documentelor.
JKLGDMXVWDELOSHQWUXPDUJLQHDOLQLD]FROLOHFXSUHFL]LH
NLWGHED]LQFOXVSHQWUXGRFXPHQWH
IRUPDW$$
FW000801

Cod
Capacitate de perforare

20 coli (80 g/mp)

Capacitate de ndosariere

500 coli

Diametru maxim inel plastic

50 mm

Lungime maxim de legare

305 mm

126 x 456 x 418 (mm)

Greutate

7 kg

mecanism de aliniere a colilor

TEHNIC DE BIROU

Dimensiuni

margine lateral de aliniere a colilor

07

GARANIE

tav de depozitare cu sistem patentat de


msurare a inelelor

tvi pentu deeuri

Aparat de ndosariat Pulsar+ 300


Aparat de ndosariat cu inele din plastic, perforare manual.
Sistem patentat de msurare a inelelor de plastic i a documentelor.
JKLGDMXVWDELOSHQWUXPDUJLQHDOLQLD]FROLOHFXSUHFL]LH
NLWGHED]LQFOXVSHQWUXGRFXPHQWH
IRUPDW$$
FW000802

Cod
Capacitate de perforare

15 coli (80 g/mp)

Capacitate de ndosariere

300 coli

Diametru maxim inel plastic

38 mm

GARANIE

Lungime maxim de legare

305 mm

Dimensiuni

130 x 456 x 396 (mm)

Greutate

6.9 kg

fagure pentru spiral nclinat pentru


a uura introducerea hrtiei

form ergonomic

caseta deeuri

tav de depozitare cu sistem patentat de


msurare a inelelor

tvi pentru deeuri

Aparat de ndosariat manual Star 150+


Aparat de ndosariat cu inele din plastic, perforare manual.
Sistem patentat de msurare a inelelor de plastic i a documentelor.
JKLGDMXVWDELOSHQWUXPDUJLQHDOLQLD]FROLOHFXSUHFL]LH
NLWGHED]LQFOXVSHQWUXGRFXPHQWH
IRUPDW$$

GARANIE

FW000800

Cod
Capacitate de perforare

12 coli (80 g/mp)

Capacitate de ndosariere

150 coli

Diametru maxim inel plastic

18 mm

Lungime maxim de legare

305 mm

Dimensiuni

130 x 456 x 396 (mm)

Greutate

6.9 kg

mecanism independent de perforare

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

331

aparate de laminat
ase role

iLAM touch stabilete noi standarde n laminare - laminator premium A3, 100%
automat cu senzori ncorporai, pentru o utilizare profesional.
FRPSOHWDXWRPDWGHPDUHYLWH]SHQWUXXWLOL]DUHLQWHQVLY
IXQFLHGHUHYHUVDXWRPDWFHSUHYLQHEORFDUHDGRFXPHQWHORUQODPLQDWRU
IXQFLHGHDXWRVWLQJHUHGXSPLQXWHGHSDX]
FRQVXPGHHQHUJLHVF]XW

07
3

GARANIE

TEHNIC DE BIROU

Aparat de laminat
iLAM Touch Turbo

laminare n 10 secunde
SUPER
CALITATE

Cod

SL091212

SL091214

Model

iLAM Touch Turbo

iLAM Touch Turbo

Format

A4

A3

Lime maxim de laminare 230 mm

320 mm

Grosimea maxim a foliei

250 mm

250 mm

Vitez de laminare

700 mm/minut

1900 mm/minut

Nr. role

Timp de nclzire

1 minut

1 minut

Dimensiuni (L x H x l)

414 x 143 x 401 mm

526 x 143 x 401 mm

Greutate

3.8 kg

6.3 kg

Alte funcii

revers automat

revers automat

complet automat - nu
necesit setri prealabile

clape rabatabile - pentru


o laminare perfect plat

tehnologie cu senzori laminare inteligent

Laminatoarele inteligente Leitz iLAM touch turbo sunt cele


mai rapide din categoria lor. Datorit tehnologiei de ultim
generaie, acestea lamineaz pn la 1.900 mm pe minut.
Leitz iLAM Tot ce trebuie s tii este ON i OFF!

Aparat de laminat
iLAM Touch
iLAM touch stabilete noi standarde n laminare. Laminator premium A4/A3,
100% automat, cu senzori ncorporai, pentru o utilizare profesional.
FRPSOHWDXWRPDWGHPDUHYLWH]SHQWUXXWLOL]DUHLQWHQVLY
IXQFLHGHUHYHUVDXWRPDWFHSUHYLQHEORFDUHDGRFXPHQWHORUQODPLQDWRU
IXQFLHGHDXWRVWLQJHUHGXSPLQXWHGHSDX]
FRQVXPGHHQHUJLHVF]XW

GARANIE

setri automate
patru role
SUPER
CALITATE

332

Cod

SL091213

Model

iLAM Touch

Format

A3

Lime maxim de laminare

320 mm

Grosimea maxim a foliei

250 mm

Vitez de laminare

700 mm/minut

Nr. role

Timp de nclzire

1 minut

Dimensiuni (L x H x l)

526 x 143 x 401 mm

Greutate

5.0 kg

Alte funcii

revers automat

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

De ce este nevoie pentru ca laminarea s e att de uoar? De o tehnologie sucient de inovatoare nct s
permit o laminare simpl i rapid, cu rezultate perfecte de ecare dat. Leitz a creat primele laminatoare
100% automate. Cu laminatoarele iLAM nu este necesar nicio setare. n plus, Foliile cu Tehnologia Unic de
Direcie i indic direcia corect de introducere a documentului n laminator.
Tot ce trebuie s tii este ON i OFF!

www.leitz.com /ilam

aparate de laminat
Aparat de laminat Neptun
Laminator cu 4 role, pentru o laminare de nalt calitate. Util i pentru laminarea
pozelor. Dispune de funcia AutoSense - sistem unic de detectare a grosimii foliei
i de auto-ajustare a vitezei de laminare. Funcia InstaHeat asigur nclzirea
aparatului ntre 30 i 60 secunde de la pornire, iar funcia manual de revers,
asigur operaiuni sigure, n orice moment.

07

4 role, nclzire rapid

TEHNIC DE BIROU

GARANIE

Cod

FW000600

Model

Neptun

Format

A3

Lime maxim de laminare

320 mm

Grosimea maxim a foliei

75/80-175 mm

Vitez de laminare

650 mm/minut

Timp de nclzire

3 min

Dimensiuni (L x H x l)

125 x 570 x 180 mm

Greutate

5.0 kg

CALITATE
PRE

utilizare facil

funcie manual de reverse

Aparat de laminat Saturn 3i


Funcia InstaHeat asigur nclzirea aparatului n 60 secunde de la pornire.
Prevzut cu senzor ce oprete laminarea, dac documentul nu este aliniat,
permind reaezarea acestuia. Oprire automat dup 30 de minute de inactivitate
pentru reducerea consumului de energie.
2 role

GARANIE

CALITATE
PRE

Cod

FW000500

FW000501

Model

Saturn 3i

Saturn 3i

Format

A3

A4

Lime maxim de laminare

320 mm

235 mm

Grosimea maxim a foliei

75/80-125 mm

75/80-125 mm

Vitez de laminare

300 mm/minut

300 mm/minut

Timp de nclzire

60 s

60 s

Dimensiuni (L x H x l)

105 x 532 x 146 mm

105 x 437 x 140 mm

Greutate

2.1 kg

1.7 kg

Aparat de laminat L125


Laminator cu design elegant, util pentru acas sau pentru birouri mici.
Prevzut cu manet pentru eliberarea documentelor prelucrate greit. Sistem cu 2
role i temperatur fix. Indicatorii audio i vizuali semnaleaz atunci cnd aparatul
este pregtit. Lamineaz fotografii i documente.

GARANIE

334

Cod

FW000700

Model

L125

Format

A4

Lime maxim de laminare

230 mm

Grosimea maxim a foliei

75/80-175 mm

Vitez de laminare

300 mm/minut

Timp de nclzire

5-6 min

Dimensiuni (L x H x l)

90 x 380 x 100 mm

Greutate

1.5 kg

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

accesorii ndosariere i laminare


Folii pentru laminare
Dimensiuni/ 216 x 303 mm (A4) 303 x 426 mm (A3)
Grosime (m)
AY140754

80

AY140854

100

AY141004

125

AY141254

175

AY141754

AY140753
AY141253

07
TEHNIC DE BIROU

75

Folii pentru laminare Leitz iLAM


Foliile pentru laminare la cald Leitz iLAM ndeplinesc cele mai nalte standarde de calitate i siguran,
asigurnd protecia documentelor importante! Unitate de vnzare: 100 coli/top.
Dimensiuni/ 54 x 86 mm 65 x 95 mm
Grosime (m)

154 x 216 mm (A5) 216 x 303 mm (A4) 303 x 426 mm (A3)

80

SL090807

100
SL091251 SL091252 SL091257

SL090805

SL090806

SL091005

SL091006

SL091255

SL091256

175

SL091755

SL091756

250

SL092505

125

laminare perfect de fiecare dat


Scaneaz codul
cu mobilul pentru
a vedea noile
videoclipuri iLAM!

Foliile pentru laminare la cald Leitz iLAM beneficiaz de Tehnologia Unic


de Direcie (UDT Unique Direction Technology), care garanteaz o
laminare uoar, fr blocaje, ntotdeauna perfect.
WHKQRORJLHXQLF
XRUGHIRORVLW
IUEORFDMH
ODPLQDUHQIUEXOHGHDHU
IUGRFXPHQWHGLVWUXVH
UH]XOWDWHSHUIHFWHODHFDUHXWLOL]DUH
PEXQWHVFDVSHFWXOGRFXPHQWHORU FXORULPDLDFFHQWXDWH L
protejeaz mpotriva uzurii
VJHLOHGHVHQDWHSHIROLHLQGLFGLUHFLDFRUHFWGHLQWURGXFHUH
a documentului n laminator i dispar imediat ce procesul s-a ncheiat
GLVSDULLDVJHLORUHVWHGRYDGDXQHLHWDQULSHUIHFWH
VHUHFRPDQGXWLOL]DUHDORUPSUHXQFXODPLQDWRDUHOH/HLW]L/$0
ns sunt compatibile cu orice marc de laminatoare

Inele de ndosariere
Culoare: negru.
Cod

Grosime (mm)

Unitate de vnzare

AY100601

100 buci/cutie

AY100801

100 buci/cutie

AY100802

100 buci/cutie

SFATUL SPECIALISTULUI
UTILIZAREA INELELOR DE NDOSARIERE
Pentru un aspect profesionist al documentelor, alege corect inelele.
Grosimea (diametrul) acestora trebuie raportat la numrul de pagini pe
care doreti s le ndosariezi.
Grosime (mm) Numr de coli Grosime (mm) Numr de coli

AY101001

10

100 buci/cutie

AY101201

12

100 buci/cutie

AY101401

14

100 buci/cutie

AY101601

16

100 buci/cutie

4 mm

16

20 mm

150

AY101901

19

100 buci/cutie

6 mm

25

22 mm

175

AY102201

22

50 buci/cutie

8 mm

40

25 mm

200

10 mm

55

28 mm

250

AY102801

28

50 buci/cutie

AY103201

32

50 buci/cutie

11 mm

70

32 mm

275

12 mm

85

38 mm

325

AY103801

38

50 buci/cutie

AY104501

45

50 buci/cutie

AY105101

51

50 buci/cutie

14 mm

100

45 mm

375

16 mm

125

51 mm

425

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

335

accesorii ndosariere i laminare


Spire metalice
Ofer documentelor legate o elegan oficial i o siguran n exploatare.
Culoare: negru.

TEHNIC DE BIROU

07

Cod

Grosime (mm)

Unitate de vnzare

AY180601

100 buci/cutie

AY180801

100 buci/cutie

AY180802

100 buci/cutie

AY181001

10

100 buci/cutie

AY181201

12

100 buci/cutie

AY181401

14

100 buci/cutie

Coperi din plastic pentru ndosariere


Unitate de vnzare: 100 coli/top.
Cod
SL093102

Culoare

Grosime (m)

Dimensiuni (mm)

transparent

150

210 x 297 (A4)

SL093103

transparent

180

210 x 297 (A4)

SL093106

transparent

200

210 x 297 (A4)

SL093107

fumuriu

200

210 x 297 (A4)

SL093105

transparent

250

210 x 297 (A4)

Coperi din plastic pentru ndosariere


Unitate de vnzare: 100 coli/top.
Cod
AY110105

Culoare

Grosime (m)

Dimensiuni (mm)

cristal

150

210 x 297 (A4)

Coperi din carton colorat


Format: A4. Dimensiuni: 210 x 297 mm. Gramaj: 250 g/mp.
Unitate de vnzare: 100 coli/top.
Cod
AY110503

Culoare

AY110502

albastru

AY110701

negru

alb

Coperi imitaie piele


Format: A4. Dimensiuni: 210 x 297 mm. Gramaj: 250 g/mp.
Unitate de vnzare: 100 coli/top.

336

Cod
AY110303

Culoare

AY110302

albastru

AY110301

negru

alb

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

8. Consumabile IT
tonere originale HP

338

tonere originale Lexmark

348

cartue cu cerneal originale HP

342

tonere originale Samsung

348

tonere originale Brother

345

tonere originale Xerox

349

cartue cu cerneal originale Brother

345

tonere compatibile HP

350

tonere originale Canon

346

cartue cu cerneal compatibile HP

351

cartue cu cerneal originale Canon

347

consumabile compatibile Canon

351

riboane originale Epson

347

alte consumabile compatibile

351

cartue cu cerneal originale Epson

347

consumabile IT

Toner original CB381A

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH&RORU/DVHU-HW&3
Cod: HP814600

QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH&RORU/DVHU-HW&3&0
Cod: HP812801

Toner original CB383A

Toner original CB382A

QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH&RORU/DVHU-HW&3&0
Cod: HP812802

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH&RORU/DVHU-HW&3&0
Cod: HP812803

CONSUMABILE IT

08

Toner original CB380A

Disponibile din stoc!

Tonere originale HP

NOU

Cod HP
C7115A

Cod RTC
FK31200

Nr. pagini*

Culoare

Echipamente compatibile

2500

negru

Laserjet 1000/1005/1200/1220/3300 Multifunction/3380

C7115X

FK118

3500

negru

Laserjet 1200/1220/3300 Multifunction/3380

C8543X

FK156

30000

negru

Laserjet M9040mfp/M9050mfp/9000/9040/9050

CB380A

HP814600

16500

negru

Color LaserJet CP6015

NOU

CB381A

HP812801

21000

cyan

Color LaserJet CP6015, CM6030/6040

NOU

CB382A

HP812803

21000

galben

Color LaserJet CP6015, CM6030/6040

NOU

CB383A

HP812802

21000

magenta

Color LaserJet CP6015, CM6030/6040

CB435A

FK164

1500

negru

Laserjet P1005/P1006

CB436A

PM130

2000

negru

Laserjet P1505/N, M1120, M1522MFP

CB540A

FK173

2200

negru

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB541A

FK174

1400

cyan

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB542A

FK175

1400

galben

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB543A

FK176

1400

magenta

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CC364A

FK177

10000

negru

Laserjet P4014/P4015/P4515

CC364X

HP811200

20000

negru

Laserjet P4015/P4515

CC530A

HP811100

3500

negru

Color Laserjet CP2025/CM2320

CC531A

HP810401

2800

cyan

Color Laserjet CP2025/CM2320

CC532A

HP810303

2800

galben

Color Laserjet CP2025/CM2320

CC533A

HP810202

2800

magenta

Color Laserjet CP2025/CM2320

CE255A

HP810700

6000

negru

Laserjet P3015

CE278A

HP810800

2100

negru

Laserjet Pro P1566, Laserjet P1606, Laserjet Pro M1536dnf

CE285A

FK432

1600

negru

Laserjet P1102/Pro M1212nf MFP/M1217nfw MFP/M1132/M1214

CE320A

HP811300

2000

negru

Color Laserjet CP1525/CM1415

CE321A

HP810501

1300

cyan

Color Laserjet CP1525/CM1415

CE322A

HP810403

1300

galben

Color Laserjet CP1525/CM1415

CE323A

HP810302

1300

magenta

Color Laserjet CP1525/CM1415

COMAND
SPECIAL

!
338

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT
Toner original Q6000A
QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH&RORU/DVHUMHWQ
CM1015mfp/CM1017mfp
Cod: FK160

Toner original Q6001A

08
CONSUMABILE IT

QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH&RORU/DVHUMHWQ
CM1015mfp/CM1017mfp
Cod: FK161

Toner original Q6002A


QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH&RORU/DVHUMHWQ
CM1015mfp/CM1017mfp
Cod: FK162

Toner original Q6003A


QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH&RORU/DVHUMHWQ
CM1015mfp/CM1017mfp
Cod: FK163

Toner original CF283A


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH/DVHU-HW3UR0)300VHULHV/DVHU-HW
Pro M201n/dw, LaserJet Pro MFP M225dn/dw
Cod: HP813500

Disponibile din stoc!

Tonere originale HP

NOU

Cod HP
CE505A

Cod RTC
FK1781

Nr. pagini*

Culoare

Echipamente compatibile

2300

negru

Laserjet P2035/P2055

CE505X

FK178

6500

negru

Laserjet P2055d/dn

CF280A

HP812300

2700

negru

Laserjet M425, Laserjet Pro 400 M401/425

CF280X

HP812400

6900

negru

Laserjet Pro 400 M401/Pro 400 MFP M425

CF283A

HP813500

1500

negru

LaserJet Pro MFP M125/M127 series, LaserJet Pro M201n/dw, LaserJet Pro MFP M225dn/dw

Q2612A

FK133

2000

negru

Laserjet 1010/1012/1015/1018/1020/1022/3015/3020/3030/3050/3052/3055/M1005mfp/M1319mfp

Q5949A

FK149

2500

negru

Laserjet 1160/1320/3390/3392

Q6000A

FK160

2500

negru

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q6001A

FK161

2000

cyan

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp


Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q6002A

FK162

2000

galben

Q6003A

FK163

2000

magenta

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q7551A

FK0391

6500

negru

Laserjet M3027/M3035/P3005

Q7551X

FK039

13000

negru

Laserjet M3027/M3035/P3005

Q7553A

FK040

3000

negru

Laserjet P2014/P2015/M2727mfp

Q7553X

FK0101

7000

negru

Laserjet P2014/P2015/M2727mfp

COMAND
SPECIAL

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

339

consumabile IT

CONSUMABILE IT

08

Toner original CE340A

Toner original CE341A

Toner original CE342A

Toner original CE343A

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH/DVHU-HW(QWHUSULVHFRORU
MFP M775
Cod: HP813800

QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH/DVHU-HW(QWHUSULVHFRORU
MFP M775
Cod: HP812501

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH/DVHU-HW(QWHUSULVHFRORU
MFP M775
Cod: HP812403

QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH/DVHU-HW(QWHUSULVHFRORU
MFP M775
Cod: HP812402

Toner original CE410X

Toner original CF033A

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH/DVHUMHW3UR&RORU00)3
M351 MFP/M475 MFP/M375 MFP
Cod: HP812800

QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH&RORU/DVHU-HW(QWHUSULVH
CM4540 MFP
Cod: HP810702

Toner original CF031A

Toner original CF032A

QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH&RORU/DVHU-HW(QWHUSULVH
CM4540 MFP
Cod: HP810901

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH&RORU/DVHU-HW(QWHUSULVH
CM4540 MFP
Cod: HP810903

Disponibile la comand special!


Disponibile la comand special!

Tonere originale HP
Cod HP
CE255X

Cod RTC
FK184

Nr. pagini*

Culoare

Echipamente compatibile

12500

negru

Laserjet P3015

CE310A

HP811500

1200

negru

Color Laserjet CP1012/1025, Laserjet Pro 100 M175/M275

CE311A

HP811001

1000

cyan

Color Laserjet CP1012/1025, Laserjet Pro 100 M175/M275

CE312A

HP810803

1000

galben

Color Laserjet CP1012/1025, Laserjet Pro 100 M175/M275

CE313A

HP811003

1000

magenta

Color Laserjet CP1012/1025, Laserjet Pro 100 M175/M275

NOU

CE340A

HP813800

13500

negru

LaserJet Enterprise 700 color MFP M775

NOU

CE341A

HP812501

16000

cyan

LaserJet Enterprise 700 color MFP M775

NOU

CE342A

HP812403

16000

galben

LaserJet Enterprise 700 color MFP M775

NOU

CE343A

HP812402

16000

magenta

LaserJet Enterprise 700 color MFP M775

CE400A

HP812900

5500

negru

Laserjet Enterprise 500 color M551n

CE401A

HP812301

6000

cyan

Laserjet Enterprise 500 color M551n

NOU

CE402A

HP812303

6000

galben

Laserjet Enterprise 500 color M551n

CE403A

HP812302

6000

magenta

Laserjet Enterprise 500 color M551n

CE410A

HP812200

2200

negru

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE410X

HP812800

4000

negru

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE411A

HP810801

2600

cyan

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE412A

HP810703

2600

galben

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE413A

HP810602

2600

magenta

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE740A

HP812000

7000

negru

Color Laserjet CP5225

CE741A

HP810701

7300

cyan

Color Laserjet CP5225

CE742A

HP810603

7300

galben

Color Laserjet CP5225

CE743A

HP810502

7300

magenta

Color Laserjet CP5225

NOU

CF031A

HP810901

12500

cyan

Color LaserJet Enterprise CM4540 MFP

NOU

CF032A

HP810903

12500

galben

Color LaserJet Enterprise CM4540 MFP

NOU

CF033A

HP810702

12500

magenta

Color LaserJet Enterprise CM4540 MFP

!
340

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT

Toner original CF380A


Toner original CF350A

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH/DVHU-HW3UR0)30'1':1:
Cod: HP814300

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH/DVHU-HW3UR0)3010IZ
Cod: HP814400

Toner original CF352A

Toner original CF382A

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH/DVHU-HW3UR0)3010IZ
Cod: HP812603

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH/DVHU-HW3UR0)30'1':1:
Cod: HP812503

CONSUMABILE IT

08

Toner original CF351A


QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH/DVHU-HW3UR0)3010IZ
Cod: HP812701

Toner original CF381A


QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH/DVHU-HW3UR0)30'1':1:
Cod: HP812601

Toner original CF353A


QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH/DVHU-HW3UR0)3010IZ
Cod: HP812602

Toner original CF383A


QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH/DVHU-HW3UR0)30'1':1:
Cod: HP812502

Disponibile la comand special!

Tonere originale HP
Cod HP
CF210A

Cod RTC
HP812500

Nr. pagini*

Culoare

1600

negru

Echipamente compatibile
Laserjet Pro 200 color M251n/nw/MFP M276n/nw

CF211A

HP812201

1800

cyan

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

CF212A

HP812203

1800

galben

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

CF213A

HP812202

1800

magenta

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

NOU

CF350A

HP814400

1300

negru

LaserJet Pro MFP M176N/M177fw

NOU

CF351A

HP812701

1000

cyan

LaserJet Pro MFP M176N/M177fw


LaserJet Pro MFP M176N/M177fw

NOU

CF352A

HP812603

1000

galben

NOU

CF353A

HP812602

1000

magenta

LaserJet Pro MFP M176N/M177fw

NOU

CF380A

HP814300

2400

negru

/DVHU-HW3UR0)30'1':1:

NOU

CF381A

HP812601

2700

cyan

/DVHU-HW3UR0)30'1':1:

NOU

CF382A

HP812503

2700

galben

/DVHU-HW3UR0)30'1':1:

NOU

CF383A

HP812502

2700

magenta

/DVHU-HW3UR0)30'1':1:

Q2613A

FK308

2500

negru

Laserjet 1300

Q2613X

FK3081

4000

negru

Laserjet 1300

Q5942A

FK320

10000

negru

Laserjet 4250/4350

Q5942X

FK321

20000

negru

Laserjet 4250/4350

Q5949X

FK150

6000

negru

Laserjet 1320/3390/3392

Q5950A

FK5950

11000

negru

Color Laserjet 4700

Q5951A

FK5951

10000

cyan

Color Laserjet 4700

Q5952A

FK5952

10000

galben

Color Laserjet 4700

Q5953A

FK5953

10000

magenta

Color Laserjet 4700

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Oricare ar fi meseria ta, avem produsul potrivit.

341

consumabile IT

CONSUMABILE IT

08

TIAI C?
Toate tipurile de cerneluri sunt testate
cu ajutorul a peste 20 de teste diferite
pentru evaluarea gradului de puritate
i peste 50 de teste de calitate, cum ar
fi rezistena la ap, rezistena la uzur
i acurateea culorilor.

Disponibile din stoc!

Cartue cu cerneal originale HP


Cod HP
C4844A

Cod RTC
PM215

Nr. cartu
HP 10

Nr. pagini*

Culoare

1750

negru

Business Inkjet 1000/1200/2200/2300/2600/2800 series, Officejet Pro K850 series

C4836A

PM221

HP 11

1750

cyan

Business Inkjet 1000/1200/2200/2300/2600/2800 series, Officejet Pro K850 series

C4837A

PM223

HP 11

1750

magenta

Business Inkjet 1000/1200/2200/2300/2600/2800 series, Officejet Pro K850 series

C4838A

PM224

HP 11

1750

galben

Business Inkjet 1000/1200/2200/2300/2600/2800 series, Officejet Pro K850 series

C6615DE

PM139

HP 15

495

negru

'HVNMHWFFFFF2FHMHW36&

C9351AE

PM176

HP 21

150

negru

'HVNMHW)')2FHMHW
4315/4355, J3680

C9352AE

PM177

HP 22

138

color

'HVNMHW)')2FHMHW
4315/4355, J3680

C8727AE

PM152

HP 27

220

negru

'HVNMHW2FHMHW36&

C8728AE

PM153

HP 28

190

color

'HVNMHW2FHMHW36&

51645AE

PM136

HP 45

840

negru

'HVNMHW2FHMHW3UR3KRWRVPDUW
1000/1100/1215/1315

C6656AE

PM149

HP 56

450

negru

'HVNMHW)2FHMHW3KRWRVPDUW
7150/7260/7350/7450/7960

C6657AE

PM150

HP 57

400

color

'HVNMHW)2FHMHW3KRWRVPDUW
7150/7260/7350/7450/7960
'HVNMHW36&3KRWRVPDUW

C6578D

PM138

HP 78

450

color

C4911A

PM161

HP 82

1750

cyan

'HVLJQMHWPISPISVHULHVVHULHV

C4912A

PM162

HP 82

1750

magenta

'HVLJQMHWPISPISVHULHVVHULHV

C4913A

PM163

HP 82

1750

galben

'HVLJQMHWPISPISVHULHVVHULHV

C9385AE

PM235

HP 88

900

negru

Officejet Pro K550/5400/8600, L7480/7580/7590/7680/7780

C9396AE

PM2352

HP 88

2580

negru

Officejet Pro K550/5400/8600, L7480/7580/7590/7680/7780

C9386AE

PM236

HP 88

940

cyan

Officejet Pro K550/5400/8600, L7480/7580/7590/7680/7780

C9387AE

PM237

HP 88

1130

magenta

Officejet Pro K550/5400/8600, L7480/7580/7590/7680/7780

C9388AE

PM238

HP 88

850

galben

Officejet Pro K550/5400/8600, L7480/7580/7590/7680/7780

CC640EE

PM368

HP 300

'HVNMHW')))3KRWRVPDUW&(QY\

PM378

CC643EE

PM367

200
HP 300XL 600
HP 300
165

negru

CC641EE

HP 300XL 440

negru

'HVNMHW')))3KRWRVPDUW&(QY\

color

'HVNMHW')))3KRWRVPDUW&(QY\

CC644EE

PM379

color

'HVNMHW')))3KRWRVPDUW&(QY\

CH561EE

HP800300 HP 301

190

negru

'HVNMHW

CH563EE

negru

'HVNMHW

CH562EE

HP800600 HP 301XL 480


HP800504 HP 301
165

color

'HVNMHW

CH564EE

HP800704 HP 301XL 330

color

'HVNMHW

COMAND
SPECIAL

!
342

Echipamente compatibile

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT

Disponibile din stoc!

Cod HP

Cod RTC

Nr. cartu

Nr. pagini*

Culoare

Echipamente compatibile

C9362EE

PM336

HP 336

210

negru

'HVNMHW'2FHMHW3KRWRVPDUW&

C9364EE

PM337

HP 337

400

negru

'HVNMHW2FHMHW+PRELOHPRELOH.
3KRWRVPDUW&'

C8765EE

PM173

HP 338

450

negru

'HVNMHW2FHMHW+PRELOHPRELOH.3KRWRVPDUW
2610/2710, C3180/7850/8150/8450/8750/Pro B8350

C8767EE

PM169

HP 339

800

negru

'HVNMHW2FHMHW.3KRWRVPDUW
'3UR%

C8766EE

PM174

HP 343

260

color

'HVNMHW2FHMHW+PRELOHPRELOH.3KRWRVPDUW
2610/2710, C3180/7850/8150/8450/8750/Pro B8350

C9363EE

PM170

HP 344

450

color

'HVNMHW2FHMHW+PRELOHPRELOH.3KRWRVPDUW
2610/2710, C8150/8450/8750/Pro B8350

CB335EE

PM350

HP 350

negru

'HVNMHW'2FHMHW-3KRWRVPDUW&'

CB336EE

PM350XL

CB337EE

PM193

200
HP 350XL 1000
HP 351
170

negru

'HVNMHW'2FHMHW-3KRWRVPDUW&'

color

'HVNMHW'2FHMHW-3KRWRVPDUW&'

CB338EE

PM351XL

HP 351XL 580

color

'HVNMHW'2FHMHW-3KRWRVPDUW&'

CB316EE

PM373

HP 364

250

negru

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CN684EE

HP800500 HP 364XL 550

negru

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB318EE

PM377

300

cyan

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB323EE

HP800001 HP 364XL 750

cyan

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB319EE

PM376

300

magenta

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB324EE

HP800002 HP 364XL 750

magenta

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB320EE

PM375

300

galben

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

CB325EE

HP800003 HP 364XL 750

galben

'HVNMHW$2FHMHW3KRWRVPDUW%&'
6520/7510/7520

HP 364

HP 364

HP 364

COMAND
SPECIAL

08
CONSUMABILE IT

Cartue cu cerneal originale HP

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

343

consumabile IT

CONSUMABILE IT

08

Cartu original CZ109AE

Cartu original CZ110AE

Cartu original CZ111AE

Cartu original CZ112AE

QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
($,2
Cod: HP802800

QXPUSDJLQL
FXORDUHF\DQ
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
($,2
Cod: HP800301

QXPUSDJLQL
FXORDUHPDJHQWD
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
($,2
Cod: HP800402

QXPUSDJLQL
FXORDUHJDOEHQ
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
($,2
Cod: HP800503

Disponibile din stoc!

Cartue cu cerneal originale HP


Cod HP

Cod RTC

Nr. pagini*

Culoare

CZ101AE

HP802600 HP 650

Nr. cartu

360

negru

'HVNMHW,QN$GYDQWDJH

CZ102AE

HP800804 HP 650

200

color

'HVNMHW,QN$GYDQWDJH

NOU

CZ109AE

HP802800 HP 655

550

negru

'HVNMHW,QN$GYDQWDJH($,2

NOU

CZ110AE

HP800301 HP 655

600

cyan

'HVNMHW,QN$GYDQWDJH($,2

NOU

CZ111AE

HP800402 HP 655

600

magenta

'HVNMHW,QN$GYDQWDJH($,2

NOU

CZ112AE

HP800503 HP 655

600

galben

'HVNMHW,QN$GYDQWDJH($,2

CC653AE

PM248

CC654AE

PM2481

CC656AE

PM250
PM372

CD972AE

PM371

CD973AE

HP 920XL 700
HP 920XL 700
HP803000 HP 932XL 1000

CN053AE
CN054AE
CN055AE
CN056AE
NOU

C2P23AE

NOU

C2P24AE

NOU

C2P25AE

NOU

C2P26AE

Officejet 6000/6500/7000 series/7500


Officejet 6000/6500/7000 series/7500

negru

2FHMHWH3ULQWHU:)H3ULQWHUH$OO,Q2QH3UHPLXPH$OO,Q2QH

HP800501 HP 933XL 825


HP800502 HP 933XL 825

cyan

2FHMHWH3ULQWHU:)H3ULQWHUH$OO,Q2QH3UHPLXPH$OO,Q2QH

HP800603 HP 933XL 825


HP803600 HP 934XL 1000
HP800901 HP 935XL 825
HP800902 HP 935XL 825

C4908AE

PM382
PM383

HP 940XL 1400

CN625AE

Officejet 6000/6500/7000 series/7500

cyan

Officejet 6000/6500/7000 series/7500

HP801202
C4909AE
CN045AE

CN626AE

Officejet 4500, J4535/4580/4660/4680

negru
magenta

HP 940XL 1400
HP 940XL 1400

NOU

color

galben

PM381

NOU

Officejet 4500, J4535/4580/4660/4680


2FHMHW-6HULHV-6HULHV

PM369

C4906AE

CN048AE

negru
negru

PM370

C4907AE

CN047AE

NOU

HP 920XL 1200
HP 920XL 700

HP800903 HP 935XL 825


PM380
HP 940XL 2200

CN046AE

NOU

HP 901
200
HP 901XL 700
HP 901
360

CD975AE

CD974AE

magenta

2FHMHWH3ULQWHU:)H3ULQWHUH$OO,Q2QH3UHPLXPH$OO,Q2QH

galben

2FHMHWH3ULQWHU:)H3ULQWHUH$OO,Q2QH3UHPLXPH$OO,Q2QH

negru

Officejet Pro 6230/6830

cyan

Officejet Pro 6230/6830

magenta

Officejet Pro 6230/6830

galben

Officejet Pro 6230/6830

negru

2FHMHW3UR$$3OXV

cyan

2FHMHW3UR$$3OXV

magenta

2FHMHW3UR$$3OXV

galben

2FHMHW3UR$$3OXV

HP802500 HP 950XL 2300


HP800201 HP 951XL 1500
HP800202 HP 951XL 1500

negru

2FHMHW3URGZGZH3ULQWHU

cyan

2FHMHW3URGZGZH3ULQWHU

magenta

2FHMHW3URGZGZH3ULQWHU

HP800203 HP 951XL 1500


HP803400 HP 970XL 9200

galben

2FHMHW3URGZGZH3ULQWHU

negru

2FHMHW3UR;':;GZ;':;GZ

cyan

2FHMHW3UR;':;GZ;':;GZ

CN627AE

HP801301 HP 971XL 6600


HP801202 HP 971XL 6600

magenta

2FHMHW3UR;':;GZ;':;GZ

CN628AE

HP801303 HP 971XL 6600

galben

2FHMHW3UR;':;GZ;':;GZ

COMAND
SPECIAL

!
344

Echipamente compatibile

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT
Toner original TN-3230
QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH'&3''1
+/'/'1'1/7+/':'1
0)&'1'1'1':
Cod: BR810000

Toner original TN-2210


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH)D['&3''1':
+/''10)&1'1
Cod: BR810500

Cod Brother
TN-2000

Cod RTC
BRTN2000

Nr. pagini*

Culoare

Echipamente compatibile

2500

negru

'&3)$;+/'&30)&

TN-2010

BR810800

1000

negru

'&3+/

TN-1030

BR811400

1000

negru

'&3(+/(0)&(

Disponibile la comand special!

Tonere originale Brother

NOU

Cod Brother
DR-2000

Cod RTC
DP1016

12000

Nr. pagini*

Culoare
cilindru

'&3)$;+/'&30)&

DR-2200

BR811000

12000

cilindru

)D['&3(''1':+/:''1
0)&1'1

CONSUMABILE IT

Disponibile din stoc!

Tonere originale Brother

NOU

08

Echipamente compatibile

TN-2110

BRTN2110

1500

negru

NOU

TN-2120

BR811700

2600

negru

'&31+/1:0)&1:

NOU

TN-2210

BR810500

1200

negru

)D['&3''1':+/''10)&1'1

TN-2220

BR810600

2600

negru

+/0)&'&3

NOU

TN-3230

BR810000

3000

negru

'&3''1+/'/'1'1/7+/':'1
0)&'1'1'1':

TN-3280

BR810700

8000

negru

+/'&30)&

'&31+/0)&

Toner original TN-2120


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH'&31
+/1:0)&1:
Cod: BR811700

Toner original DR-2200


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH)D['&3(''1':
+/:''10)&1'1
Cod: BR811000

Disponibile la comand special!

Cartue cu cerneal originale Brother


Cod Brother
LC-123BK

Cod RTC
BR800300

Nr. pagini*

Culoare

Echipamente compatibile

600

negru

0)&-':-':-':-':-':

LC-123C

BR800401

600

cyan

0)&-':-':-':-':-':

LC-123M

BR800402

600

magenta

0)&-':-':-':-':-':

LC-123Y

BR800403

600

galben

0)&-':-':-':-':-':

LC-1240BK

BR800200

600

negru

'&3-0)&-

LC-1240C

BR800101

600

cyan

'&3-0)&-

LC-1240M

BR800102

600

magenta

'&3-0)&-

LC-1240Y

BR800103

600

galben

'&3-0)&-

LC-1280XLBK

BR800100

2400

negru

MFC J5910/6510/6710/6910

LC-1280XLC

BR800301

1200

cyan

MFC J5910/6510/6710/6910

LC-1280XLM

BR800302

1200

magenta

MFC J5910/6510/6710/6910

LC-1280XLY

BR800303

1200

galben

MFC J5910/6510/6710/6910

COMAND
SPECIAL

La comand
special putem
oferi orice model
de consumabil.
Pentru mai multe
detalii contacteaz
consultantul de
vnzri.

*numrul
de pagini
variazvariaz
n funcie
de tipul
printate
i de mediile
de printare
alese alese
*numrul
de pagini
n funcie
depaginilor
tipul paginilor
printate
i de mediile
de printare

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

345

consumabile IT

Toner original C-EXV40


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWHL5$,)
Cod: CN812700

CONSUMABILE IT

08
Disponibile din stoc!

Tonere originale Canon

NOU

Cod Canon
Cartridge T

Cod RTC
CN0032001

Nr. pagini*

Culoare

Echipamente compatibile

3000

negru

/3&'

C-EXV14

CN1002016

8300

negru

iR 2016/2018/2020/2022/2025/2030/2318/2320

C-EXV18

CN0018400

8400

negru

iR 1018/1020/1022/1023/1024/1025

C-EXV33

CN810300

14600

negru

iR 2520/2525/2530

C-EXV40

CN812700

6000

negru

L5$,)

CRG-703

CN20306

2500

negru

/%3

CRG-719

CN810000

2100

negru

L6(16<6/%3GQGQ0)GQGQGQGQ

CRG-719H

CN811000

6400

negru

L6(16<6/%3GQGQ0)GQGQGQGQ

CRG-725

CN811200

1600

negru

/%30)

CRG-728

CN810400

2100

negru

)D[/,6HQV\V0)

EP-27

CN20305

2500

negru

,PDJHFODVV0),6HQV\V/%30)

FX-10

CN1002005

2000

negru

)D[/,PDJHFODVV0)
,6HQV\V0)3&'

Toner original C-EXV37


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWHL5LL5LL5L
Cod: CN811500

Toner original CRG-737


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH0)0):0)10):
0)'10)':
Cod: CN813700

Disponibile la comand special!

Tonere originale Canon

NOU

NOU

Cod Canon
C-EXV3

Cod RTC
CN0220001

Nr. pagini*

Culoare

Echipamente compatibile

15000

negru

iR 2200/2220/2800/3220/3230/3300

C-EXV5

CN0160001

7800

negru

iR 1600/1610/1630/1670/2000/2010/210F

C-EXV11

CN022701

21000

negru

iR 2230/2270/2830/2870/3025/3030/3225

C-EXV37

CN811500

15100

negru

iR 1730i, iR 1740i, iR 1750i

CRG-712

CN20368

1500

negru

/%3

CRG-737

CN813700

2400

negru

0)0):0)10):0)'10)':

FX-3

CN1030001

2700

negru

Fax L200/220/240/250/260/280/290/295/300/350/3500IF/360/4000/4500IF/L60/90/95, Imageclass 1100,


Multipass L60/6000/90

COMAND
SPECIAL

!
346

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT
Disponibile din stoc!

Cod Canon
CL-41

Cod RTC
CN100011

Nr. pagini*

Culoare

Echipamente compatibile

155

color

Pixma MP140/150/160/170/180/190/210/220/450/460/470, MX300/310, Pixma IP 1200/1300/1600/1700/


1800/1900/2200/2400/2500/2600

CL-511

CN20374

240

color

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

CL-513

CN20375

349

color

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

CLI-8Bk

CN1002008

360

negru

3L[PD030;3UR0$5.,,,3
5100/5200/5300/6600/6700

CLI-8C

CN1002009

490

cyan

3L[PD030;3UR0$5.,,,3
5100/5200/5300/6600/6700

CLI-8M

CN1002010

490

magenta

3L[PD030;3UR0$5.,,,3
5100/5200/5300/6600/6700

CLI-8Y

CN1002011

490

galben

3L[PD030;3UR0$5.,,,3
5100/5200/5300/6600/6700

PG-40

CN100010

330

negru

Fax JX200/210/500/510, Pixma MP140/150/160/170/180/190/210/220/450/460/470, MX300/310, IP1200/


1300/1600/1700/1800/1900/2200/2400/2500/2600

PG-510

CN20373

220

negru

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

PG-512

CN20376

401

negru

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

PGI-5Bk

CN10028

490

negru

Pixma IX4000/5000, MP500/510/520/530/600/610/800/810/830/950/970, MX700/850, IP3300/3500/


4200/4300/4500/5100/5200/5300

Disponibile din stoc!

Riboane originale Epson


Cod Epson
7753/C13S015633

Cod RTC
EP999

Tip

Culoare

Echipamente compatibile

ribon

negru

/4

C13S015637

EP911

ribon

negru

);/;,,0;5;

8755

EP915

ribon

negru

/;);

ERC-38

EP933

ribon

negru

70888888

Cod: EP801601

Cod: EP801402

Cod: EP800700

Cod: EP800501

Cod: EP800602

Cod: EP800803

Disponibile la comand special!

Cartue cu cerneal originale Epson


Cod Epson
C13T67314A

Cod RTC
EP801100

Tip

Culoare

cartu cu cerneal

negru

L800

C13T67324A

EP801201

cartu cu cerneal

cyan

L800

Echipamente compatibile

C13T67334A

EP801302

cartu cu cerneal

magenta

L800

C13T67344A

EP801103

cartu cu cerneal

galben

L800

C13T67354A

EP801601

cartu cu cerneal

light cyan

L800

C13T67364A

EP801402

cartu cu cerneal

light magenta

L800

C13T66414A

EP800700

cartu cu cerneal

negru

L100/200, L110/210/300/355/550

C13T66424A

EP800501

cartu cu cerneal

cyan

L100/200, L110/210/300/355/550

C13T66434A

EP800602

cartu cu cerneal

magenta

L100/200, L110/210/300/355/550

C13T66444A

EP800803

cartu cu cerneal

galben

L100/200, L110/210/300/355/550

COMAND
SPECIAL

08
CONSUMABILE IT

Cartue cu cerneal originale Canon

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

347

consumabile IT

CONSUMABILE IT

08

Toner original 60F2H00


QXPUSDJLQL
FXORDUHQHJUX
Cod: LX813900

Toner original 60F2000


QXPUSDJLQL
FXORDUHQHJUX
Cod: LX814000

Tonere originale Lexmark

Disponibile la comand special!

Cod Lexmark
12016SE
NOU

Cod RTC
FK033

Nr. pagini*

Culoare

Echipamente compatibile

2500

negru

E120

24016SE

FK024

2500

negru

E232/E240/E330/E332/E340/E342

50F2000

LX815000

1500

negru

06''106''106'106'('1'7(

NOU

50F2H00

LX814500

5000

negru

06''106''106'106'('1'7(

NOU

50F2X00

LX814400

10000

negru

06''106'106'('1'7(

NOU

60F2000

LX814000

2500

negru

0;'10;'(0;'(0;'('+('7(0;'('+(

NOU

60F2H00

LX813900

10000

negru

0;'10;'(0;'(0;'('+('7(0;'('+(

64016HE

FK64016H

21000

negru

T640/T642/T644

64016SE

FK64016S

6000

negru

T640/T642/T644

E250A11E

FK424

3500

negru

(''1('('1

E260A11E

FK183

3500

negru

E260/E360/E460//E462

X264A11G

LX810400

3500

negru

X264/X363/X364

X340A11G

FK034

2500

negru

X340/X342

NOU

Toner original MLT-D101S


QXPUSDJLQL
FXORDUHQHJUX
Cod: SM811000

Toner original MLT-D116S


QXPUSDJLQL
FXORDUHQHJUX
Cod: SM812200

Toner original MLT-D1092S


QXPUSDJLQL
FXORDUHQHJUX
Cod: SMS210

Disponibile din stoc!

Tonere originale Samsung


&RG6DPVXQJ
MLT-D101S

Cod RTC
SM811000

Nr. pagini*

Culoare

Echipamente compatibile

1500

negru

0/6&;6)3

MLT-D1042S

SM810800

1500

negru

0/6&;

MLT-D1052L

SM810000

2500

negru

0/6&;6)

MLT-D119S

SM812300

2000

negru

0/16&;)

Disponibile la comand special!

Tonere originale Samsung


NOU

&RG6DPVXQJ
MLT-D103L

Cod RTC
SM811500

Nr. pagini*

Culoare

Echipamente compatibile

2500

negru

0/1'0/':1'6&;1'6&;)'6&;)'6&;)'
6&;):
0/6&;

MLT-D103S

SM811400

1500

negru

NOU

MLT-D111S

SM812600

1000

negru

;35(666/0:;35(666/0))::

NOU

MLT-D116S

SM812200

1200

negru

6/0'6/0))16/0':1'6/0)'):1'6/0):

NOU

MLT-D116L

SM812400

3000

negru

6/0'6/0))16/0':1'6/0)'):1'6/0):

MLT-D1052S

SM810100

1500

negru

0/6&;6)

MLT-D1082S

SM811700

1500

negru

0/

NOU

MLT-D1092S

SMS210

2000

negru

6&;

NOU

MLT-D203L

SM813900

5000

negru

6/01'6/0)'6/0'':1'6/0)'):6/01'
6/0)5);

NOU

MLT-D203S

SM813600

3000

negru

6/01'6/0)'6/0'':1'6/0)'):6/01'
6/0)5);

MLT-D2092L

SMS142

5000

negru

0/6&;

!
348

Toner original MLT-D203L


QXPUSDJLQL
FXORDUHQHJUX
Cod: SM813900

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT
Toner original 101R00474
QXPUSDJLQL
FXORDUHFLOLQGUX
HFKLSDPHQWH3KDVHU
:RUN&HQWUH
Cod: XC819400

Toner original 108R00796


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH3KDVHU
Cod: XC813300

08
Tonere originale Xerox
Cod Xerox
006R01179

Cod RTC
XC1062

Nr. pagini*

Culoare

Echipamente compatibile

11000

negru

:RUN&HQWUH&0L

negru

&RS\FHQWUH&&:RUN&HQWUH000:RUN&HQWUH3UR

006R01182

XC1090

30000

013R00589

XC1048

60000

013R00621

XC1085

3000

106R01159

XC1004

3000

negru

Phaser 3117/3122/3124/3125

106R01277

XC4029

6300

negru

:RUN&HQWUH
:RUN&HQWUH

cilindru
negru

106R01487

XC810800

4100

negru

106R01531

XC813700

11000

negru

:RUN&HQWUH

106R02180

XC812200

1000

negru

3KDVHU:RUN&HQWUH

109R00746

XC1010

3500

negru

Phaser 3150

Toner original 106R01485


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH:RUN&HQWUH
Cod: XC811600

Toner original 106R01379


QXPUSDJLQL
FXORDUHQHJUX
HFKLSDPHQWH3KDVHU
Cod: XC814700

Disponibile la comand special!

Tonere originale Xerox


Cod Xerox
013R00606
NOU

NOU

NOU

:RUN&HQWUH&00
:RUN&HQWUH3(

Cod RTC
XC1089

Nr. pagini*

Culoare

Echipamente compatibile

5000

negru

:RUN&HQWUH3(3(L

negru

:RUN&HQWUH

013R00625

XC1087

3000

101R00432

XC4030

22000

cilindru

:RUN&HQWUH

101R00434

XC816700

50000

cilindru

:RUN&HQWUH

101R00474

XC819400

10000

cilindru

3KDVHU:RUN&HQWUH

106R01379

XC814700

5000

negru

Phaser 3100

106R01413

XC810000

20000

negru

:RUFN&HQWUH

106R01485

XC811600

2000

negru

:RUN&HQWUH

106R01634

XC815300

2000

negru

3KDVHU:RUN&HQWUH

106R02182

XC814800

2200

negru

3KDVHU:RUN&HQWUH

106R02760

XC812701

1000

cyan

3KDVHU:RUN&HQWUH

NOU

106R02761

XC812702

1000

magenta

3KDVHU:RUN&HQWUH

NOU

106R02762

XC812703

1000

galben

3KDVHU:RUN&HQWUH

NOU

106R02763

XC819500

2000

negru

3KDVHU:RUN&HQWUH

NOU

106R02778

XC819600

3000

negru

3KDVHU:RUN&HQWUH

NOU

106R02782

XC819700

6000

negru

3KDVHU:RUN&HQWUH

NOU

108R00796

XC813300

10000

negru

Phaser 3635

108R00909

XC811400

2500

negru

Phaser 3140/3155/3160

109R00725

XC1056

3000

negru

Phaser 3130

113R00730

XC012

3000

negru

Phaser 3200 MFP

COMAND
SPECIAL

CONSUMABILE IT

Disponibile din stoc!

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

*numrul de pagini variaz n funcie de tipul paginilor printate i de mediile de printare alese

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

349

consumabile IT

Cod: AJ810502

Cod: AJ810500

Cod: AJ810503

Cod: AJ810601

08
CONSUMABILE IT

Cod: AJ810600

Cod: AJ810602

Cod RTC
AJ811700

Culoare

Echipamente compatibile

negru

Laserjet 1000/1005/1200/1220/3300 Multifunction/3380

C7115X

AJ811800

negru

Laserjet 1200/1220/3300 Multifunction/3380

CB435A

AJ811500

negru

Laserjet P1005/P1006

CB436A

AJ810200

negru

Laserjet P1505/N, M1120, M1522MFP

CB540A

AJ812200

negru

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB541A

AJ810301

cyan

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB542A

AJ810203

galben

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CB543A

AJ810202

magenta

Color Laserjet CM1312mfp/CP1215/CP1515/CP1518

CC364X

AJ812100

negru

Laserjet P4015/P4515

CC530A

AJ811100

negru

Color Laserjet CP2025/CM2320

CC531A

AJ810001

cyan

Color Laserjet CP2025/CM2320

CC532A

AJ810003

galben

Color Laserjet CP2025/CM2320

CC533A

AJ810002

magenta

Color Laserjet CP2025/CM2320

CE255A

AJ810700

negru

Laserjet P3015

CE278A

AJ810000

negru

Laserjet Pro P1566, Laserjet P1606, Laserjet Pro M1536dnf

CE285A

AJ810300

negru

Laserjet P1102/Pro M1212nf MFP/M1217nfw MFP/M1132/M1214

CE400X

AJ813300

negru

Laserjet Enterprise 500 color M551n

CE401A

AJ810501

cyan

Laserjet Enterprise 500 color M551n

CE402A

AJ810403

galben

Laserjet Enterprise 500 color M551n


Laserjet Enterprise 500 color M551n

CE403A

AJ810402

magenta

NOU

CE410X

AJ816200

negru

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

NOU

CE411A

AJ810701

cyan

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

NOU

CE412A

AJ810703

galben

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

NOU

CE413A

AJ810602

magenta

Laserjet Pro Color M451 MFP/M351 MFP/M475 MFP/M375 MFP

CE505A

AJ810500

negru

Laserjet P2035/P2055

CE505X

AJ810600

negru

Laserjet P2055d/dn

NOU

CF210X

AJ815700

negru

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

NOU

CF211A

AJ810601

cyan

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

NOU

CF212A

AJ810503

galben

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

NOU

CF213A

AJ810502

magenta

Laserjet Pro 200 color M251n/nw/MFP M276n/nw

CF280A

AJ811300

negru

Laserjet M425, Laserjet Pro 400 M401/425

CF280X

AJ811400

negru

Laserjet Pro 400 M401/Pro 400 MFP M425

CF283A

AJ816700

negru

LaserJet Pro MFP M125/M127 series, LaserJet Pro M201n/dw, LaserJet Pro MFP M225dn/dw

Q2612A

AJ810100

negru

Laserjet 1010/1012/1015/1018/1020/1022/3015/3020/3030/3050/3052/3055/M1005mfp/M1319mfp

Q5949A

AJ810900

negru

Laserjet 1160/1320/3390/3392

Q5949X

AJ811000

negru

Laserjet 1320/3390/3392

Q6000A

AJ811900

negru

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q6001A

AJ810201

cyan

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q6002A

AJ810103

galben

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q6003A

AJ810102

magenta

Color Laserjet 1600/2600n/2605/CM1015mfp/CM1017mfp

Q7553A

AJ811200

negru

Laserjet P2014/P2015/M2727mfp

Q7553X

AJ810400

negru

Laserjet P2014/P2015/M2727mfp

NOU

COMAND
SPECIAL

350

Cod: AJ810703

Disponibile din stoc!

Tonere compatibile HP
Cod Original
C7115A

Cod: AJ810701

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

consumabile IT
Cartu original CZ101AE

Cartu original CZ102AE

FXORDUHQHJUX
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
Cod: AJ801500

FXORDUHFRORU
HFKLSDPHQWH'HVNMHW,QN$GYDQWDJH
Cod: AJ801004

Disponibile din stoc!

Cod Original
51645AE

Cod RTC
AJ800000

Culoare

Echipamente compatibile

negru

'HVNMHW2FHMHW3UR3KRWRVPDUW

C4906AE

AJ800100

negru

2FHMHW3UR$$3OXV

C4907AE

AJ800001

cyan

2FHMHW3UR$$3OXV

C4908AE

AJ800002

magenta

2FHMHW3UR$$3OXV

C4909AE

AJ800003

galben

2FHMHW3UR$$3OXV

C6578D

AJ800004

color

'HVNMHW36&3KRWRVPDUW

C6656AE

AJ800200

negru

'HVNMHW)2FHMHW3KRWRVPDUW

C6657AE

AJ800104

color

'HVNMHW)2FHMHW3KRWRVPDUW

C8727AE

AJ800300

negru

'HVNMHW2FHMHW36&

C8728AE

AJ800204

color

'HVNMHW2FHMHW36&

C9351AE

AJ800400

negru

'HVNMHW)')2FHMHW-

C9352AE

AJ800604

color

'HVNMHW)')2FHMHW-

CC640EE

AJ800500

negru

'HVNMHW')))3KRWRVPDUW&(QY\

CC643EE

AJ800304

color

'HVNMHW')))3KRWRVPDUW&(QY\

CC654AE

AJ800700

negru

2FHMHW-6HULHV-6HULHV

CC656AE

AJ800404

color

Officejet 4500, J4535/4580/4660/4680

CD972AE

AJ800101

cyan

Officejet 6000/6500/7000 series/7500

CD973AE

AJ800102

magenta

Officejet 6000/6500/7000 series/7500

CD974AE

AJ800103

galben

Officejet 6000/6500/7000 series/7500

CD975AE

AJ800800

negru

Officejet 6000/6500/7000 series/7500

CH563EE

AJ800900

negru

'HVNMHW

CH564EE

AJ800504

color

'HVNMHW

NOU

CZ101AE

AJ801500

negru

'HVNMHW,QN$GYDQWDJH

NOU

CZ102AE

AJ801004

color

'HVNMHW,QN$GYDQWDJH

Disponibile din stoc!

Consumabile compatibile Canon


Cod Original
C-EXV14

Cod RTC
AJ813400

negru

iR 2016/2018/2020/2022/2025/2030/2318/2320

FX-10

AJ813500

negru

)D[/,PDJHFODVV0),6HQV\V0)
3&'

CRG-728

AJ813600

negru

)D[/,6HQV\V0)

Cartridge T

AJ813700

negru

/3&'

EP-27

AJ813800

negru

,PDJHFODVV0),6HQV\V/%30)

CL-41

AJ800804

color

Pixma MP140/150/160/170/180/190/210/220/450/460/470, MX300/310, Pixma IP 1200/1300/1600/1700/1800/1900/


2200/2400/2500/2600

Culoare

Echipamente compatibile

CL-511

AJ800704

color

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

PG-40

AJ801000

negru

Fax JX200/210/500/510, Pixma MP140/150/160/170/180/190/210/220/450/460/470, MX300/310, IP1200/1300/1600/


1700/1800/1900/2200/2400/2500/2600

PG-510

AJ801100

negru

Pixma MP240/250/260/270/280/480/490, MX320/330/340/350/360/410/420, IP2700

Disponibile din stoc!

Alte consumabile compatibile


Brand
Brother

Cod Original
TN-2000

Cod RTC
AJ813900

Culoare

Echipamente compatibile

negru

'&3)$;+/'&30)&

6DPVXQJ

MLT-D1052L

AJ814000

negru

0/6&;6)

6DPVXQJ

MLT-D2092L

AJ814100

negru

0/6&;
:RUN&HQWUH

Xerox

106R01487

AJ814200

negru

Xerox

109R00747

AJ814300

negru

Phaser 3150

Xerox

106R01159

AJ814400

negru

Phaser 3117/3122/3124/3125

COMAND
SPECIAL

08
CONSUMABILE IT

Cartue cu cerneal compatibile HP

La comand special putem oferi orice model de consumabil.


Pentru mai multe detalii contacteaz consultantul de vnzri.

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

351

CONSUMABILE IT

08

AI NCREDERE N ACTIVEJET

CERNEAL I TONER
activejet.com

9. Mobilier
managerial office

354

dulapuri metalice

368

sal de conferine

356

clasificatoare i vestiare

370

recepie

358

sisteme de arhivare i cuiere

371

serviciu suport clieni

360

seifuri

372

contabilitate

362

fotolii directoriale

374

home & office

363

scaune operaionale

376

mobil configurabil

364

scaune vizitator

379

birouri i mese de conferin

365

mobilier horeca

381

office line

366

accesorii mobilier

382

Managerial Office
Componentele modulare ale biroului, scaunele pentru vizitatori, elementele de depozitare, masa de conferin, toate ntr-o gam variat de culori i
finisaje, te ajut s dai o not elegant biroului tu. Gama Managerial Office ofer soluia ideal pentru amenajarea biroului.

354

COMAND
SPECIAL

Mobilier disponibil la comand special. Pentru detalii


suplimentare, contacteaz consultantul tu de vnzri.

Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
 cant ABS
 metal

VFKHOHWPHWDOLF

VLVWHPGHSULQGHUHFX/PHWDOLF

VLVWHPGHQFKLGHUHFX\DO

SUL]DVFXQV

PAL melaminat
PRVWUHFXORUL

wenge

mesteacn

calvados

nuc

Finisaje
aluminiu

355

Sal de conferine
Fiind una dintre cele mai importante zone din cadrul unui birou, o atenie deosebit trebuie acordat nivelului de confort. n acest sens, propunem
orientarea ctre un design simplu, aerisit, eficientizat prin mobilier modular i sisteme de depozitare.

356

COMAND
SPECIAL

Mobilier disponibil la comand special. Pentru detalii


suplimentare, contacteaz consultantul tu de vnzri.

Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
 cant ABS
 metal

GXODSFXXLSHQWUXGRFXPHQWH

PDVGHFRQIHULQ

PAL melaminat
PRVWUHFXORUL

wenge

mesteacn

calvados

nuc

Finisaje
aluminiu

357

Recepie
Este o component important a imaginii companiei, cu un impact considerabil. Produsele care alctuiesc aceast seciune sunt ideale pentru organizarea
spaiului de lucru (att pe orizontal, ct i pe nlime) i asigur un nivel ridicat de operativitate i discreie.

358

COMAND
SPECIAL

Mobilier disponibil la comand special. Pentru detalii


suplimentare, contacteaz consultantul tu de vnzri.

Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
 cant ABS
 metal

ELURXFXVFKHOHWPHWDOLF

VLVWHPGHSULQGHUHFX/PHWDOLF

PAL melaminat
PRVWUHFXORUL

wenge

mesteacn

calvados

nuc

Finisaje
aluminiu

359

Serviciu suport clieni


Produsele din aceast categorie faciliteaz interaciunea dintre angajat i client, crend o atmosfer propice comunicrii. Elementele care compun
DFHDVWDULH ELURXUL/VKDSHSLHGHVWDOXULSDQRXULGHGLVFUHLHVLVWHPHGHGHSR]LWDUHLGHDVFXQGHUHDFDEOXULORU VHDGDSWHD]DFWLYLWLLGHVIXUDWH
HFKLSDPHQWHORUIRORVLWHLVSDLXOXLSXVODGLVSR]LLH*DPDEHQHFLD]GHGLYHUVLWDWHQPDWHULHGHQLVDMHLSDOHWFRORULVWLF

360

COMAND
SPECIAL

Mobilier disponibil la comand special. Pentru detalii


suplimentare, contacteaz consultantul tu de vnzri.

Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
 cant ABS
 metal

SUL]DVFXQV

GXOSLRUPRELO

ELURXHUJRQRPLF

VWUXFWXUPHWDOLF

PAL melaminat
PRVWUHFXORUL

wenge

mesteacn

calvados

nuc

Finisaje
aluminiu

361

Contabilitate
Elementele componente pentru acest tip de activitate sunt caracterizate prin discreie i funcionalitate, utiliznd n mod inteligent ntreg spaiul
disponibil. Produsele ncorporate n aceast gam (biroul rectangular cu cable management, panoul de plut care servete drept panou de discrecie,
sistemele de depozitare) pot fi realizate din pal melaminat de diferite culori.
Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
COMAND
Mobilier disponibil la comand special. Pentru detalii
SPECIAL
 cant ABS
suplimentare, contacteaz consultantul tu de vnzri.
 metal

PAL melaminat
PRVWUHFXORUL

wenge

ELURXHUJRQRPLF
destinat utilizrii
intense

GXODSFXGRXXL
pentru documente,
QFKLGHUHFX\DO

SDQRXGHVSULWRU
cu suprafa pentru
prinderea documentelor

mesteacn

calvados

Finisaje
aluminiu

362

nuc

Home & Office


Cu un design simplu, dar de efect, gama Express Home & Office poate fi utilizat cu succes i n amenajarea biroului de acas, pstrnd aspectul
confortabil, dar n acelai timp profesionist.
Elementele de mobilier pot fi combinate conform preferinelor utilizatorului, obinnd un spaiu folosit n mod eficient, ntr-o atmosfer relaxat.
Materiale folosite:
 PAL melaminat, 18 mm i 25 mm grosime
 cant PVC 2 mm
COMAND
Mobilier disponibil la comand special. Pentru detalii
SPECIAL
 cant ABS
suplimentare, contacteaz consultantul tu de vnzri.
 metal

PAL melaminat
PRVWUHFXORUL

wenge

mesteacn

calvados

nuc

Finisaje
HWDMHUFUL

SLFLRUXH
reglabile

GXOSLRUPRELO
3 sertare

aluminiu

363

Mobil configurabil
Acum i poi configura n diverse combinaii i dimensiuni
biroul, masa de conferin sau de cafea, exact cum i doreti!

wenge

COMAND
SPECIAL

GARANIE

mesteacn

calvados

nuc

negru

Mobilier disponibil la comand special. Pentru detalii


suplimentare, contacteaz consultantul tu de vnzri.

Mese de cafea
Blat rotund

Blat dreptunghiular

Blat ptrat

Cod
OF1001x

Cod
OF1101x

Dimensiuni (cm)

Cod
OF1201x

Dimensiuni (cm)

40 x 60

OF1102x

60 x 80

OF1202x

80 x 80

OF1103x

60 x 100

OF1203x

100 x 100

OF1002x
OF1003x

Dimensiuni (cm)

60
80
100

60 x 60

[FXORDUHQHJUX wenge, 10- mesteacan, 11- calvados, 12- nuc

364

Cod
Dimensiuni (cm)
OF09010y 76 x 52.5 x 75

Cod
Dimensiuni (cm)
OF09020y 70 x 50 x 72

Cod
Dimensiuni (cm)
OF09030y 76 x 52 x 72

Cod
Dimensiuni (cm)
OF09040y 76 x 47 x 72

Cod
Dimensiuni (cm)
OF09050y 76 x 54 x 72

Cod
Dimensiuni (cm)
OF09060y 76 x 35 x 45

Cod
Dimensiuni (cm)
OF09070y 76 x 38 x 72

Cod
Dimensiuni (cm)
OF09080y 76 x 54 x 110

Cod
Dimensiuni (cm)
OF09090y 76 x 56 x 72

Cod
Dimensiuni (cm)
OF31010y 60 x 75

\FXORDUH aluminiu satinat, 9- crom

Birouri i mese de conferin


Cu un design simplu, dar de efect, gama de blaturi i cadre metalice poate fi utilizat cu succes n amenajarea biroului tu ntr-un mod profesionist.
Elementele de mobilier pot fi combinate conform preferinelor utilizatorului, obinnd un spaiu de lucru cu o atmosfer relaxant.
Pentru detalii i configuraii suplimentare, apeleaz la specialistul RTC.

Blaturi i extensii
Dreptunghiular

Semirotund

Semirotund

Rotunjit la coluri

Cod
OF1301x

Dimensiuni (cm)

Cod
OF1401x

Dimensiuni (cm)

120 x 80

Cod
OF1601x

Dimensiuni (cm)

120 x 80

Cod
OF1501x

Dimensiuni (cm)

120 x 80

OF1302x

140 x 80

OF1402x

140 x 80

OF1502x

140 x 80

OF1602x

140 x 80

OF1303x

160 x 80

OF1403x

160 x 80

OF1503x

160 x 80

OF1603x

160 x 80

Form L

Ergonomic

Cod
OF1701x

Dimensiuni (cm)

Cod
OF1801x

Dimensiuni (cm)

120 x 80 x 80

OF1702x

140 x 80 x 80

OF1802x

140 x 80

OF1703x

160 x 80 x 80

OF1803x

160 x 80

120 x 80

Extensie triunghiular

Cod
OF1901x

Dimensiuni (cm)
80 x 80

120 x 80

Extensie semirotund

Cod
OF2001x

Dimensiuni (cm)
70 x 80

[FXORDUHQHJUX wenge, 10- mesteacan,


11- calvados, 12- nuc

Cadre metalice

Cod
OF21010y

Dimensiuni (cm)

Cod
OF22010y

Dimensiuni (cm)

120 x 80 x 72

Cod
OF24010y

Dimensiuni (cm)

120 x 80 x 72

Cod
OF23010y

Dimensiuni (cm)

100 x 80 x 72

OF21020y

120 x 80 x 72

OF22020y

140 x 80 x 72

OF23020y

140 x 80 x 72

OF24020y

140 x 80 x 72

OF22030y

160 x 80 x 72

OF23030y

160 x 80 x 72

OF24030y

160 x 80 x 72

120 x 80 x 72

Cod
OF25010y

Dimensiuni (cm)

Cod
OF26010y

Dimensiuni (cm)

120 x 80 x 62-82

Cod
OF28010y

Dimensiuni (cm)

80 x 80 x 72

Cod
OF27010y

Dimensiuni (cm)

120 x 80 x 72

OF25020y

140 x 80 x 72

OF26020y

100 x 100 x 72

OF27020y

140 x 80 x 62-82

OF28020y

140 x 80 x 72

OF25030y

160 x 80 x 72

OF26030y

120 x 120 x 72

OF27030y

160 x 80 x 62-82

OF28030y

160 x 80 x 72

Cod
OF29010y

Dimensiuni (cm)

Cod
OF30010y

Dimensiuni (cm)

120 x 80 x 72

OF29020y

140 x 80 x 72

OF30020y

140 x 80 x 72

OF29030y

160 x 80 x 72

OF30030y

160 x 80 x 72

120 x 80 x 72

120 x 80 x 72

[FXORDUH aluminiu satinat, 9- crom

365

office line

SFATUL SPECIALISTULUI
CTEVA TRUCURI PENTRU UN SPAIU DE LUCRU PRIMITOR,
N CARE S I FAC PLCERE S LUCREZI!
1. Calculatorul este recomandat s fie poziionat n partea de nord sau de vest, ca s i stimuleze creativitatea.
2.8DGHODLQWUDUHWUHEXLHVVHGHVFKLGODUJIUSUREOHPHLVQXQWPSLQHQLFLXQREVWDFROFDUHDUSXWHDVWDQFDOHD
creativitii, productivitii i clienilor.
3. Masa din sala de ntlniri este recomandat s fie rotund sau oval pentru a stimula gsirea de soluii, negocierea i
comunicarea.
4. Biroul tu ar fi bine s fie poziionat n partea opus a intrrii, s poi vedea cine intr, dar nu pe aceeai linie cu ua.
'HDVHPHQHDHVWHELQHVDLQVSDWHXQSHUHWHVDXRSLHVGHPRELOLHUSHQWUXVXVLQHUH
5.(VWHLQGLFDWVDLRSODQWYLHSHELURXXQJKLYHFLFXRULFHRDUHSUHIHUL$FHDVWDDEVRDUEHWR[LQHOHGLQDHULL
nveselete spaiul de lucru.
6. Nu lsa cablurile ntinse pe jos sau ncurcate.
7. Pentru mai mult bun dispoziie atunci cnd intri n birou, amenajeaz mai vizibil i mai plcut colul pe care l vezi
prima dat cnd intri n ncpere.

MOBILIER

09

GARANIE

Caracteristici:
%ODWPPGLQPHODPLQ ODYDELOUH]LVWHQWOD]JULHWXULQHUHHFWRUL]DQW PDUJLQLGHSURWHFLH$%6GUHSWPPDQWLRF
3DQRXULSLFLRDUHPPGLQPHODPLQ ODYDELOUH]LVWHQWOD]JULHWXULQHUHHFWRUL]DQW PDUJLQL$%6GUHSWPPDQWLRF
3D]LHGLQPHODPLQ ODYDELOUH]LVWHQWOD]JULHWXULQHUHHFWRUL]DQW
'LPHQVLXQLOHVXQWH[SULPDWHQFHQWLPHWULLUHSUH]LQWOXQJLPH[OLPH[QOLPH
*DUDQLDDFRUGDWSURGXVHORUHVWHGHDQLSHQWUXXWLOL]DUHDQFRQGLLLRSWLPH

Opiuni culori OFFICE LINE


6- stejar / negru

7 - negru

Birouri
Cod
OF1006

Culoare
stejar/negru

Dimensiuni (cm)
120 x 60 x 75

OF1206

stejar/negru

120 x 80 x 75

OF1406

stejar/negru

140 x 80 x 75

OF1606

stejar/negru

160 x 80 x 75

OF1806

stejar/negru

180 x 80 x 75

Mas de conferin
Pazie din melamin.

366

Cod
OF1996

Culoare

Dimensiuni (cm)

stejar/negru

200 x 80 x 75

OF1997

negru

200 x 80 x 75

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

office line

Mas
calculator

Dulpior mobil

'RXSROLHFXOLVDQWHGXOSLRULORFSHQWUXXQLWDWHDFHQWUDO

QFKLGHUHFHQWUDOL]DWWUHLVHUWDUHHJDOH

Cod
OF1936

Culoare

Dimensiuni (cm)

Cod

Culoare

Dimensiuni (cm)

stejar/negru

120 x 60 x 75

OF3006

stejar/negru

43 x 52 x 67

OF1937

negru

120 x 60 x 75

OF3007

negru

43 x 52 x 67

1XLQFOXGH\DO
Se poate aduga
opional.

1XLQFOXGH\DO
Se poate aduga
opional.

Dulap cu o poli

Dulap cu dou polie

O poli fix.
Cod
OF3086

MOBILIER

09

O poli fix i una variabil pe nlime.


Culoare

Dimensiuni (cm)

stejar/negru

80 x 36 x 78

Cod
OF3286

Culoare

Dimensiuni (cm)

stejar/negru

80 x 36 x 115

1XLQFOXGH\DO
Se poate aduga
opional.

Dulap cu patru polie

Etajer cu patru polie

O poli fix i trei variabile pe nlime.

O poli fix i trei variabile pe nlime.

Cod
OF3886

Culoare

Dimensiuni (cm)

Dimensiuni (cm)

80 x 36 x 185

Cod
OF3896

Culoare

stejar/negru

stejar/negru

80 x 36 x 185

OF3887

negru

80 x 36 x 185

OF3897

negru

80 x 36 x 185

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

367

dulapuri metalice
Dulapuri metalice cu ui culisante
'XODSIDEULFDWGLQWDEOVXGDWGHJURVLPHPP
Capacitate de ncrcare pe poli: 60 kg.
Posibilitate ajustare poli pe nlime: 21 mm.
Vopsit n cmp electrostatic, cu vopsea rezistent la coroziune. Culoare: gri.
Dimensiuni (L x A x H mm)

Numr rafturi

1200 x 420 x 1200

CHD195

1200 x 420 x 1950

MOBILIER

09

Cod
CHD120

GARANIE

SUPER
CALITATE

CHD195

CHD195

Dulapuri metalice cu ui batante


'XODSIDEULFDWGLQWDEOVXGDWGHJURVLPHPP
Ui ranforsate cu amortizoare pentru zgomot.
Capacitate de ncrcare pe poli: 45 kg.
Posibilitate ajustare poli pe nlime: 36 mm.
Vopsit n cmp electrostatic, cu vopsea rezistent la coroziune. Culoare: gri.

CH308

368

Cod
CH075

Dimensiuni (L x A x H mm)

Numr rafturi

800 x 380 x 750

CH120

920 x 420 x 1200

CH308

920 x 420 x 1945

CH120

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

GARANIE

SUPER
CALITATE

CH075

dulapuri metalice
include seif
cu ncuietoare

MOBILIER

09

GARANIE

SUPER
CALITATE

Dulap metalic cu seif


'XODSIDEULFDWGLQWDEOVXGDWGHJURVLPHPP8LUDQIRUVDWHSUHY]XWH
cu amortizor pentru zgomot. Vopsit n cmp electrostatic, cu vopsea rezistent la
coroziune. Culoare: gri.
Cod
CHB195

GARANIE

SUPER
CALITATE

Dulap metalic cu ui pliabile

'XODSIDEULFDWGLQWDEOVXGDWGHJURVLPHPP8LFHVHSRWGHVFKLGHFWUH
LQWHULRUODrSUHY]XWFXDPRUWL]RUSHQWUX]JRPRW'RX\DOHSHGXODSFWH
XQDSHHFDUHXFXFKHLLQGLYLGXDOH&DSDFLWDWHGHQFUFDUHSHSROLNJ
Posibilitate ajustare poli pe nlime: 36 mm. Vopsit n cmp electrostatic,
cu vopsea rezistent la coroziune.
Culoare: gri.
Cod
CHK100

Dimensiuni (L x A x H mm)

Numr rafturi

Dimensiuni (L x A x H mm)

1200 x 420 x 1000

920 x 420 x 1945

CHK195

1200 x 420 x 1950

GARANIE

GARANIE

SUPER
CALITATE

Dulap metalic pentru haine

Dulap metalic cu ui batante

'XODSIDEULFDWGLQWDEOVXGDWGHJURVLPHPP8LUDQIRUVDWHSUHY]XWH
cu amortizor pentru zgomot. Vopsit n cmp electrostatic, cu vopsea rezistent la
coroziune. Culoare: gri.

)DEULFDWGLQWDEOGHRHOFXORDUHJUL5$/&DSDFLWDWHDGHQFUFDUHSHSROLHVWH
GHNJXQLIRUPGLVWULEXLWH'RXXLEDWDQWHFXFKHLHSDWUXSROLHUHJODELOHSH
nlime, patru accesorii din plastic pentru picioare.

Cod
CHM195

Dimensiuni (L x A x H mm)
920 x 500 x 1950

Cod
TH308

Oricare ar fi meseria ta, avem produsul potrivit.

Dimensiuni (L x A x H mm)
1830 x 800 x 440

369

clasificatoare i vestiare

capacitate: 100 dosare /sertar


sistem* anti-tilt

09

sistem* anti-tilt

GARANIE

GARANIE

MOBILIER

SUPER
CALITATE

SUPER
CALITATE

*nu permite deschiderea simultan a dou sau mai multor sertare,


astfel nct se evit rsturnarea clasificatorului

Clasificator metalic dublu

*nu permite deschiderea simultan a dou sau mai multor sertare,


astfel nct se evit rsturnarea clasificatorului

Clasificator metalic

)DEULFDWGLQWDEOVXGDWGHJURVLPHPP&DSDFLWDWHGHQFUFDUH
sertar: 100 dosare. Sistem de amortizare a zgomotului.
Vopsit n cmp electrostatic, cu vopsea rezistent la coroziune.
Rezisten crescut la uzur. Culoare: gri.

)DEULFDWGLQWDEOVXGDWGHJURVLPHPP&DSDFLWDWHGHQFUFDUHSHVHUWDU
45-50 dosare. Sistem de amortizare a zgomotului. Vopsit n cmp electrostatic,
cu vopsea rezistent la coroziune. Culoare: gri.

Cod
CH110010

Dimensiuni (L x A x H mm)

Numr sertare

Numr sertare

Cod
CH306

Dimensiuni (L x A x H mm)

840 x 620 x 1020

463 x 620 x 1022

CH110011

840 x 620 x 1330

CH305

463 x 620 x 1328

GARANIE

SUPER
CALITATE

CH310

CH304

Vestiare metalice
)DEULFDWHGLQWDEOVXGDWGHJURVLPHPP9RSVLWHQFPSHOHFWURVWDWLFFX
vopsea rezistent la coroziune. Culoare: gri. Yal individual pentru fiecare u.

370

CH311
Cod
CH304

Dimensiuni (L x A x H mm)

Numr de ui

590 x 500 x 1800

CH310

870 x 500 x 1800

CH311

1185 x 500 x 1945

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

sisteme de arhivare i cuiere


2

GARANIE

SUPER
CALITATE

70 kg

09
MOBILIER

GARANIE

CHT801

CHT802

Coloan rotativ pentru bibliorafturi

Raft pentru depozitare

Posibilitate de adugare de nivele suplimentare. Structur din oel, cu plci realizate


din PFL laminat, cu margini de protecie de PVC. Capacitatea maxim a unei etajere
este de 24 bibliorafturi.
Cod
CHT801

Tip

Dimensiuni (L x A x H mm)

Numr coloane

extensie

800 x 365

CHT802

coloan

800 x 930

6WUXFWXUPHWDOLF9RSVLWQFPSHOHFWURVWDWLFFXORDUH*UL5$/$VLJXU
posibilitatea utilizrii spaiului n mod raional. Solid, practic i funcional. Polie
reglabile.
Cod

Dimensiuni
(L x A x H mm)

Polie Portan/poli Montaj


(kg)

TH041

1000 x 400 x 1900

70 kg

LP906

70

cu uruburi

LP911

GARANIE

Raft pentru arhiv

GARANIE

Cuier Pom

6WUXFWXUPHWDOLFVROLG9RSVLWQFPSHOHFWURVWDWLFFXORDUH*UL5$/
5 polie reglabile. Montaj cu cleme.

QOLPHFP&RUSPHWDOLFDJWRULVXSRUWSHQWUXXPEUHOH

Cod

Dimensiuni
(L x A x H mm)

Portan/poli (kg)

Cod
LP906

Culoare

TH8011

1000 x 400 x 1800

100

LP911

cromat

negru

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

371

seifuri

povestea unei mrci


%XUJ:FKWHUHVWHRUPJHUPDQGHIDPLOLHFXRWUDGLLHGHSHVWHGHDQLQ
domeniul produselor de siguran.

%XUJ:FKWHUHVWHXQXOGLQOLGHULLPRQGLDOLFDSURGXFWRULIXUQL]RUGHODFWH
sigurane pentru ui sau ferestre, case de bani, seifuri, dulapuri de arme, casete de
YDORULLFXWLLSRWDOH'DUDGHYUDWXOSURGXVHVWHVLJXUDQD2DPHQLLVHQFUHGQ
SURGXVHOH%XUJ:FKWHUSHQWUXFOHRIHUVLJXUDQ

3URGXVHOH%XUJ:FKWHUVXQWIDEULFDWHIRORVLQGXVHWHKQRORJLLPRGHUQH
RELQQGXVHDVWIHOSURGXVHVLJXUHGHFDOLWDWH*HUPDQ(QJLQHHULQJ

Administraie
Wetter
Vollmarstein

Producie
Wetter
Vollmarstein

Cercetare i
producie
Meinerzhagen
Valbert

SIGURAN PRIN CALITATE!


&DVHWHGHYDORUL

Producie
Wiesmar

/DFWH
QFXLHWRDUHFXFKHLH
VDXFXFLIUXPHFDQLF
3RWRIHULWHLvQORWXULFX
DFHHDLFKHLH0RGHOH
GLYHUVHLQFOXVLYFX
SODFVSHFLDOSHQWUX
DQFRUDUH

&DVHWHLGXOSLRDUHSHQWUXFKHL
&DSDFLWDWHLQWHULRDU
GHODRVLQJXUFKHLH
SkQODGHFKHL

6HLIXULGHSHUHWH

&XWLLGHSRW
'HODPRGHOHOHVLPSOH
SkQODVLVWHPHFRPSOH[H
PDVWHUNH\/RWXULGH
ODFWHFXDFHHDL
FKHLHQFKLGHUHFX
FLIUXVDXFXFKHLH'H
ODPRGHOHFXUH]LVWHQ
QRUPDOODLQWHPSHULL
SkQODPRGHOH
UH]LVWHQWHODDSVUDW

7HKQLFGHPVXU

5H]LVWHQWHODLQWHPSHULL
3HQWUXDSDUWDPHQWH
VDXSHQWUXYLOH

QFXLHWRULHOHFWURQLFH
6HSRWPRQWDSHRULFH
XHGHH[WHULRUVDX
GHLQWHULRU0RQWDUH
UDSLGLXRDUIU
DVFKLPEDEURDVFD
VLOGXOVDXFODQD
&DPRGDOLWDWHGH
GHVFKLGHUHVHSRDWH
DOHJHvQWUHFLIUX
HOHFWURQLFWHOHFRPDQG
(NH\
 
)XQFLLH[WLQVHSULQ
VRIWZDUH

7HOHPHWUHFXXOWUDVXQHWH
QLYHOHODVHUXEOHUH
HOHFWURQLFHQLYHOH
FODVLFHUXOHWH
WHUPRPHWUHODGLVWDQ
YROWPHWUH

6HLIXULGHPRELOLHU

&DVHGHEDQL
7HVWDWHLFHUWLFDWH
ODHIUDFLH'LIHULWH
GLPHQVLXQLQFXLHWRUL
PHFDQLFHFXFKHLH
FXFLIUXHOHFWURQLFVDX
biometrice,FXDPSUHQW
GLJLWDO/DFHUHUHSRW
GRWDWHFXPDLPXOWH
vQFXLHWRUL

3HQWUXDPRQWDWHvQ]LG
QFXLHWRDUHPHFDQLFVDXFXFLIUXHOHFWURQLF

3HQWUXDPRQWDWHvQLQWHULRUXOPRELOLHUXOXL
QFXLHWRDUHPHFDQLFHOHFWURQLFVDX
ELRPHWULFDPSUHQWGLJLWDO'HODPRGHOH
VLPSOHSkQODVHLIXULFXUH]LVWHQFHUWLFDW
DWkWODLQFHQGLXFkWLODHIUDFLH

seifuri

Nu face nici un
compromis!

MOBILIER

09

AC103100

Cu Burg-Wchter ai
sigurana garantat!

AC103130

Seifuri pentru mobilier


&RUSLXVFXSHUHWHVLPSOX
'LVSRQLELOFXGRXVLVWHPHGHQFKLGHUH
PRGHOXO.FXFKHLHLPRGHOXO(HOHFWULF
3RVLELOLWDWHGHDQFRUDUH
0ULPLOHLVXQWSUHY]XWHFXSROL
&XORDUH3$1721(%ODFN&

AC103120

COMAND
SPECIAL

AC103140

COMAND
SPECIAL

AC103150

COMAND
SPECIAL

Cod
AC103100

Model

Dimensiuni interioare (mm)

Dimensiuni exterioare (mm)

Greutate (kg)

Volum (l)

Favor S1K

168 x 228x 136

170 x 230 x 170

3.3

6.6

ncuietoare cu 2 chei

AC103130

Favor S5K

248 x 348 x 216

250 x 350 x 250

22

ncuietoare cu 2 chei

AC103120

Favor S3E

198 x 308 x 156

200 x 310 x 200

12.4

ncuietoare electronic
cu cod programabil

AC103140

Favor S5E

248 x 348 x 206

250 x 350 x 250

22

ncuietoare electronic
cu cod programabil

AC103150

Favor S7E

412 x 307 x 305

415 x 310 x 350

17

45

ncuietoare electronic
cu cod programabil

Sistem inchidere

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

373

fotolii directoriale
Alte culori disponibile
la comand special.

Fotolii Formula
Fotolii cu profil ergonomic, ce v permit s v simii ca n scaunul unei maini sport.
'RWDWHFXPHFDQLVPXO0XOWLEORFNFHSHUPLWHXWLOL]DWRUXOXLXQEDODQVUHOD[DQWVXQW
ideale pentru cei care petrec la birou mai mult de 6 ore pe zi. ezutul i sptarul
fotoliilor sunt tapiate cu piele natural. Brae din piele, picioare cromate, cu rotile.
Greutate suportat: 110 kg.

SUPER
CALITATE

09

8 ORE

piele neagr

Specificaii

PL691103

piele roie

440-535

270

1165-1260

MOBILIER

GARANIE

Cod
PL691101

ezut i sptar dinamic, cu


mecanism Multiblock

posibiliti de blocare
ezut i sptar n 6 poziii

700

funcie Anti Shock

ezut i sptar dinamic,


cu mecanism Multiblock

brae din
piele natural

posibiliti de blocare
ezut i sptar n 6 poziii

odihnitor; tapierie
piele natural

SUPER
CALITATE

Alte culori disponibile


la comand special.

GARANIE

8 ORE

GARANIE

520-600

485-575

1240

250

1205-1295

8 ORE

700

Fotolii Orion

660

Fotolii confortabile, cu ezut i sptar tapiate cu piele. nlimea i poziia ezutului


SRWDMXVWDWH)XQFLD$QWL6KRFNSUHYLQHUHYHQLUHDEUXVFDVSWDUXOXLVSUHVSDWHOH
utilizatorului. Braele metalice sunt fixe i prevzute cu paduri moi din piele.
Scaunul are baza cromat n form de stea i este dotat cu roi.
Greutate suportat: 130 kg.

374

Cod
PL686101

Specificaii

PL686104

piele crem

piele neagr

Fotoliu 5700
Scaun destinat lucrului ndelungat la birou sau n faa calculatorului. Poate fi folosit
att ca scaun directorial, ct i ca scaun de birou. Sptarul are un design special
creat pentru susinere lombar. Scaun tapiat cu piele neagr, prevzut cu brae,
picioare negre, din plastic i rotile. Greutate suportat: 110 kg.
Cod
PL575700

Specificaii
piele neagr

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

fotolii directoriale

6 ORE

8 ORE

GARANIE

09

1300

1400-1550

MOBILIER

GARANIE

660

660

Scaun Pro 2
Fotoliu LGA

$VLJXUSUHVWDQLRIHURSR]LLHFRQIRUWDELOFKLDUSHQWUXRSHULRDGOXQJ
de timp, avnd un design ergonomic. Fotoliu din piele neagr, cu brae, picioare
negre, din plastic i rotile. Greutate suportat: 120 kg.
Cod
PL575702

ezut i sptar din piele natural. Spate i laterale din piele ecologic. nlime
reglabil, mecanism oscilant. Baz cromat. Greutate suportat: 120 kg.
Cod
PL6411

Specificaii
piele ecologic neagr

Specificaii
piele neagr

8 ORE

8 ORE

GARANIE

289
480

370-460

1220

1100-1120

GARANIE

660

660

Fotoliu Tomy

Fotoliu Ergo D

Piele natural pe partea frontal i piele ecologic pe prile laterale i spate.


'LVSR]LWLYGHQFOLQDUHVLPXOWDQDH]XWXOXLLVSDWHOXL*UHXWDWHVXSRUWDWNJ

Este confortabil, fabricat din piele ecologic de calitate superioar, care rezist n
timp. Stea cromat i brae din plastic. Este soluia perfect ntr-un birou.

Cod
PL6721

Specificaii
piele neagr

Cod
PL575800

Specificaii
piele neagr

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

375

scaune operaionale
Alte culori disponibile
la comand special.

Alte culori disponibile


la comand special.

8 ORE

09

6 ORE

1010-1220

190-260

GARANIE

460-560

470-590

190

1090-1190

MOBILIER

GARANIE

690

Fotoliu Stilo

3RDWHIRORVLWDWWFDVFDXQGLUHFWRULDOFWLFDVFDXQGHELURX'HVWLQDWOXFUXOXL
ndelungat la birou sau n faa calculatorului. Sptarul are un design special
creat pentru susinere lombar. Scaun tapiat cu stof neagr, prevzut cu brae,
picioare negre, din plastic i rotile. Greutate suportat: 120 kg.

Fotoliu directorial ce mbin confortul cu un aspect de impact. Ofer posibilitatea


reglrii nlimii ezutului i balans. Fotoliu tapiat cu stof neagr, prevzut cu
brae i picioare negre, din plastic i rotile.
Greutate suportat: 120 kg.
Cod
PL575705

640

Scaun 1580 Gala

Cod
PL575706

Specificaii
stof neagr

Specificaii
stof neagr

Alte culori disponibile


la comand special.

Alte culori disponibile


la comand special.

8 ORE

6 ORE

GARANIE

Scaun ergonomic Neo II

685

Scaun office confortabil i ergonomic. ezut i sptar tapiate cu material textil.


Scaunul este dotat cu un mecanism de blocare a sptarului n 5 poziii. nlimea
LSR]LLDH]XWXOXLSRWDMXVWDWH0HFDQLVPXO$QWL6KRFNSHUPLWHGHDVHPHQHD
evitarea unei reveniri brute a sptarului. Braele fixe sunt metalice i au paduri
moi. Tetiera este tapiat integral cu material textil i ajustabil. Scaunul are baza
PHWDOLFQIRUPGHVWHDFXURWLOHSHQWUXSRGHOHFXPRFKHWVDXSDUFKHW
Greutate suportat: 120 kg.
Cod
PL691300

376

420-570

455-545

990

1215-1305

215

240

GARANIE

Specificaii
negru

620

Scaun Panther
ezut i sptar din material textil negru. Sptar nalt cu format ergonomic, reglabil.
Mecanism pneumatic. Scaun prevzut cu cotiere. Sptarul se nclin pentru a
urmri continuu micrile spatelui i pentru a-l susine. Greutate suportat: 120 kg.
Cod
PL5590

Specificaii
stof neagr

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

scaune operaionale
Alte culori disponibile
la comand special.

8 ORE

6 ORE

GARANIE

220
400-520

1110-1119

1120

09
MOBILIER

GARANIE

560

Scaun Holo

640

ezut i sptar din material textil negru. Mecanism sincron antioc cu 3 manete
(o manet pentru reglarea simultan a ezutului i sptarului, o manet pentru
reglarea pe nlime i o manet pentru reglarea sptarului individual) i cu reglarea
forei contragreutii. Mecanism pneumatic. Scaun prevzut cu cotiere. Sptarul se
nclin pentru a urmri continuu micrile spatelui i pentru a-l susine.
Greutate suportat: 120 kg.
Cod
PL5591

Specificaii

Scaun Mesh CMX


Scaun rotativ. Sptar mediu. ezut tapiat cu piele sintetic. Sptar tapiat cu plas
i imitaie piele. Baz cromat. Greutate suportat: 110 kg.
Cod
PL5810

stof neagr

Specificaii
stof neagr

Alte culori disponibile


la comand special.

Alte culori disponibile


la comand special.

8 ORE

8 ORE

GARANIE

900-1020

450-570

480-610

960

200

GARANIE

600

600

Scaun Pegas

Scaun 1040 Ergo

Este un scaun ergonomic cu sptar mediu ce asigur o poziie confortabil.


nlimea scaunului se poate regla cu ajutorul cilindrului cu gaz. Sptarul poate fi
nclinat i blocat n poziia dorit. Greutate suportat: 120 kg.

Este un scaun cu format ergonomic. Prin nlimea medie i forma sptarului, acest
scaun ofer utilizatorului o bun susinere n zona lombar.
Greutate suportat: 100 kg.

Cod
PL5592

Specificaii
stof neagr

Cod
PL575709

Specificaii
stof neagr

Nivel de serviciu ridicat, acoperire naional, vnzare consultativ de calitate. Vei fi mulumit de RTC!

377

scaune operaionale
Alte culori disponibile
la comand special.

09

6 ORE
8 ORE

GARANIE

600

Scaun Torino

cu cotiere,

PL5529

fr cotiere, stof neagr

180
600

Scaun HCM 1005

Este un scaun mobil, ergonomic, cu sptar, care asigur o poziie confortabil.


nlimea scaunului se poate regla cu ajutorul cilindrului cu gaz. Sptarul poate fi
nclinat i blocat n poziia dorit. Greutate suportat: 120 kg.
Cod
PL5528

410-500

440-560

985-1175

920-1010

MOBILIER

GARANIE

Specificaii
stof neagr

Recomandat n general pentru birouri, persoanelor care ndeplinesc funcii


administrative. Este un scaun mobil, care asigur o poziie confortabil.
Mecanismul permite reglarea n nlime a scaunului. Scaun tapiat cu stof neagr,
prevzut cu brae, picioare negre, din plastic i rotile. Greutate suportat: 100 kg.
Cod
PL575708

Specificaii
stof neagr

8 ORE

8 ORE

940-1130

440-570

440-570

950-1120

210

GARANIE

200

GARANIE

645

645

Scaun call center Perfect


Scaun call center Ergo J
Scaun office recomandat n mediile cu activitate intens. Sptar ajustabil pe
nlime, care susine corect spatele. Materialul textil este uor de ntreinut.
Greutate suportat: 120 kg.
Cod
PL690203

378

Specificaii
stof neagr

Scaun office confortabil, cu ezut i sptar din material textil, brae fixe. nlimea i
poziia ezutului i a sptarului sunt ajustabile. Greutate suportat: 120 kg.
Cod
PL690204

Specificaii
stof neagr

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

scaune vizitator
Alte culori disponibile
la comand special.

980

GARANIE

470

SFATUL SPECIALISTULUI
AVANTAJELE SCAUNELOR ERGONOMICE
Avantajele oferite de multitudinea modelelor de scaune
HUJRQRPLFHGHELURXSRWKRWUWRDUHQDOHJHUHDSURGXVHORU
potrivite:
Meninerea unei poziii corecte a corpului - scaunele ergonomice
pot asigura o meninere a corpului ntr-o poziie corect pentru
foarte mult timp. n acest fel, durerile de spate i cele lombare pot
fi evitate.
Reducerea durerilor de mini i brae - datorit braelor reglabile
FXFDUHVXQWHFKLSDWHPDMRULWDWHDPRGHOHORUGHVFDXQHVHHOLPLQ
apariia durerilor de mini i de brae n cazul n care se st mult
timp n faa calculatorului.

610

Fotoliu 3550/S
Este recomandat n general pentru birouri sau spaii de lucru care necesit utilizarea
scaunelor pentru vizitatori. l putei utiliza n mod special n anticamerele din
preajma birourilor persoanelor de conducere, pentru musafiri. Fotoliu din piele, cu
brae i cadru vopsit negru, n cmp electrostatic. Greutate suportat: 110 kg.
Cod
PL575703

Specificaii
piele neagr

Alte culori disponibile


la comand special.

Alte culori disponibile


la comand special.

8 ORE

6 ORE

870

600

ezut i sptar din piele neagr, brae din lemn. ezut spaios,
FRQIRUWDELOLRGLKQLWRU&DGUXFURPDW*UHXWDWHVXSRUWDWNJ
Cod
PL4414

Specificaii
piele neagr

470

450

880

200

GARANIE

200

GARANIE

Scaun Samba

09
MOBILIER

6 ORE

Scaun Elite

555

H]XWLVSWDUGLQSLHOHQHDJUH]XWODWLRGLKQLWRU6WUXFWXUHODVWLFFURPDWFX
4 butoane antiderapante care asigur stabilitatea scaunului.
Greutate suportat: 90 kg.
Cod
PL4411

Specificaii
piele neagr

Onorm comenzi speciale cu rapiditate i seriozitate. Contacteaz-i cu ncredere consultantul de vnzri!

379

scaune vizitator
Economiseti 10% per bucat
DFKL]LLRQQGVHWXOGHEXFL
Alte culori disponibile la comand special.

stof

stof

09

6+ ORE

6+ ORE

GARANIE

480

Scaun Niky

490

ezut i sptar din material textil negru. Structur metalic foarte rezistent.
Componente interne din lemn. Greutate suportat: 120 kg.
Cod
PL5211

810

480

340

810

340

MOBILIER

GARANIE

Scaun Niky cu cotier i msu

Specificaii

Unitate de vnzare

ram neagr, stof neagr

bucat

ram neagr, stof neagr

set (10 buci)

PL5212

ram cromat, stof neagr

bucat

PL5625

ram neagr, stof gri

bucat

490

'LPHQVLXQLPVX[FPH]XWLVSWDUGLQPDWHULDOWH[WLO
Greutate suportat: 120 kg.
Cod
PL575710

Specificaii
negru

lemn
plastic

6 ORE

6+ ORE

GARANIE

430

480

750

810

340

200

GARANIE

440

400

Scaun Edda
ezut i sptar din material plastic. Structur metalic. Greutate suportat: 110 kg.
Cod
PL5213

380

Specificaii
negru

PL52131

albastru

PL52132

rou

Scaun Elev
ezut i sptar din lemn stratificat. Structur metalic de culoare neagr.
Greutate suportat: 90 kg.
Cod
PL5218

Specificaii
lemn stratificat

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

mobilier horeca

MOBILIER

09

8 ORE

8 ORE

GARANIE

GARANIE

COMAND
SPECIAL

COMAND
SPECIAL

Scaun Dan
Scaun Ovidiu
Este un scaun simplu i elegant, cu sptar i ezut fabricate din stof rezistent
la uzur. Cadru metalic ce poate fi vopsit n diverse culori. Este ideal pentru
UHVWDXUDQWHKRWHOXULVDXVOLGHPHVH
Cod
PL575802

Este un scaun cu un design deosebit, ce mbin stilul clasic cu cel modern. ezut i
sptar tapiate cu piele sintetic, cadru metalic vopsit n cmp electrostatic.

Specificaii

Cod
PL575801

stof

Specificaii
stof

GARANIE

COMAND
SPECIAL

COMAND
SPECIAL

Mas Lena

Mas Rodica

Cu blat rezistent la uzur. Fabricat din PAL melaminat de 18 mm, cu cant ABS de 2
mm, cadru metalic vopsit n culoare neagr, gri sau cromat.

Cu blat ultrarezistent la uzur. Fabricat din PAL melaminat de 36 mm, cu cant ABS
de 4.2 mm. Picioare metalice de culoare argintie sau cromate.

Cod
OF000100

GARANIE

Specificaii
PAL melaminat 18 mm

Cod
OF000101

Specificaii
PAL melaminat 36 mm

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

381

accesorii mobilier

MOBILIER

09
Suport de scaun pentru spate
Suport profesional pentru spate

Reduce tensiunea prin nlturarea presiunii asupra curbei lombare din partea
inferioar a spatelui. Se muleaz uor pe conturul corpului pentru a asigura nivelul
PD[LPGHVXVLQHUHHVWXUDFXRFKLXULSHUPLWHFLUFXODLDDHUXOXLSHQWUXDVLJXUDUHD
confortului personal. Se ataeaz cu uurin oricrui tip de scaun.

Fabricat din material antimicrobian i spum. Confer spatelui o poziie natural


crend astfel utilizatorului confortul necesar pentru desfurarea activitii
n bune condiii.

Cod
FWS0005

Cod
FW002003

Covor de protecie pentru mochet


Suport pentru picioare

$VLJXUSURWHFLDPRFKHWHLGLQELURXOGXPQHDYRDVWU
Stratul antiderapant asigur o fixare bun.
Realizat din policarbonat.
'LPHQVLXQL[FP
Grosime: 0.8 mm.

Folosit de persoanele care stau peste 4 ore la birou. Ajusteaz poziia picioarelor
ODQOLPHDGRULW FXOLVHD]SHRUL]RQWDO LDUQFKHLHWXULOHSLFLRDUHORUVWDXODXQ
XQJKLGHr UHOD[DWH 

Cod
RC9212201

Cod
3MFR330

Suport profesional pentru picioare

Suport cu nclinare i reglare nlime de la 100 mm la 165 mm. Suprafat rezistent


la uzur. Ajut utilizatorul s menin picioarele n poziia dorit, eliminnd astfel
disconfortul.
Cod
FW002001

382

Suport pentru picioare


'HVLJQHUJRQRPLFFXVXSUDIDQFOLQDWRWDQWFHPDVHD]WOSLOHSLFLRDUHORU
Cod
FWS0002

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

10. Promoionale
instrumente de scris

384

tiprituri personalizate

387

accesorii pentru birou

388

cni

390

articole de cltorie i outdoor

391

stick-uri memorie
i power bank-uri

392

geni i rucsacuri

393

tricouri

394

instrumente de scris
Disponibile la comand special!

Set pixuri Mark Twain


6HWGHSL[XULGLQGRXSLHVHFHFRQLQHXQUROOHUFXJHODOEDVWUXLXQ
SL[FXPLQQHDJU$PEDODWQFXWLHQHDJUGHFDGRX
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWJUYXUODVHU
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

PROMOIONALE

10

Cod
FT800101

Culoare
negru

SFATUL SPECIALISTULUI
MODALITI DE PERSONALIZARE
1. SerigrafiaHVWHSHUVRQDOL]DUHDUHDOL]DWSHRVXSUDIDSODQFXDMXWRUXOXQXLDEORQSUHJWLWSHQWUXSURFHGXUD
IRWRWHKQLF VLWDVHULJUDF 6HULJUDDHVWHUHFRPDQGDWQFD]XOSURGXVHORUWH[WLOHGLQSODVWLFFDUWRQVDXKUWLHHWFSHQWUX
DSURDSHRULFHGLPHQVLXQL
2. TampografiaHVWHXQSURFHGHXGHSHUVRQDOL]DUHSHVXSUDIDSODQVDXFXUEDWODXQDVDXPDLPXOWHFXORULFXDMXWRUXO
XQXLFOLHXIRWRWHKQLFLDUVXSUDIDDGHSHUVRQDOL]DUHQXSRDWHGHSL[PP6HSRWWDPSRJUDDRELHFWHOHGHPLFL
GLPHQVLXQLGLQSODVWLFPHWDOOHPQVWLFOSLHOHQDWXUDOVDXDUWLFLDOHWF
3. Gravura laserHVWHXQSURFHGHXGHSHUVRQDOL]DUHDORJRXULORUGHGLPHQVLXQLIRDUWHPLFL*UDYXUDVHUHDOL]HD]SH
VXSUDIDDSURGXVXOXLSULQLQWHUPHGLXOXQXLIDVFLFXOODVHUFRQWURODWGHFDOFXODWRU)RORVLPDFHDVWPRGDOLWDWHODSURGXVHOHGLQ
PHWDOVWLFOLSRUHODQ

Pix elegant M Collection


Pix elegant din aluminiu cu accesorii cromate.
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWJUDYXUODVHUWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800102
FT700203
FT700204
FT700205

Culoare
negru
albastru
rou
argintiu

Pix Mumbei
3L[GLQDOXPLQLXFXGHVFKLGHUHSULQDSVDUHLDFFHVRULLVWUOXFLWRDUH
FURPDWH0LQQHDJU
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHDUHFRPDQGDWJUDYXUODVHUWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800103
FT800104

Culoare
negru
gri

Pix Delgado
,QVWUXPHQWHGHVFULVFXGHVLJQPRGHUQLFRUSGLQPHWDO3L[FXPHFDQLVP
DFLRQDWSULQUVXFLUHLUH]HUYWLS3DUNHUGHFXORDUHDOEDVWU
SHUVRQDOL]DUHUHFRPDQGDWJUDYXUODVHUPHFDQLFVDXWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
SE2241

personalizare prin tampografie (H), gravur laser (J) sau gravur mecanic (I)

384

Tip

Finisaj

Accesorii

pix

gri mat

crom

SE2242

pix

argintiu

crom

SE2803

pix

argintiu

auriu

SE2804

pix

negru mat

auriu

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

instrumente de scris
Disponibile la comand special!
Pix cu touchpad i LED
3L[FXPLQDOEDVWULOXPLQ/('&DSDFXOHVWHSUHY]XW
FXWRXFKSDGSHQWUXDXWLOL]DWSHVSDUWSKRQHXULLWDEOHW
3&XUL
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

10

Culoare
negru
albastru
rou

PROMOIONALE

Cod
FT800105
FT800106
FT800107

Pix cu clip metalic


3L[GLQSODVWLFFXPLQPDUHDOEDVWU
'LVSRQLELOQPDLPXOWHFXORUL
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800108
FT800109
FT800110
FT800111
FT800112
FT800113
FT800114

Culoare
negru
albastru
rou
alb
galben
verde
portocaliu

CALITATE
PRE

Pix din plastic ABS cu mecanism prin rsucire


3L[GLQ$%6FXGHVFKLGHUHSULQUVXFLUH$VHPQWRUFDIRUPFXR
OHEG3UHY]XWFXPLQDOEDVWU
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800300
FT800301
FT800302
FT800303
FT800304

Culoare
alb / portocaliu
alb / rou
alb / verde
alb / albastru
alb / negru

CALITATE
PRE

Pix din plastic cu touchpad


3L[GLQSODVWLFFXPHFDQLVPSULQUVXFLUH)RUPHOHJDQWVXELUH3UHY]XW
FXPLQDOEDVWULWRXFKSDGSHQWUXXWLOL]DUHSHVPDUWSKRQHXULLWDEOHWH3&
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800115
FT800116
FT800117
FT800118
FT800119

Culoare
portocaliu
roz
mov
albastru deschis
verde deschis

RTC, soluie complet pentru companii. Ctig timp, achiziionnd de la RTC toate articolele de care ai nevoie pentru firma ta!

385

instrumente de scris
Disponibile la comand
special!
Disponibile
la comand special!

Pix Point Classic


&RUSGLQSODVWLFFXDFFHVRULLPHWDOLFH5H]HUYWLS3DUNHUGHFXORDUHDOEDVWU
&OLSPHWDOLFGHSULQGHUH9UIPHWDOLF/XQJLPHGHVFULHUHP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

10
CALITATE
PRE

PROMOIONALE

Cod
SE25740
SE25741
SE25742
SE25743
SE25744

Culoare
alb
negru
bordo
albastru
verde

Pix Dart
3L[GLQSODVWLFFRUSURWXQGFXFOLSPHFDQLVPDFLRQDWSULQDSVDUH
5H]HUY;DOEDVWU9UIGLQRHOLQR[LGDELO*URVLPHYUIPP
/XQJLPHGHVFULHUHP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
SE26000
SE26003

Culoare
alb
albastru

Pix Fun Hands


3L[GLQSODVWLFH[LELO0RGHO)XQ+DQGV0LQDOEDVWULIXQFLH
WRXFKSDGSHQWUXVPDUWSKRQHLWDEOHWH3&
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800305
FT800306
FT800307
FT800308
FT800309
FT800310

Culoare
albastru
rou
verde
portocaliu
mov
albastru deschis

Pix plastic Slim Line


3L[GLQSODVWLF6OLP/LQHFXPHFDQLVPGHUVXFLUHLPLQDOEDVWU
'DWRULWIRUPHLVXELULSL[XOHVWHXRUGHDWDDWSHVXSRUWXORULFUHL
agende.
GLPHQVLXQHSURGXV[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800120
FT800121
FT800122

386

Culoare
alb
albastru
negru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

accesorii pentru birou


Disponibile la comand special!
nur pentru ecuson
QXUSHQWUXHFXVRQSUHY]XWFXVLVWHPGHQFKLGHUHFHVHGHVFKLGHGDFHFXVRQXO
HVWHDJDW*DPYDULDWGHFXORUL
GLPHQVLXQHSURGXVFPOLPHFPOXQJLPH
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

10
PROMOIONALE

Cod
FT000401
FT000402
FT000403
FT000407
FT000411
FT000412
FT000414
FT000420

Culoare
rou
galben
albastru
verde
alb
negru
gri
portocaliu

Map A4
0DSGLQSLHOHHFRORJLFSUHY]XWFXVXSRUWSHQWUXSL[
EX]XQDUSHQWUXGRFXPHQWHLEORFQRWHV&XORDUHQHJUX
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDHWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT600832

Port card nvelit cu piele

Port cri de vizit

3RUWFDUGQYHOLWFXSLHOHGHRFDOLWDWHVXSHULRDUFXRVXSUDIDH[WUHPGHOXFLRDV
QYHOLWFXSLHOHLFXQFKLGHUHPDJQHWLF
GLPHQVLXQHSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWJUDYXU
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

3RUWFULGHYL]LWGLQPHWDOPDW
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWJUDYXUODVHUWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT100100

Cod
FT800204

Culoare
argintiu

Ceas flexibil
&HDVPLFH[LELOFXIXQFLHGHDODUPLFOLSPHPR
6HSRDWHIRORVLLFDVXSRUWGHWHOHIRQPRELO
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800205
FT800206
FT800207
FT800208

388

Culoare
rou
albastru
verde
portocaliu

Memo cub
6XSRUWSHQWUXQRWLHED]GLQSODVWLFFXFOHP
PHWDOLF
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT600850

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

accesorii pentru birou


Disponibile la comand special!
Minge anti-stres
0LQJHHODVWLFDQWLVWUHVGLQVSXPGHSODVWLF
6FSDLGHVWUHVVDXDQWUHQDLYPXVFXODWXUDGHJHWHORU
GLDPHWUXFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT0007x

10
PROMOIONALE

[FXORDUH URX JDOEHQ DOEDVWUX


 YHUGH DOESRUWRFDOLX

Blocnotes autoadeziv
,QFOXGHQRWLHDGH]LYHOHLVHWXULDFWHLQGHFL
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT700696

CALITATE
PRE

Suport pentru notie autoadezive


6XSRUWGHELURXQIRUPGHFVXFHLQFOXGHQRWLHDGH]LYHOHLVHWXULDFWH
LQGHFL
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT600951

Calculator solar din silicon


&DOFXODWRUVRODUGLJLWDOFXGHVLJQPRGHUQLH[LELOGDWRULWWDVWDWXULLGLQVLOLFRQ
GLJLL
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800341

Culoare

FT800342

portocaliu

FT800343

verde lime

albastru

Textmarker n form de omule


HUB USB 2.0
+XE86%GLQSODVWLF3RDWHIRORVLWSHSRVWGHVXSRUWSHQWUXQRWLH
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT600751

Culoare
alb

,QFOXGHSDWUXPLQLWH[WPDUNHUHQGLYHUVHFXORUL
SUHY]XWFXSHULHH[WHQVLELOSHQWUXFXUDWWDVWDWXUD
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT700524

Oricare ar fi meseria ta, avem produsul potrivit.

389

cni
Disponibile la comand special!

SFATUL SPECIALISTULUI
SUBLIMAREA

10
PROMOIONALE

Can pentru sublimare


&DQFHUDPLFFXRVXSUDIDVSHFLDOSHQWUXSHUVRQDOL]DUHSULQVXEOLPDUH
SHWRDWVXSUDIDDH[WHULRDUDFQLL
FDSDFLWDWHPO
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVXEOLPDUH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800334

Culoare
rou

FT800335

albastru

5HSUH]LQWWHKQLFDGHDSOLFDUHDLPDJLQLORUQSROLFURPLHSHRELHFWH
GLQFHUDPLFVSHFLDOIDEULFDWHWH[WLOHPHWDOHVDXPDWHULDOHSODVWLFH
IRORVLQGLQJUHGLHQWHSULPDUHFHUQHOXULVSHFLDOHFDOGXULSUHVLXQH
6HSRWWUDQVIHUDDVWIHOLPDJLQLIRWRJUDFHODRUH]ROXLHDSURSLDW
GHFHDRULJLQDOOXFUXPDLJUHXDFFHVLELOVDXFKLDULPSRVLELOSHQWUX
FHOHODOWHPHWRGHGHSHUVRQDOL]DUH
PSUHXQFXUH]LVWHQDGDWGHQFRUSRUDUHDFKLPLFQPDWHULDO
SRVLELOLWDWHDGHDWUDQVIHUDLPDJLQLGHUH]ROXLHPDUHSHPDWHULDOH
IRDUWHGLYHUVHIDFHGLQVXEOLPDUHPHWRGDLGHDOGHDSHUVRQDOL]D
RELHFWHOHGRPHVWLFHJHQFQLEUHORFXULVWLFOHSDKDUHHWF

Can termoizolant din plastic

Can termo
&DQWHUPRL]RODQWFXSHUHLGXEOLVLVWHPGHQFKLGHUHLGHVFKLGHUHSULQDSVDUH
SUDFWLFLXRUGHIRORVLW
GLPHQVLXQLSURGXV[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT60084x
[FXORDUH UR] DOEDVWUXGHVFKLV JDOEHQSRUWRFDOLX
QHJUX DOE

FDSDFLWDWHPO
SUHY]XWFXFDSDF
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT600561

Culoare

FT800323

albastru

portocaliu

FT800324

alb

FT800325

gri

FT800326

verde

Can ceramic
&DQGLQSRUHODQFXOLQJXULQPQHU
FDSDFLWDWHPO
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

390

Can sablat
&DQSHQWUXFHDLLFDIHDGLQVWLFOVDEODW
FDSDFLWDWHPO
GLPHQVLXQLSURGXV[RFP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

Cod
FT100401

Culoare

FT100402

galben

FT100403

albastru

Cod
FT800331

Culoare
rou

FT100407

verde

FT800332

albastru

FT100420

portocaliu

FT800333

verde

rou

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

articole de cltorie i outdoor


Disponibile la comand special!
Umbrel
8PEUHOWHOHVFRSLFSOLDELO5DLQERZFXKXVQ\ORQ
GLDPHWUXFP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT2002x

PROMOIONALE

10

[FXORDUH URX JDOEHQ DOEDVWUX DOEDVWUXGHVFKLV


 DOEDVWUXQFKLV YHUGH YHUGHGHVFKLV YHUGHQFKLV
 DOE JUL ERUGHDX[ PDURQHJUX
SRUWRFDOLX UR] PRY

Umbrel automat
8PEUHODXWRPDWFXPQHUGLQOHPQLYUIPHWDOLF
GLDPHWUXFP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT700345

Culoare
rou

FT800336

galben

FT800337

albastru

FT800338

verde

FT800339

portocaliu

FT800340

negru

Pelerin de ploaie
3HOHULQGHSORDLHWUDQVSDUHQWQVXSRUWURWXQGGLQSODVWLF3UHY]XWFXFUOLJ
FDUDELQSHQWUXDDJDWGHFXUHDVDXGHJHDQW
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH SHVXSRUW
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT300701

Culoare
verde

FT300703

rou

FT300705

albastru

FT300711

alb

FT300712

negru

apc baseball
DSFEDVHEDOOQFKLGHUHFXFDWDUDP9DULHWDWHDGHFXORULSRDWHVDWLVIDFHGRULQD
RULFUXLFOLHQWFDUHGRUHWHVLSURPRYH]HFRPSDQLDQWUXQPRGLQHGLW6SDLXOGH
SHUVRQDOL]DUHSHUPLWHQFDGUDUHDRULFUHLVLJOH
VSDWLXVXFLHQWSHQWUXSHUVRQDOL]DUHORJR IURQWDOODWHUDO
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT1008x
[FXORDUH URX JDOEHQ DOEDVWUX DOEDVWUXGHVFKLV
 DOEDVWUXQFKLV YHUGH YHUGHGHVFKLV DOEQHJUX
SRUWRFDOLX UR]

Soluia complet, livrat rapid: echipamente de protecie, curenie, protocol, promoionale, mobilier, papetrie, IT.

391

stick-uri USB i powerbank-uri


Disponibile la comand special!

10
PROMOIONALE

USB Stick

392

USB Stick Capsule

0HPRULHDVK86%JDPYDULDWGHFXORUL
SHUVRQDOL]DUHUHFRPDQGDWJUDYXUODVHUWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Capacitate (GB)

Culoare

0HPRULHDVK86%WLSFDSVXOGLQSODVWLFVDWLQDW
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

Cod
FT200902

1 / 2 / 4 / 8 / 16

rou

FT200914

1 / 2 / 4 / 8 / 16

negru

Culoare

1 / 2 / 4 / 8 / 16

portocaliu

Cod
FT800311

Capacitate (GB)

FT200920

1 / 2 / 4 / 8 / 16

rou

FT200925

1 / 2 / 4 / 8 / 16

verde lime

FT800312

1 / 2 / 4 / 8 / 16

albastru

FT200926

1 / 2 / 4 / 8 / 16

albastru

FT800313

1 / 2 / 4 / 8 / 16

argintiu

FT200927

1 / 2 / 4 / 8 / 16

alb

FT800314

1 / 2 / 4 / 8 / 16

negru

USB Stick MINI

USB Stick Card

0HPRULHDVK86%GLQSODVWLFVDWLQDWFXQLVDMHGLQDOXPLQLX
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDHJUDYXUODVHUSHSDUWHDPHWDOLF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

0HPRULHDVK86%WLSFDUGGLQ$%6GHFXORDUHDOE
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWLPSULPDUHGLJLWDOVSHFLDOSROLFURPLH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

Cod
FT800315

Capacitate (GB)

Culoare
rou

Cod
FT800319

Capacitate (GB)

1 / 2 / 4 / 8 / 16

Culoare
alb

FT800316

1 / 2 / 4 / 8 / 16

albastru

FT800320

alb

FT800317

1 / 2 / 4 / 8 / 16

portocaliu

FT800321

alb

FT800318

1 / 2 / 4 / 8 / 16

negru

FT800322

alb

Powerbank din metal

Powerbank PB-3000

3RZHUEDQNGLQPHWDOSHQWUXQFUFDUHDWHOHIRQXOXLPRELOVPDUWSKRQH
VDXDWDEOHWHL
LQFOXGH86%
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDHVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

,QFOXGHXQFDEOX86%0LFUR86%LQWHJUDWLHVWHFRPSDWLELOFXPDMRULWDWHD
VPDUWSKRQHXULORU3RDWHQFUFDWSULQSRUWXO86%DOXQXLODSWRSVDXFDOFXODWRU
$PEDODWQWURFXWLHGHFDGRX$YHQXH
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWWDPSRJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT800213

Capacitate (Mah)

Culoare

3000

rou

Cod
FT800210

Capacitate (Mah)

Culoare

2200

rou

FT800211

2200

albastru

FT800214

3000

alb

FT800212

2200

negru

FT800215

3000

albastru

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

geni i rucsacuri
Disponibile la comand special!

Geant cptuit din microfibr


3HQWUXGRFXPHQWHFSWXLWGLQPLFUREUSROLHVWHU'
SUHY]XWFXPQHULFXUHDGHXPU
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT80040x

*HDQWSHQWUXGRFXPHQWHSROLHVWHU'
FXGLYHUVHFRPSDUWLPHQWHFXIHUPRDULFODSHWFRORUDW
FXUHDGHXPUDMXVWDELO
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT80040x

[FXORDUH URXQHJUX JULQHJUX DOEDVWUXQHJUX

[FXORDUH URXQHJUX DOEDVWUXQHJUX JULQHJUX


QHJUXQHJUXJDOEHQQHJUX

Rucsac Boulder

Rucsac Laguna

5XFVDFGLQSROLHVWHU'&RPSDUWLPHQWPDUHFXIHUPRDUEX]XQDUQLQWHULRUL
EX]XQDUYHUWLFDOH[WHULRU'LVSRQLELOQWURJDPYDULDWGHFXORUL
SUHY]XWFXEUHWHOHUHJODELOHFSWXLWHLPQHU
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

5XFVDFGLQSROLHVWHU'&RPSDUWLPHQWPDUHFXIHUPRDU
'RXEX]XQDUHXQXOODH[WHULRULFHOODOWODLQWHULRU
SUHY]XWFXEUHWHOHFSWXLWHLPQHU
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

10
PROMOIONALE

Geant pentru documente

Cod
FT8004x

Cod
FT8004x
[FXORDUH URX QDY\ JUL DOEQHJUX
 UR] JDOEHQ YHUGHOLPH YHUGH DOEDVWUXGHVFKLV

[FXORDUH JUL URX JUL DOEDVWUX JUL YHUGH


 JUL QDY\ JUL PRY JULQHJUX

Geant sport Boomerang


Geant frigorific
*HDQWIULJRULFGLQSROLHVWHU'FXGRXFRPSDUWLPHQWHQFKLVHSULQIHUPRDU
SUHY]XWFXEUHWHDUHJODELO
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT80050x
[FXORDUH URX DOEDVWUXGHVFKLV DOE QDY\ YHUGHOLPH

*HDQWVSRUWGLQSROLHVWHU'LSROLSURSLOHQQHHVXWGHJPS&RPSDUWLPHQW
PDUHQFKLVSULQIHUPRDUEX]XQDUIURQWDOIDQWSHQWUXSL[LEX]XQDUODWHUDOSHQWUX
VWLFODGHDS
SUHY]XWFXPQHUHLFXUHDDMXVWDELOGHXPU
GLPHQVLXQLSURGXV[[FP
SHUVRQDOL]DUHUHFRPDQGDWVHULJUDH
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT80050x
[FXORDUH URXQHJUXQHJUXQHJUX
 DOEDVWUXQHJUX JULQHJUX

Economisete timp i bani pentru compania ta! Alege RTC: un singur furnizor, o singur factur.

393

tricouri
Disponibile la comand special!
Tricou Original T
%XPEDFXQLVH[JDPYDULDWGHFXORUL
PRGDOLWDWHGHSHUVRQDOL]DUHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT1009x

10
PROMOIONALE

[FXORDUH URX JDOEHQ DOEDVWUX DOEDVWUXQFKLV


 YHUGH DOE JUL EOHXPDULQQHJUXSRUWRFDOLX

Tricou dam
%XPEDFGDPJDPYDULDWGHFXORUL
PRGDOLWDWHGHSHUVRQDOL]DUHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT2001x
[FXORDUH URX JDOEHQ DOEDVWUXQFKLV EOHX DOEDVWUXGHVFKLV
 YHUGH YHUQLO DOE JUL EOHXPDULQQHJUXSRUWRFDOLX
 UR] PRY siclam

394

Azi dau comand la RTC! comenzi@rtc.ro, 021.408.20.00, magazin.rtc.ro

tricouri
Disponibile la comand special!

Tricou polo pentru pentru brbai


7ULFRXSRORGLQEXPEDFLGHDOSHQWUXSHUVRQDOL]DUHJDPYDULDWGHFXORUL
%XPEDFJPS
PRGDOLWDWHGHSHUVRQDOL]DUHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL

[FXORDUH URX JDOEHQ DOEDVWUX EOHX


 DOEDVWUXGHVFKLV EOHXPDULQ YHUGHQFKLV DOE
QHJUX JULSRUWRFDOLX EXUJXQG\ maro

PROMOIONALE

10

Cod
FT4002x

Tricou polo pentru dam


7ULFRXSRORGLQEXPEDFLGHDOSHQWUXSHUVRQDOL]DUHJDPYDULDWGHFXORUL
%XPEDFJPS
PRGDOLWDWHGHSHUVRQDOL]DUHWUDQVIHUVHULJUDF
FDQWLWDWHPLQLPSHQWUXSHUVRQDOL]DUHEXFL
Cod
FT4001x
[FXORDUH URX DOEDVWUX EOHX DOEDVWUXGHVFKLV
 YHUGHQFKLV DOEQHJUX EOHXPDULQ UR] 
 EXUJXQG\ magenta

Livrare n 24/48 de ore, cu transport gratuit pentru comenzi mai mari de 200 de lei fr TVA.

395

condiii comerciale

Condiii generale de vnzare a produselor


1. Generaliti
Clauzele prezentate mai jos sunt valabile pentru achiziii standard i pot fi modificate n anumite situaii, fr o notificare prealabil. Ele pot fi modificate
prin negociere cu reprezentanii Vnztorului sau prin orice ofert ori contract de achiziie ce poate conine clauze specifice. Ofertele sau contractele vor
fi valabile doar la data emiterii acestora sau pe perioada de valabilitate nscris n ofert ori contract. Informaiile despre articole publicate n cataloage,
brouri, pliante, pe site sau n alte materiale de promovare, sunt prezentate sub rezerva erorilor de tipar i a limitrilor tehnologice. Pozele produselor vor
fi considerate cu titlu informativ. Orice nelegere devine valabil doar dup confirmarea acesteia n scris.

2. Calitatea produselor, garania i returul


Calitatea produselor este cea prevzut n specificaiile i standardele tehnice ale productorului. Orice reclamaie legat de calitatea sau conformitatea
produselor trebuie semnalat n maximum 3 zile de la livrare. Informaii despre reelele autorizate de service pentru fiecare produs sunt disponibile pe
certificatul de garanie. La prezentarea produsului n locaia de service, pe lng certificatul de garanie trebuie prezentat i factura de achiziie.
Soluionarea reclamaiilor se va realiza n raport cu prevederile legale n vigoare, n minimum 48 de ore de la livrare, dar nu mai trziu de 2 luni de la
momentul nregistrrii reclamaiei, pe urmtoarele ci: repararea defectelor reclamate sau nlocuirea produselor reclamate. Returul mrfurilor neconforme
de ctre Cumprtor se va face n colete sigilate, tampilate i nsoite de o copie a documentului de livrare, pe care se va trece i numrul coletelor returnate.
Returul mrfurilor se face numai dup ntiinarea i obinerea acordului Vnztorului. Vnztorul nu are nicio rspundere pentru cazul n care mrfurile
livrate nu corespund scopului pentru care au fost achiziionate de ctre Cumprtor.

3. Livrarea produselor
Livrarea produselor este gratuit pentru comenzi/facturi a cror valoare depete 200 lei fr TVA . Pentru comenzi/facturi a cror valoare este mai mic dect
200 lei fr TVA, se va percepe tax de transport. Pentru produsele din stoc livrarea se va face n termen de: maximum 24 ore n Bucureti i n reedinele
de jude i maximum 72 ore n orice alt punct de livrare de pe teritoriul Romniei. Pentru produsele ce nu se afl n stoc, termenul de livrare este variabil
i se stabilete de comun acord cu Cumprtorul, n raport cu diveri factori care pot influena livrarea respectiv. Produsele vor fi livrate n colete sigilate i
tampilate.

4. Recepia produselor
Dac livrarea se realizeaz de ctre Vnztor la sediul Cumprtorului, Cumprtorul are obligaia de a face recepia cantitativ a coletelor sigilate i de a
verifica integritatea acestora n prezena reprezentantului Vnztorului. Recepia produselor din interiorul coletelor se va face ulterior de ctre Cumprtor.
Dac marfa este ridicat de ctre Cumprtor din depozitul Vnztorului, Cumprtorul are obligaia de a face recepia cantitativ a coletelor i verificarea
integritii acestora la ua depozitului. De asemenea, poate realiza i recepia produselor din interiorul coletelor, dac dorete. La primirea/ridicarea mrfii,
Cumprtorul are obligaia de a trece pe documentele de livrare urmtoarele nsemne: semntura, numele n clar i tampila firmei; semntura, numele
n clar i datele de identificare (serie, numr CI i CNP) - n cazul n care nu dispune de tampila firmei. Compania se oblig s remedieze eventualele
neconcordane cantitative sau calitative constatate de Cumprtor n momentul recepiei dac se dovedete c productorul, vnztorul sau transportatorul
su poart responsabilitatea acestor neconcordane. Sugestiile i sesizrile se pot face pe site (www.rtc.ro), modulul contact, sesizri sau pe e-mail, la
adresa: sesizari@rtc.ro sau telefonic: 0372.088.925 sau 0722.654.226.

5. Preuri i modaliti de plat


Preul poate fi discutat cu reprezentantul de vnzri, alocat n raport cu particularitile fiecrei achiziii. Preul final al produselor este cel indicat n
documentul de nsoire a mrfii. Modaliti de plat acceptate n raport cu particularitile fiecrui client: numerar, ordin de plat, bilet la ordin sau fil CEC.
Termenul de plat se stabilete n raport cu particularitile achiziiei.

6. Penalizri
Pentru neplata preului la termenul scadent specificat pe factur, Cumprtorul datoreaz Vnztorului penalizri de 0.15 % pe zi n primele 30 de zile de la
data scadenei, iar ncepnd cu cea de-a 31-a zi de ntrziere penalizrile sunt de 0.3%/zi, calculate din valoarea sumei scadente i neachitate. Cuantumul
penalitilor poate depi valoarea mrfii. n cazul n care Cumprtorul nu i ndeplinete n mod corect obligaiile de plat sau n cazul n care Vnztorul
primete informaii care reduc credibilitatea Cumprtorului, toate creanele devin imediat scadente, iar Vnztorul este ndreptit s se retrag din toate
contractele existente, fr a fi necesar preavizarea. n acest caz, Vnztorul este ndreptit s nu mai onoreze nicio comand lansat de Cumprtor.

7. Dreptul de proprietate
Mrfurile livrate de Vnztor Cumprtorului rmn n proprietatea Vnztorului pn la achitarea lor integral, plile pariale ale unor facturi nu opereaz
transfer de proprietate. n cazul plii facturilor prin fil(e) CEC sau trat, se consider achitate datoriile ctre Vnztor abia dup ncasarea banilor i nu
la data predrii filei CEC sau tratei. n cazul n care marfa este vndut mai departe, creanele pe care Cumprtorul le dobndete prin vnzarea mrfii
Vnztorului se consider cesionate acestuia pn la plata facturilor.

8. Litigii
n cazul oricror nenelegeri care se vor ivi n cursul executrii prezentului contract, se va ncerca rezolvarea lor pe cale amiabil. n caz de litigiu, prile
accept competena instanelor judectoreti de la sediul Vnztorului.

9. Dispoziii finale
Clauzele comerciale internaionale, cum ar fi CIF, FOB, etc. se vor nelege aa cum sunt cel mai recent publicate de ctre Camera de Comer Internaional
(INCOTERMS). La baza relaiilor de afaceri stau prevederile legale ale Romniei. Dac orice prevedere de mai sus este sau devine nul, celelalte prevederi
rmn valabile. Orice prevedere nul va fi nlocuit de drept cu o dispoziie legal aplicabil, fiind avut n vedere sensul sau scopul celor de mai sus.

Pozele au caracter informativ i nu prezint obligaie contractual. Informaiile despre articole sunt prezente
sub rezerva erorilor de tipar. RTC 2015, drepturi rezervate.
396

index coduri
Cod
3M000470
3M000471
3M000472
3M000473
3M004824
3M020100
3M020101
3M020102
3M020104
3M020106
3M020107
3M020111
3M020113
3M020116
3M020130
3M020134
3M030001
3M10385101
3M105
3M1050
3M1051760
3M107676
3M1076760
3M1076763
3M1076778
3M1076783
3M110039
3M110131
3M110132
3M110133
3M110134
3M110135
3M110136
3M11018
3M11020
3M1102746
3M11028
3M11051
3M11065
3M1127760
3M1127763
3M119033
3M119033C
3M15010
3M151066
3M2001
3M20011
3M20018
3M2003
3M220001
3M220002
3M220003
3M680002
3M6801
3M6802
3M6803
3M6804
3M6807
3M6814
3M700050
3M700051
3M700060
3M700061
3M7003
3M7004
3M767600
3MFR330
AB01
AB07126
AB07127
AB07128
AC031000
AC031001
AC031002
AC031003
AC102000
AC102001
AC103100
AC103120
AC103130
AC103140
AC103150
AC1852
AC9141
AC9144
AG103
AG104
AG105
AIT350
AIT450
AIT600
AIT710
AJ510000
AJ510001
AJ510002
AJ510003
AJ800000
AJ800001
AJ800002
AJ800003
AJ800004
AJ800100
AJ800101
AJ800102
AJ800103
AJ800104
AJ800200
AJ800204
AJ800300
AJ800304
AJ800400
AJ800404
AJ800500
AJ800504
AJ800604
AJ800700
AJ800704
AJ800800
AJ800804
AJ800900
AJ801000
AJ801004
AJ801100
AJ801500
AJ810000
AJ810001
AJ810002
AJ810003
AJ810100
AJ810102
AJ810103
AJ810200
AJ810201
AJ810202
AJ810203
AJ810300
AJ810301
AJ810400
AJ810402
AJ810403
AJ810500

Pagina
244
244
244
244
52
50
50
50
50
49
49
52
50
53
49
50
52
247
162
162
247
247
247
242
242
242
242
244
244
244
244
244
245
243
243
243
243
243
242
247
247
163
163
163
165
161
161
161
160
170
170
170
104
104
104
104
104
104
104
171
171
171
171
158
158
242
382
117
117
117
117
25
25
25
25
73
73
373
373
373
373
373
73
73
73
227
227
227
82
82
82
82
310
310
311
311
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
351
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350

Cod
AJ810501
AJ810502
AJ810503
AJ810600
AJ810601
AJ810602
AJ810700
AJ810701
AJ810703
AJ810900
AJ811000
AJ811100
AJ811200
AJ811300
AJ811400
AJ811500
AJ811700
AJ811800
AJ811900
AJ812100
AJ812200
AJ813300
AJ813400
AJ813500
AJ813600
AJ813700
AJ813800
AJ813900
AJ814000
AJ814100
AJ814200
AJ814300
AJ814400
AJ815700
AJ816200
AJ816700
AJ900000
AJ900100
AJ900200
AJ900300
AJ900400
AJ900500
AJ900700
AJ900701
AJ900702
AJ900703
AJ900800
AJ900801
AJ900802
AJ900900
AJ900901
AJ901000
AJ901001
AJ901002
AJ901003
AJ901004
AJ902000
AL001110
AL001111
AL001112
AL001113
AL001120
AL001140
AL010972
AL010974
AL010975
AL010976
AL010977
AL011035
AL011169
AL011286
AL011329
AL011596
AL011713
AL011714
AL011715
AL011723
AL011896
AL011897
AL011898
AL011899
AL011912
AL011948
AL011949
AL011950
AL011951
AL011952
AL01223
AL01224
AL01225
AL01226
AL01227
AL01228
AL012482
AL012483
AL012533
AL012610
AL012611
AL012612
AL012613
AL013351
AL013370
AL013780
AL013782
AL02001
AL02409
AL02412
AL02420
AL02421
AL02422
AL02423
AL03136
AL100910
AL100917
AL101418
AL101419
AL10817
AL11102
AL11103
AL11201
AL11202
AL11270
AL11271
AL11284
AL11288
AL11290
AL11292
AL11294
AL11295
AL11298
AL11299
AL11300
AL11301
AL11304
AL11305
AL11307
AL11324
AL11325
AL11406
AL11508
AL11707

Pagina
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
350
351
351
351
351
351
351
351
351
351
351
351
350
350
350
76
76
76
76
76
76
76
76
76
76
76
76
76
76
76
77
77
77
77
77
77
167
168
168
168
167
167
245
245
247
247
247
162
163
105
163
245
172
172
172
172
246
246
246
246
105
172
172
172
172
172
240
240
240
240
240
240
105
105
161
105
105
105
105
173
243
128
128
241
239
239
239
239
239
239
238
80
80
80
80
238
238
163
238
238
238
238
238
238
238
238
238
238
238
238
319
318
238
281
319
317
317
238
238
238

Cod
AL11710
AL11711
AL11712
AL11714
AL11715
AL11716
AL11817
AL12114
AL12115
AL12252
AL13360
AL13361
AL13362
AL13363
AL13364
AQ010000
AQ011001
AQ020001
AQ020002
AQ021000
AQ031000
AQ033000
AQ200200
AS00411
AS00412
AS00422
AS00423
AS006001
AS006002
AS006003
AS006004
AS007000
AS007001
AS007003
AS007004
AT210002
AT407600
AV000200
AV000220
AV000300
AV000400
AV000500
AV000501
AV000800
AV001000
AY0001
AY0002
AY0003
AY0004
AY0005
AY0006
AY0007
AY0008
AY000800
AY000801
AY000802
AY000803
AY000804
AY000805
AY000806
AY000807
AY000808
AY100601
AY100801
AY100802
AY101001
AY101201
AY101401
AY101601
AY101901
AY102201
AY102801
AY103201
AY103801
AY104501
AY105101
AY110105
AY110301
AY110302
AY110303
AY110502
AY110503
AY110701
AY140753
AY140754
AY140854
AY141004
AY141253
AY141254
AY141754
AY150100
AY150101
AY150102
AY150103
AY150104
AY150105
AY150106
AY150107
AY150108
AY150201
AY150202
AY150203
AY150204
AY150205
AY150301
AY150302
AY150303
AY150304
AY150305
AY150401
AY150402
AY150403
AY150404
AY150405
AY150600
AY150601
AY150602
AY150603
AY150700
AY150701
AY150800
AY150801
AY150900
AY150901
AY151000
AY151001
AY151100
AY151101
AY151200
AY151201
AY160000
AY160001
AY160002
AY160003
AY160004
AY160005
AY160006
AY160007
AY160008
AY160009
AY160010

Pagina
238
238
238
238
238
238
238
131
131
240, 289
81
81
81
81
81
38
38
40
42
38
38
38
39
156
156
156
156
156, 248
156, 248
156
156
156
156
156
156
290
290
37
47
37
48
34
34
40
39
167
167
167
213
212
215
169
215
247
247
247
247
247
246
245
106
106
335
335
335
335
335
335
335
335
335
335
335
335
335
335
336
336
336
336
336
336
336
335
335
335
335
335
335
335
262
264
273
273
273
273
277
277
277
283
283
283
283
283
283
283
283
283
283
283
283
283
283
283
272
272
272
272
262
262
266
266
266
266
266
266
276
276
282
282
319
318
316
317
317
318
316
319
280
282
281

Cod
AY160011
AY160012
AY180601
AY180801
AY180802
AY181001
AY181201
AY181401
BI001000
BI001001
BI001002
BI001003
BI001004
BR610500
BR710400
BR800100
BR800101
BR800102
BR800103
BR800200
BR800300
BR800301
BR800302
BR800303
BR800401
BR800402
BR800403
BR810000
BR810500
BR810600
BR810700
BR810800
BR811000
BR811400
BR811700
BRTN2000
BRTN2110
BV011101
BV011102
BV011201
BV011202
BV011301
BV011302
BV011303
BV011304
BV011401
BV011402
BV012121
BV012122
BV012131
BV012132
BV012141
BV012142
BV012171
BV012172
BV012181
BV012182
BV012191
BV012192
BV012213
BV013111
BV013221
BV013231
BV013241
BV013251
BV013311
BV013321
BV013331
BV014211
BV014221
BV014311
BV014321
BV01441
BV015111
BV015112
BV015113
BV015211
BV015213
BV015214
BV015215
BV015216
BV015217
BV016111
BV017111
BV017112
BV017113
BV017114
BV017115
BV017121
BV017124
BV017211
BV017221
BV017311
BV021111
BV021211
BV031111
BV031211
BV031212
BV041111
BV061111
BV061112
BV071101
BZ1001
BZ1003
CC001000
CC001001
CCS003
CE435C
CH075
CH110010
CH110011
CH120
CH304
CH305
CH306
CH308
CH310
CH311
CHB195
CHD120
CHD195
CHK100
CHK195
CHM195
CHT801
CHT802
CI101111
CI101112
CI120141
CI120142
CI120151
CI120152
CI770004
CI770005
CI770016
CI770017
CI805703
CI805803
CI833010
CI833011
CI833012

Pagina
318
316
336
336
336
336
336
336
23
23
23
23
23
303
303
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
345
170
170
170
170
171
171
171
171
171
171
156, 159
156, 159, 258
156, 248
156, 248
156
156
156
156
156
156
55, 156
55, 156
160
141
141
141
141
141
147
146
146
141
141
141
141
150
151
151
151
151
151
151
151
151
151
151
172
172
172
172
172
172
172
172
172
172
282
283
106
106
106
212
321
321
158
126
126
27
27
314
314
368
120, 370
120, 370
368
370
120, 370
120, 370
368
370
370
369
368
368
369
369
369
371
371
259
259
259
259
259
259
259
259
259
259
256
256
260
260
260

Cod
CI833013
CI833014
CI833015
CI833016
CI833017
CI833020
CI833021
CI833100
CI833101
CI833102
CI833103
CI833104
CI833105
CI833106
CI833107
CI833120
CI833121
CI834010
CI834011
CI834012
CI834013
CI9201001
CI9201002
CI9201003
CI9201004
CI9301501
CI9301502
CI935003
CI935004
CI9364001
CI9364002
CI9365001
CI9365002
CI9411001
CI9411002
CI9412001
CI9412002
CI9413001
CI9413002
CI9414001
CI9414002
CL0801
CL0802
CL0803
CL0804
CL0805
CL0806
CL0807
CL0808
CL0810
CL0811
CL0850
CL0851
CL1601
CL1602
CL1603
CL1604
CL1605
CL1606
CL1607
CL1608
CL1610
CL1611
CL309021
CL309042
CL310021
CL310042
CL312022
CL312044
CL316021
CL316042
CL320021
CL320042
CL325022
CL325042
CL328021
CL330021
CL413521
CL417021
CL420021
CL425021
CM5013
CN000100
CN000101
CN0018400
CN0032001
CN0160001
CN0220001
CN022701
CN100010
CN100011
CN1002005
CN1002008
CN1002009
CN1002010
CN1002011
CN1002016
CN10028
CN1030001
CN20305
CN20306
CN20368
CN20373
CN20374
CN20375
CN20376
CN3120010T
CN3160000T
CN810000
CN810300
CN810400
CN811000
CN811200
CN811500
CN812700
CN813700
CO32195
CO32995
CO329951
COX001
COX0010
COX002
COX0020
COX005
COX006
COX010
COX011
COX014
COX015
COX016
COX017
COX018
COX019
COX020
COX021
COX024
COX025
COX026
COX041
COX042
COX043

Pagina
260
260
260
260
260
260
260
260
260
260
260
260
260
260
260
260
260
258
258
258
258
257
257
257
257
257
257
258
258
258
258
258
258
258
258
258
258
258
258
258
258
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
224
226
226
226
226
226
226
226
226
226
226
226
226
226
226
226
226
226
226
311
320
320
346
346
346
346
346
347
347
346
347
347
347
347
346
347
346
346
346
346
347
347
347
347
320
320
346
346
346
346
346
346
346
346
227
227
227
250
250
250
250
252
252
252
252
250
250
250
250
253
253
253
253
251
251
251
251
251
251

Cod
COX044
COX045
COX046
COX047
COX048
CP2006
CP2007
CR128040
CR128050
CZ010112
CZ0102
CZ0106
CZ014445
DB195223
DB195323
DB195701
DB195703
DB195704
DB195707
DB220001
DB220006
DB220007
DB220901
DB220906
DB220907
DB226001
DB226003
DB226005
DB226007
DB227001
DB227003
DB227007
DB238507
DB238558
DB238719
DB238807
DB238858
DB238919
DB241301
DB241323
DB241419
DB241701
DB241723
DB241819
DB241902
DB244301
DB244323
DB244910
DB290001
DB290003
DB290006
DB290019
DB290101
DB290103
DB290106
DB290119
DB291906
DB291919
DB309510
DB4800
DB4804
DB4805
DB487023
DB487123
DB487201
DB487203
DB487205
DB487207
DB487223
DB487301
DB487323
DB487419
DB487519
DB494130
DB494131
DB494132
DB499501
DB499523
DB499601
DB499623
DB499701
DB499723
DB554001
DB557900
DB558737
DB563100
DB569100
DB569200
DB569300
DB570700
DB5708021
DB570902
DB571519
DB572102
DB573402
DB573819
DB575902
DB579819
DB583400
DB690802
DB760527
DB760727
DB761112
DB761212
DB761312
DB761412
DB771101
DB800219
DB8003190
DB80051925
DB807919
DB809419
DB809519
DB813701
DB813707
DB815219
DB82141925
DB857819
DB857919
DB861319
DB868419
DB868519
DB891000
DB891122
DB891201
DB891300
DB891402
DB891502
DB900003
DB900005
DB900007
DB900009
DB900021
DB900022
DB900023
DB945130
DB945131
DB945132
DH00502
DH00507
DH00508

Pagina
251
253
253
253
253
289
289
43
43
321
320
321
321
73
73
73
73
73
73
125
125
125
125
125
125
125
125
125
125
125
125
125
131
131
131
130
130
130
130, 152
130, 152
132
129, 152
129, 152
129, 130
129
129, 152
129
131
113
113
113
113
113
113
113
113
113
113
119
270
270
270
268
268
268
268
268
268
268
268
268
270
270
269
269
269
268
268
268
268
268
268
284
285
284
285
286
286
286
317
318
318
319
317
319
319
281
316
316
100
153
153
153
153
153
153
152
288
288
288
100
100
100
289
289
290
288
157
157
157
157
157
287
287
287
287
287
287
152, 160
152, 173
152, 159
152, 248
289
289
289
269
269
269
322
323
323

Cod
DH010860
DH010861
DH010870
DH010875
DH010876
DH022022
DH022092
DH022312
DH040025
DH040026
DH040028
DH095138
DH20790
DH961510
DH961520
DH961540
DH961580
DL3000
DL3001
DL3002
DL3003
DL301M
DL301N
DL301R
DL302M
DL302N
DL302R
DL303M
DL303N
DL303R
DL3041M
DL3041R
DL304M
DL304R
DL70030
DL70031
DO221202
DO221216
DO261202
DO261216
DO261602
DO261616
DO9306
DP1016
DS103C
DS103S
DS104C
DS104S
DS105C
DS105S
DS106C
DS106S
DS203S
DS204S
DS205S
DS206S
DS403C
DS403S
DS404C
DS404S
DS405C
DS405S
DS406C
DS406S
DS413C
DS413S
DS414C
DS414S
DS415C
DS415S
DS416C
DS416S
DS423S
DS424S
DS425S
DS426S
DS433S
DS434S
DS435S
DS436S
DV000102
DV000103
DV000104
DY000300
DY000351
DY00036
DY000361
DY00037
DY00038
DY00039
DY00040
DY001201
DY001203
DY001204
DY200101
DY200102
DY200103
DY200201
DY200202
DY200203
DY200301
DY200302
DY200303
ED000231
ED000232
ED000241
ED000242
ED083001
ED083002
ED083003
ED084001
ED084002
ED084003
ED11
ED12
ED13
ED1401
ED1402
ED1403
ED1411
ED1412
ED1413
ED1421
ED1422
ED1423
ED1515
ED20001
ED20002
ED20003
ED21851
ED21852
ED21853
ED21854
ED218553
ED218554
ED21901
ED21902
ED21903
ED21904
ED280001
ED280002

Pagina
171
171
171
171
171
326
326
325
170
170
170
280
328
272
272
272
272
259
259
259
259
123
123
123
123
123
123
123
123
123
123
123
123
123
123
123
80
80
80
80
80
80
80
345
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
122
34
34
34
110
103
103
103
103
103
103
103
126
126
126
124
124
124
126
126
126
107
107
107
213
213
213
215
201
201
201
203
203
203
204
204
204
202
202
202
202
202
202
202
202
202
213
205
205
205
186
186
186
186
186
186
187
187
187
187
197
197

Cod
ED280003
ED280004
ED280005
ED300/4
ED3001
ED3002
ED3003
ED3004
ED3301
ED3302
ED3303
ED34510
ED34511
ED34512
ED345400
ED3455
ED3456
ED3459
ED3701
ED3702
ED3703
ED3704
ED380001
ED380002
ED380003
ED380004
ED380005
ED3901
ED3902
ED3903
ED3904
ED4001
ED4002
ED4003
ED409001
ED409002
ED409003
ED409004
ED409005
ED409006
ED5001
ED5002
ED5003
ED5004
ED68001
ED68002
ED68003
ED68004
ED7000
ED7500
ED7501
ED7502
ED7503
ED7504
ED7505
ED75053
ED75054
ED7800
ED7801
ED78053
ED78054
ED7900
ED7901
ED7902
ED7903
ED7904
ED7905
ED79053
ED79054
ED7910
ED7911
ED7912
ED7913
ED7914
ED7915
ED79153
ED79154
ED8001
ED8002
ED8003
ED80302
ED80303
ED8400
ED84002
ED84003
ED85001
ED85002
ED85003
ED85004
ED87501
ED87502
ED87503
ED87504
ED875049
ED87505
ED891
ED892
ED893
ED893000
ED9009
ED9018
ED909
ED918
ED94251
ED94252
ED94253
EL000500
EL000501
EL000502
EL000503
EL000504
EL000505
EL000506
EL000507
EL000508
EL000509
EL000510
EL000511
EL200001
EL200002
EN1678
EN2064
EP800501
EP800602
EP800700
EP800803
EP801100
EP801103
EP801201
EP801302
EP801402
EP801601
EP911
EP915
EP933
EP999
FA000100
FA000101
FA000221
FA000222
FA000223

Pagina
197
197
197
206
206
206
206
206
206
206
206
209
209
209
209
209
209
209
205
205
205
205
196
196
196
196
196
204
204
204
204
205
205
205
201
201
201
201
201
201
204
204
204
204
188
188
188
188
213
199
199
199
199
199
199
199
199
199
199
199
199
200
200
200
200
200
200
200
200
200
200
200
200
200
200
200
200
204
204
204
201
201
203
203
203
186
186
186
186
200
200
200
200
200
200
189
189
189
189
171
171
171
171
207
207
207
58
58
58
58
59
59
59
59
59
59
58
58
57
57
52
51
347
347
347
347
347
347
347
347
347
347
347
347
347
347
96
96
101
101
101

Cod
FA000224
FA000225
FA000226
FA000227
FA000241
FA000242
FA000243
FA000244
FA000245
FA000246
FA000247
FA000250
FA000251
FA026501
FA026502
FA026503
FA026504
FA026505
FA026506
FA026507
FA026508
FA026509
FA026510
FA026511
FA026801
FA026802
FA026803
FA026804
FA026805
FA026806
FA026807
FA026808
FA026809
FA026810
FA026811
FA028501
FA028502
FA028503
FA028504
FA028505
FA028801
FA028802
FA028803
FA028804
FA028805
FA029501
FA029502
FA029503
FA029504
FA029505
FA029506
FA029510
FA029511
FA029512
FA029513
FA029514
FA029801
FA029802
FA029803
FA029804
FA029805
FA029806
FA029810
FA029811
FA029812
FA029813
FA029814
FA0361
FA0362
FA0363
FA03641
FA041
FA05121
FA05221
FA05321
FA05421
FA0661
FA0662
FA0663
FA0664
FA0665
FA0671
FA0672
FA0673
FA0674
FA0675
FA0681
FA0723
FA073
FA0741
FA0902
FA0903
FA0904
FA0905
FA0906
FA0912
FA0913
FA0914
FA0915
FA0916
FA0922
FA0923
FA0924
FA0925
FA0926
FA0932
FA0933
FA0934
FA0935
FA0936
FA09402
FA09403
FA09404
FA09405
FA09406
FA095
FA09502
FA09503
FA09504
FA09505
FA09506
FA0952
FA0953
FA0954
FA0955
FA0956
FA096
FA09600
FA0962
FA0963
FA0964
FA0965
FA097
FA0972
FA0973
FA0975
FA0976
FA0981
FA099
FA100111
FA100112

Pagina
101
101
101
101
101
101
101
101
101
101
101
127
127
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
93
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
96
102
102
102
102
100
103
103
103
103
98
98
98
98
98
98
98
98
98
98
99
117
248
248
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
121
119
121
121
121
121
121
118
118
118
118
118
118
118
118
118
118
118
118
118
118
118
118
119
119
127
127

index coduri
Cod
FA100113
FA100114
FA100210
FA200101
FA200102
FA200103
FA200104
FA200111
FA200112
FDAG01
FDAG02
FDAG03
FDAG05
FDAG06
FDBC010
FDBC011
FDBC012
FDBC020
FDC001
FDC005
FDC009
FDC011
FDCC0020
FDCC006
FDCC007
FDCC010
FDCC012
FDCC018
FDCC031
FDCC032
FDCC045
FDCC046
FDCC069
FDCC28
FDCO04
FDCO56
FDCO57
FDEL001
FDEL905
FDIN006
FDIN008
FDIN013
FDIN113
FDLI04
FDLI05
FDLI06
FDLI07
FDLI08
FDLI09
FDLI17
FDLI18
FDLI21
FDLI22
FDLI23
FDPS0005
FDPS0006
FDPS0007
FDPS001
FDPS25
FDPS35
FDPS36
FDTB001
FDTB002
FDWH001
FDWH003
FDWH011
FK0101
FK024
FK033
FK034
FK039
FK0391
FK040
FK118
FK133
FK149
FK150
FK156
FK160
FK161
FK162
FK163
FK164
FK173
FK174
FK175
FK176
FK177
FK178
FK1781
FK183
FK184
FK308
FK3081
FK31200
FK320
FK321
FK424
FK432
FK5950
FK5951
FK5952
FK5953
FK64016H
FK64016S
FL000100
FL000101
FL000102
FL000103
FL000200
FL000201
FL000202
FL000203
FL00037
FL000371
FL3001
FL6897
FL6898
FL6899
FL6900
FL6901
FL6902
FL696
FL6961
FL6999
FL910
FMK3300
FMK3500
FMK5300
FMK5500
FMK65012
FMK65013
FMK65014
FR050101
FT000401
FT000402
FT000403
FT000407
FT000411
FT000412

Pagina
127
127
110
112
112
112
112
112
112
23
23
23
23
23
25
25
25
25
25
26
26
26
25
26
26
26
26
25
27
27
27
27
26
25
25
27
27
18
18
24
24
24
24
22
22
22
22
22
22
22
22
22
22
22
26
26
26
26
27
27
27
19
19
23
23
23
339
348
348
348
339
339
339
338
339
339
341
338
339
339
339
339
338
338
338
338
338
338
339
339
348
340
341
341
338
341
341
348
338
341
341
341
341
348
348
156
156
156
156
156
156
156
156
131
131
132
159
159
159
159
159
159
248
248
159
174
77
77
77
77
77
77
77
315
388
388
388
388
388
388

Cod
FT000414
FT000420
FT000701
FT000702
FT000703
FT000707
FT000711
FT000720
FT100100
FT100401
FT100402
FT100403
FT100407
FT100420
FT100801
FT100802
FT100803
FT100805
FT100806
FT100807
FT100808
FT100811
FT100812
FT100820
FT100821
FT100901
FT100902
FT100903
FT100906
FT100908
FT100911
FT100912
FT100914
FT100916
FT100920
FT200101
FT200102
FT200103
FT200104
FT200105
FT200108
FT200110
FT200111
FT200112
FT200114
FT200116
FT200120
FT200121
FT200122
FT200123
FT200201
FT200202
FT200203
FT200205
FT200206
FT200207
FT200208
FT200209
FT200211
FT200212
FT200214
FT200218
FT200219
FT200220
FT200221
FT200222
FT200902
FT200914
FT200920
FT200925
FT200926
FT200927
FT300701
FT300703
FT300705
FT300711
FT300712
FT400101
FT400103
FT400104
FT400105
FT400109
FT400111
FT400112
FT400116
FT400121
FT400128
FT400129
FT400201
FT400202
FT400203
FT400204
FT400205
FT400206
FT400209
FT400211
FT400212
FT400214
FT400220
FT400228
FT400230
FT600561
FT600751
FT600832
FT600841
FT600842
FT600843
FT600844
FT600845
FT600846
FT600850
FT600951
FT700203
FT700204
FT700205
FT700345
FT700524
FT700696
FT800101
FT800102
FT800103
FT800104
FT800105
FT800106
FT800107
FT800108
FT800109
FT800110
FT800111
FT800112
FT800113
FT800114
FT800115
FT800116
FT800117
FT800118
FT800119
FT800120
FT800121
FT800122

Pagina
388
388
389
389
389
389
389
389
388
390
390
390
390
390
391
391
391
391
391
391
391
391
391
391
391
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
65, 67, 394
394
394
394
394
394
394
394
394
394
394
394
394
394
394
394
391
391
391
391
391
391
391
391
391
391
391
391
391
391
391
391
392
392
392
392
392
392
391
391
391
391
391
395
395
395
395
395
395
395
395
395
395
395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
65, 67, 395
390
389
388
390
390
390
390
390
390
388
389
384
384
384
391
389
389
384
384
384
384
385
385
385
385
385
385
385
385
385
385
385
385
385
385
385
386
386
386

Cod
FT800204
FT800205
FT800206
FT800207
FT800208
FT800210
FT800211
FT800212
FT800213
FT800214
FT800215
FT800300
FT800301
FT800302
FT800303
FT800304
FT800305
FT800306
FT800307
FT800308
FT800309
FT800310
FT800311
FT800312
FT800313
FT800314
FT800315
FT800316
FT800317
FT800318
FT800319
FT800320
FT800321
FT800322
FT800323
FT800324
FT800325
FT800326
FT800331
FT800332
FT800333
FT800334
FT800335
FT800336
FT800337
FT800338
FT800339
FT800340
FT800341
FT800342
FT800343
FT800400
FT800401
FT800402
FT800403
FT800404
FT800405
FT800406
FT800407
FT800408
FT800409
FT800410
FT800411
FT800412
FT800413
FT800414
FT800415
FT800416
FT800417
FT800418
FT800419
FT800420
FT800421
FT800422
FT800423
FT800500
FT800501
FT800502
FT800503
FT800504
FT800505
FT800506
FT800507
FT800508
FW000101
FW000300
FW000301
FW000302
FW000400
FW000401
FW000402
FW000403
FW000404
FW000405
FW000406
FW000407
FW000500
FW000501
FW000600
FW000700
FW000800
FW000801
FW000802
FW000803
FW000900
FW000901
FW000902
FW000903
FW001000
FW001001
FW002001
FW002003
FW002007
FW002008
FWS0002
FWS0005
FWS0006
FWS0007
FWS0014
FWS0021
FWS0022
FWS0100
GL000105
GL000400
GL000401
GL000402
GL000504
GL000600
GL000804
GL000918
GL000920
GL000921
GL000922
GL000938
GN010104
GN010105
GN010213
GN010214
GN020204
GN020205

Pagina
388
388
388
388
388
392
392
392
392
392
392
385
385
385
385
385
386
386
386
386
386
386
392
392
392
392
392
392
392
392
392
392
392
392
390
390
390
390
390
390
390
390
390
391
391
391
391
391
389
389
389
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
393
323
324
324
324
325
326
325
326
328
328
328
328
334
334
334
334
331
331
331
330
322
322
322
322
323
323
312, 382
312, 382
313
312
312, 382
312, 382
313
313
312
312
312
313
24
56
56
56
41
52
24
33
56
56
56
33
311
311
311
311
310
310

Cod
GN020206
HF000100
HI112416
HI112417
HI113716
HI113717
HI222411
HI222412
HI223711
HI2324111
HI2324123
HI24241234
HP1398
HP1444
HP611600
HP711600
HP800001
HP800002
HP800003
HP800201
HP800202
HP800203
HP800300
HP800301
HP800402
HP800500
HP800501
HP800502
HP800503
HP800504
HP800600
HP800603
HP800704
HP800804
HP800901
HP800902
HP800903
HP801202
HP801301
HP801303
HP802500
HP802600
HP802800
HP803000
HP803400
HP803600
HP810202
HP810302
HP810303
HP810401
HP810403
HP810501
HP810502
HP810602
HP810603
HP810700
HP810701
HP810702
HP810703
HP810800
HP810801
HP810803
HP810901
HP810903
HP811001
HP811003
HP811100
HP811200
HP811300
HP811500
HP812000
HP812200
HP812201
HP812202
HP812203
HP812300
HP812301
HP812302
HP812303
HP812400
HP812402
HP812403
HP812500
HP812501
HP812502
HP812503
HP812601
HP812602
HP812603
HP812701
HP812800
HP812801
HP812802
HP812803
HP812900
HP813500
HP813800
HP814300
HP814400
HP814600
HP971
HP981
HP988
HP9881
HS01651
HS01653
HS01654
HS01655
HS01657
HS01658
HS0176
HS01851
HS01853
HS01854
HS01855
HS01857
HS01858
HS02111
HS02113
HS02114
HS02115
HS02116
HS02118
HS02121
HS02123
HS02124
HS02125
HS02126
HS02128
HS25530
HS25533
HS25534
HS25830
HS25833
HS25834
HX000100
HX000101
HX000200
HX000201
HX000202

Pagina
310
33
229
229
229
229
229
229
229
229
229
229
227
227
302
302
343
343
343
344
344
344
342
344
344
343
344
344
344
342
342
344
342
344
344
344
344
344
344
344
344
344
344
344
344
344
338
338
338
338
338
338
340
340
340
338
340
340
340
338
340
340
340
340
340
340
338
338
338
340
340
340
341
341
341
339
340
340
340
339
340
340
341
340
341
341
341
341
341
341
340
338
338
338
340
339
340
341
341
338
227
227
227
227
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
99
101
101
101
101
101
101
29
29
28
28
29

Cod
HX000303
HX000304
HX000501
HX000503
HX000507
HX000508
HX000509
HX000620
HX000701
HX000702
HX000703
HX000704
HX000710
HX000712
HX000713
HX000907
HX000908
HX000909
HX000919
HX004000
HX006000
HX006001
HX011000
HX013000
HX021000
HY000100
HY000200
HY000300
HY000301
IAMB999
IEL0025
IEL0026
IEL0027
IG00113
IG00131
IG00132
IG00138
IG00151
IG00152
IG001557
IG00158
IG002200
IG002210
IG002220
IG002230
IG011813
IG1060
IG10960
IG1103
IG2000
IG2001
IG2002
IG2003
IG2004
IG5101
IG5105
IG5201
IG5202
IG5205
IG5206
IG5301
IG5302
IG5601
IG5602
IG5701
IG5702
IG5703
IG5721
IG5745
IG5769
IG5801
IG5802
IG5813
IG5903
IG5905
IG5913
IG5920
IG5950
IG5954
IG5959
IG5960
IG5961
IG5963
IG5964
IG5973
IG6001
IG6004
IG6482
IG9186
IG9201
IG9202
IG9203
IG9204
IG94008
IG9405
IG9406
IG9407
IG9475
IGCR001
IGCR002
IGCR12
IGCR14
IGCR15
IGCR16
IGCR19
IGCR22
IGCR23
IGCR241
IGCR25
IGCR271
IGCR28
IGCR29
IGCT101
IPH271969
IPH702678
IPH702715
IRX011
IRX012
IRX013
IRX016
IRX017
IRX020
IV000100
IV000101
IV000600
JD000100
JD000101
JD000102
JD000103
JD000104
JD000105
JD000106
JD000200
JD000201
JD000202
JX000500
JX000501
JX000510
JX000511
JX000512

Pagina
31
31
28
30
30
30
30
29
30
30
29
29
28
28
28
52
41
52
31
38
28
28
29
29
28
43
43
34
31
82
51
51
51
38
43
43
43
42
42
32
42
37
37
37
37
51, 68, 70
24
51
32
81
81
81
81
81
35
35
35
35
35
35
41
41
40
40
47
47
47
24
24
24
36
36
24
35
35
35
35
32
32
33
35
35
35
35
51
34
55
49
49
24
24
24
24
24
24
24
24
24
39
46
47
41
41
46
41
40
36
36
43
41
34
34
43
76
76
76
54
54
54
54
54
54
46
46
39
44
44
44
45
45
45
45
44
45
45
35
35
35
35
35

Cod
KF10021
KF10025
KF10100
KF10101
KF1020
KF10210
KF10211
KF11110
KF11111
KF20200
KF20201
KF20211
KF20215
KF20221
KF20225
KF20300
KF20301
KF2110
KF2111
KF30100
KF30105
KF30115
KF30131
KF30136
KF30200
KF30205
KF30210
KF30215
KF30220
KF30225
KF30300
KF30305
KF30310
KF30315
KF30325
KF30345
KF30355
KF31110
KF31115
KF40131
KF40136
KF50100
KF50102
KF50110
KF50112
KF50131
KF50135
KF50210
KF50212
KF50220
KF50222
KF50320
KF50322
KF51110
KF51119
KF60100
KF60105
KF60131
KF60136
KF60205
KF60210
KF60225
KF60305
KF60405
KF70010
KF70015
KF70100
KF70105
KF70110
KF70115
KF70131
KF70135
KF70300
KF70305
KF70310
KF70315
KF70400
KF70405
KF70410
KF70415
KF80131
KF80135
KF80141
KF80145
KF80151
KF80155
KF80225
KF80235
KF80240
KS00010
KS00011
KS00012
KS000206
KS20220
KS20230
KS32401
KS32420
KS38101
KS53639
KS61109
KS62115
KS66119
KS66406
KS69101
KS69417
KS71003
KS71023
KS71033
KS72049
KS84030
KS84751
KS873340
KS873372
KS873425
KS873427
KS878050
KS878075
KS878125
KS879031
KS879032
KS879033
KS879041
KS879042
KS879043
KS879044
KS880000
LM010
LM011
LM012
LM013
LM014
LM016
LM018
LM019
LM021
LM022
LM023
LM024
LO00500
LO00800

Pagina
235
235
235
235
235
235
235
235
235
235
235
234
234
234
234
235
235
235
235
236
236
236
237
237
236
236
236
236
236
236
235
235
235
235
234
234
234
236
236
237
237
236
236
236
236
237
237
236
236
236
236
236
236
236
236
236
236
237
237
236
236
236
236
236
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
237
106
106
106
173
169
169
51
51
168
160
214
214
214
214
214
214
174
174
174
174
213
212
167
167
167
167
246
246
246
243
243
243
246
246
246
246
212
124
124
124
124
124
124
124
124
124
124
124
124
99
99

Cod
LP906
LP911
LR000001
LR000002
LR000003
LR000020
LR000021
LR000022
LR000030
LR000031
LR000044
LR000045
LW00101S
LW00102S
LW00105
LW00106
LW030101
LW030102
LW030103
LW030111
LW030112
LW030113
LW030120
LW030141
LW030142
LW030201
LW030202
LW030203
LW030204
LW030211
LW030212
LW030311
LW030312
LW030313
LW030401
LW030402
LW030403
LW030404
LW030405
LW030411
LW030412
LW030413
LW030414
LW030415
LW030501
LW030502
LW030503
LW030504
LW030510
LW030511
LW030512
LW030513
LW030521
LW030522
LW030523
LW030524
LW825033
LW850033
LX810400
LX813900
LX814000
LX814400
LX814500
LX815000
MD000100
MO000501
MO000601
MO000701
MO000801
MP2
MT100703
MT100704
NB000500
NB000600
NB000700
NB000800
NF1134
NF1173
NF1174
NF1180
NF1190
NF2282
NF2403
NF2404
NF2680
NF26800
NF2681
NF2682
NF3434
NF3443
NF3444
NF3454
NF3880
NP434900
NP434901
NP434902
NP434903
NP434904
NS000100
NS000101
NS000102
NS000103
NS000118
NS000119
NS000211
NS000212
NS000213
NS000214
NS000216
NS000217
NS000222
NS000226
NS000300
NS000301
NS000302
NV002500
NV002501
NV002502
NV022500
NV022501
NV022502
NV0361
NV1022
NV1025
NV1242
NV1245
NV12480
NV12482
NV12485
NV16030
NV16031
NV16035
NV16036
NV1673S
NV1717
NV1737
NV1841
NV1845
NV1854
NV2210

Pagina
371
371
34
34
34
34
34
34
48
48
48
48
84
84
84
84
194
194
194
194
194
194
194
195
195
210
210
210
210
211
211
188
188
188
209
209
209
209
209
209
209
209
209
209
207
207
207
207
207
197
197
197
207
207
207
207
87
87
348
348
348
348
348
348
33
299
299
299
299
173
86
86
292
292
292
292
224
219
219
220
220
221
221
221
227
227
227
227
223
223
223
223
221
86
86
86
86
86
24
19
19
19
19
19
20
20
20
20
20
20
20
20
20
20
20
135
135
135
135
135
135
149
139
139
139
139
143
143
143
140
140
140
140
143
147
144
145
145
145
151

Cod
NV22310
NV22313
NV22317
NV22319
NV2236
NV2238
NV2246
NV2247
NV2248
NV2266
NV3208
NV321601
NV321605
NV32200
NV322001
NV32252
NV32255
NV3240
NV3260
NV3265
NV33000
NV33001
NV33005
NV33006
NV340001
NV340002
NV340005
NV340101
NV340105
NV340106
NV340201
NV340205
NV340206
NV3425
NV350001
NV350002
NV350005
NV400040
NV400041
NV400042
NV400060
NV400061
NV400062
NV6108
NV6119
NV75310
NV75312
NV75314
NV7538
OF000100
OF000101
OF090107
OF090109
OF090207
OF090209
OF090307
OF090309
OF090407
OF090409
OF090507
OF090509
OF090607
OF090609
OF090707
OF090709
OF090807
OF090809
OF090907
OF090909
OF100107
OF100109
OF100110
OF100111
OF100112
OF100207
OF100209
OF100210
OF100211
OF100212
OF100307
OF100309
OF100310
OF100311
OF100312
OF1006
OF110107
OF110109
OF110110
OF110111
OF110112
OF110207
OF110209
OF110210
OF110211
OF110212
OF110307
OF110309
OF110310
OF110311
OF110312
OF120107
OF120109
OF120110
OF120111
OF120112
OF120207
OF120209
OF120210
OF120211
OF120212
OF120307
OF120309
OF120310
OF120311
OF120312
OF1206
OF130107
OF130109
OF130110
OF130111
OF130112
OF130207
OF130209
OF130210
OF130211
OF130212
OF130307
OF130309
OF130310
OF130311
OF130312
OF140107
OF140109
OF140110
OF140111
OF140112
OF140207
OF140209
OF140210
OF140211

Pagina
151
151
151
151
151
151
151
151
151
151
149
139
139
148
148
139
139
150
150
149
140
140
140
140
140
140
140
143
143
143
144
144
144
150
140
140
140
135
135
135
135
135
135
147
147
151
151
151
151
381
381
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
366
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
364
366
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365

Cod
OF140212
OF140307
OF140309
OF140310
OF140311
OF140312
OF1406
OF150107
OF150109
OF150110
OF150111
OF150112
OF150207
OF150209
OF150210
OF150211
OF150212
OF150307
OF150309
OF150310
OF150311
OF150312
OF160107
OF160109
OF160110
OF160111
OF160112
OF160207
OF160209
OF160210
OF160211
OF160212
OF160307
OF160309
OF160310
OF160311
OF160312
OF1606
OF170107
OF170109
OF170110
OF170111
OF170112
OF170207
OF170209
OF170210
OF170211
OF170212
OF170307
OF170309
OF170310
OF170311
OF170312
OF180107
OF180109
OF180110
OF180111
OF180112
OF180207
OF180209
OF180210
OF180211
OF180212
OF180307
OF180309
OF180310
OF180311
OF180312
OF1806
OF190107
OF190109
OF190110
OF190111
OF190112
OF1936
OF1937
OF1996
OF1997
OF200107
OF200109
OF200110
OF200111
OF200112
OF210107
OF210109
OF210207
OF210209
OF220107
OF220109
OF220207
OF220209
OF220307
OF220309
OF230107
OF230109
OF230207
OF230209
OF230307
OF230309
OF240107
OF240109
OF240207
OF240209
OF240307
OF240309
OF250107
OF250109
OF250207
OF250209
OF250307
OF250309
OF260107
OF260109
OF260207
OF260209
OF260307
OF260309
OF270107
OF270109
OF270207
OF270209
OF270307
OF270309
OF280107
OF280109
OF280207
OF280209
OF280307
OF280309
OF290107
OF290109
OF290207
OF290209
OF290307
OF290309
OF300107
OF300109
OF300207
OF300209
OF300307

Pagina
365
365
365
365
365
365
366
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
366
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
366
365
365
365
365
365
367
367
366
366
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365
365

index coduri
Cod
OF300309
OF3006
OF3007
OF3086
OF310107
OF310109
OF3286
OF3886
OF3887
OF3896
OF3897
OI000100
OI000200
OI0202
OI0235
OI0237
OI22102
OI30301
OI4001
OI4002
OI4411
OI4421
OI4431
OI4441
OI57375
OI77101
OI9111
OI9119
OL150380100
OM010100
OM010101
OM010104
OM020100
OM020101
OM020103
PA6297
PE101000
PE101001
PE101002
PE101010
PE101011
PE101012
PE101100
PE101101
PE101102
PE101110
PE101111
PE101112
PE101200
PE101201
PE101202
PE101210
PE101211
PE101212
PE101230
PE101231
PE101232
PE101240
PE101241
PE101242
PE101500
PE101501
PE101502
PE101600
PE101601
PE101602
PE101700
PE101701
PE101702
PE102130
PE102131
PE102132
PE102170
PE102171
PE102172
PE103100
PE103101
PE103102
PE103220
PE103221
PE103222
PE105131
PE105132
PE417000
PE417001
PE417002
PG000100
PG000101
PG000102
PG000500
PG000501
PG000502
PG000503
PG000600
PG000601
PG000602
PG000603
PL4411
PL4414
PL5211
PL5212
PL5213
PL52131
PL52132
PL5218
PL5528
PL5529
PL5590
PL5591
PL5592
PL5625
PL575700
PL575702
PL575703
PL575705
PL575706
PL575708
PL575709
PL575710
PL575800
PL575801
PL575802
PL5810
PL6411
PL6721
PL686101
PL686104
PL690203
PL690204
PL691101
PL691103
PL691300
PM130
PM136
PM138
PM139
PM149
PM150
PM152
PM153

Pagina
365
367
367
367
364
364
367
367
367
367
367
52
52
51
52
52
53
53
56
56
56
56
56
56
49
53
52
53
132
314
314
314
314
314
314
248
183
183
183
183
183
183
183
183
183
183
183
183
182
182
182
182
182
182
182
182
182
187
187
187
183
183
183
183
183
183
183
183
183
186
186
186
182
182
182
195
195
195
192
192
192
210
210
192
192
192
38
38
38
35
35
35
35
75
75
75
75
379
379
380
380
380
380
380
380
378
378
376
377
377
380
374
375
379
376
376
378
377
380
375
381
381
377
375
375
374
374
378
378
374
374
376
338
342
342
342
342
342
342
342

Cod
PM161
PM162
PM163
PM169
PM170
PM173
PM174
PM176
PM177
PM193
PM215
PM221
PM223
PM224
PM235
PM2352
PM236
PM237
PM238
PM248
PM2481
PM250
PM336
PM337
PM350
PM350XL
PM351XL
PM367
PM368
PM369
PM370
PM371
PM372
PM373
PM375
PM376
PM377
PM378
PM379
PM380
PM381
PM382
PM383
PN010200
PP000101
PP000102
PP000103
PP110801
PP110802
PP110803
PR000104
PR000105
PR000106
PR000107
PR000108
PR000109
PR000110
PR000111
PR000112
PR000113
PR000114
PR000119
PR000200
PR000202
PR000203
PR000219
PR000807
PR000808
PR000809
PR000900
PR000934
PR000937
PS0015
PS0080
PS0081
PS0082
PS0083
PS100554
PS10223
PS10224
PS10225
PS102443
PS102454
PS10300
PS1032
PS1033
PS10343
PS103654
PS1038
PS110094
PS110096
PS121500
PS125100
PS14202
PS14204
PS152800
PS152900
PS159000
PS159100
PS159200
PS186100
PS210500
PS4305
PS531554
PS531560
PS544754
PS544760
PS710
PS810
PT000900
PT000901
PT020140
PV010401
PV010402
PV010403
PV010404
RB0103N
RB037611
RB04574
RB04761
RB053810
RB05571
RB05573/5
RC610000
RC610001
RC610101
RC9212201
RE000403
RE001319
RE002661
RE009184
RE009185
RE010508
RE010509
RE020010
RE020012
RE021011
RE022011
RE022012
RE022013

Pagina
342
342
342
343
343
343
343
342
342
343
342
342
342
342
342
342
342
342
342
344
344
344
343
343
343
343
343
342
342
344
344
344
344
343
343
343
343
342
342
344
344
344
344
309
194
194
194
206
206
206
54
54
54
54
54
54
54
54
54
55
55
55
72
72
72
55
53
53
53
52
55
55
196
264
264
264
264
273
272
272
272
276
276
281
282
282
279
271
280
196
196
282
280
277
277
263
263
265
265
265
283
271
276
279
279
279
279
277
277
33
47
47
290
290
290
290
228
228
228
228
228
228
228
304
304
304
382
61
69
60
64
64
62
62
61
69,70
61
68
67,71
69,70

Cod
RE022014
RE023010
RE023011
RE023013
RE023020
RE023021
RE023022
RE023023
RE023024
RE023025
RE023026
RE023027
RE024011
RE025010
RE026010
RE026011
RE030004
RE030014
RE030024
RE031000
RE031001
RE031002
RE031003
RE035000
RE035001
RE035002
RE035003
RE041000
RE041001
RE041002
RE041003
RE041200
RE041201
RE041202
RE041203
RE042000
RE042001
RE042005
RE042200
RE042201
RE042202
RE042203
RE043000
RE043001
RE043002
RE043003
RE043100
RE043101
RE043102
RE043105
RE043106
RE043107
RE043108
RE044130
RE044131
RE044132
RE044133
RE044134
RE100100
RE101009
RE102010
RE120000
RE123010
RE155100
RE155600
RE180100
RE211200
RE211201
RE211202
RE211203
RE211204
RE211205
RE211206
RE211300
RE211301
RE211302
RE211303
RE211304
RE211305
RE211306
RE223010
RE263300
RE290337
RE290338
RE290339
RE290340
RE290341
RE305001
RE305002
RE305003
RE305004
RE311600
RE407901
RE407902
RE407903
RE407904
RE500000
RE816000
RE907401
RE907402
RE907403
RE908116
RE908117
RE908118
RE908119
RE908120
RE908321
RE908420
RE908422
RE908423
RE908424
RE908425
RE908900
RE908901
RE908902
RE908903
RE909201
RE909220
RE909221
RE909222
RE909223
RE909224
RE919900
RH1000
RH1001
RH1002
RH1003
RH1004
RH1005
RH1006
RH1007
RH1008
RH1009
RH1010
RH1011
RH1012
RH1013
RK000200
RK000400
RK000401

Pagina
70
68,70
62
62, 68
62,68
62,68
62,68
62,68
62,68
62,68
62,68
62,68
60
61
64
64
70
70
70
65
65
65
65
65
65
65
65
66, 71
66, 71
66, 71
66, 71
63
63
63
63
64
64
64
63
63
63
63
64
64
64
64
67,71
67,71
69,71
69,71
69,71
67,71
67,71
63
63
63
63
63
72
62
61
61
68,70
62
62
62
63
63
63
63
63
63
63
63
63
63
63
63
63
63
68,70
61
69
69
69
69
69
64
64
64
64
71
67
67
67
67
62
60
67
67
67
65
65
65
65
65
66,71
65
65
65
65
65
65
65
65
65
66, 71
66
66
66
66
66
64
241
241
241
241
241
241
241
241
241
241
241
241
241
241
38
42
42

Cod
RK000500
RO033210
RO033211
RO033213
RO033216
RO502003
RO502007
RO502011
RO502015
RO502020
RO502025
RO502045
RO502107
RO505506
RO505507
RO505508
RO505707
RO505708
RO505908
RP0011
RP0020
RP00200
RP00201
RP00221
RP00222
RP00230
RP0030
RP00401
RP00501
RP00511
RQ017411
RQ017412
RQ017413
RQ017414
RQ041411
RQ041412
RQ048111
RQ048112
RQ048121
RQ048122
RQ048211
RQ048212
RQ048213
RQ049211
RQ049212
RQ049221
RQ049222
RQ092210
RX1380
RX1479
RX1480
RX1481
RX1801
RX1803
RX1804
RX1805
SC550066
SE000101
SE000102
SE000103
SE000104
SE000131
SE000201
SE000202
SE000203
SE000301
SE000302
SE000303
SE000401
SE000402
SE000404
SE000407
SE000502
SE000503
SE000504
SE000601
SE000602
SE000603
SE000604
SE000701
SE000702
SE000703
SE000801
SE000802
SE000803
SE000804
SE000901
SE000902
SE002512
SE2241
SE2242
SE25740
SE25741
SE25742
SE25743
SE25744
SE26000
SE26003
SE2803
SE2804
SE6239
SE800040
SE800041
SE800080
SF000005
SF001
SF0011
SF004
SF700000
SF700002
SF700007
SG100000
SG100100
SG100101
SG100200
SG100201
SG100300
SG100301
SG100400
SG100401
SG100402
SG100500
SG100501
SG100503
SG100600
SG100601
SG100700
SG100800
SG100801
SG100802
SG100900
SG101000
SG102000
SI000401
SI000501
SI000601
SL000080
SL000081
SL000082
SL000129

Pagina
48
190
190
190
190
210
210
210
210
210
210
210
210
211
211
211
211
211
211
113
112
112
112
112
112
110
113
113
113
107
172
172
172
172
216
216
216
216
216
216
216
216
216
195
195
195
195
173
225
225
225
225
227
227
227
227
85
195
195
195
195
190
186
186
186
187
187
187
189
189
189
189
191
191
191
191
191
191
191
187
187
187
209
209
209
209
211
211
180
181, 384
181, 384
191, 386
191, 386
191, 386
191, 386
191, 386
191, 386
191, 386
181, 384
181, 384
180
181
181
181
308
81
81
81
308
308
308
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
275
298
298
298
128
128
128
124

Cod
SL000130
SL000131
SL000132
SL000133
SL000134
SL000153
SL000159
SL000161
SL000177
SL0001771
SL000178
SL000179
SL000180
SL0001801
SL008211
SL008212
SL008221
SL008222
SL008231
SL008232
SL008241
SL008242
SL008251
SL008252
SL008261
SL008262
SL008311
SL008312
SL008321
SL008322
SL020102
SL020103
SL020106
SL020107
SL020108
SL020109
SL020202
SL020203
SL020207
SL020208
SL020209
SL020216
SL020502
SL020503
SL020504
SL020505
SL020506
SL020508
SL020522
SL020523
SL020524
SL020525
SL020526
SL020528
SL020603
SL020605
SL020606
SL020607
SL020608
SL020609
SL020613
SL020615
SL020616
SL020617
SL020618
SL020619
SL020702
SL020703
SL020706
SL020707
SL020708
SL020709
SL020802
SL020803
SL020806
SL020807
SL020808
SL020809
SL030201
SL030202
SL030203
SL030204
SL030206
SL080110
SL080111
SL080903
SL080904
SL080920B
SL080921B
SL080923B
SL080924B
SL080925B
SL080930
SL080931
SL080932
SL081000
SL081001
SL081002
SL081013
SL081014
SL081017
SL081018
SL081019
SL081023
SL081024
SL081027
SL081028
SL081029
SL081110
SL081111
SL081112
SL081113
SL081114
SL083110
SL083111
SL083112
SL090805
SL090806
SL090807
SL091005
SL091006
SL091212
SL091213
SL091214
SL091251
SL091252
SL091255
SL091256
SL091257
SL091755
SL091756
SL092505
SL093102
SL093103
SL093105
SL093106
SL093107
SL094912
SL101011
SL1101

Pagina
124
124
124
124
124
108
110
108
126
126
126
126
126
126
154
154
154
154
154
154
154
154
154
154
154
154
154
154
154
154
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
254
101
101
101
101
101
117
117
126
126
116
116
116
116
116
112
112
112
155
155
155
155
155
155
155
155
155
155
155
155
155
55, 155
55, 155
55, 155
55, 155
55, 155
155
155
155
335
335
335
335
335
332
332
332
335
335
335
335
335
335
335
335
336
336
336
336
336
120
330
95

Cod
SL1102
SL1103
SL1104
SL1105
SL1106
SL1107
SL1108
SL1109
SL1110
SL1111
SL1116
SL1117
SL1118
SL1119
SL1120
SL1121
SL1201
SL1202
SL1203
SL1204
SL1205
SL1206
SL1207
SL1208
SL1209
SL1210
SL1211
SL1216
SL1217
SL1218
SL1219
SL1220
SL1221
SL1301
SL1302
SL1303
SL1304
SL1305
SL1306
SL1307
SL1308
SL1309
SL1310
SL1311
SL1401
SL1402
SL1403
SL1404
SL1405
SL1406
SL1407
SL1408
SL1409
SL1410
SL1411
SL1412
SL1413
SL1501
SL1502
SL1503
SL1504
SL1505
SL1511
SL1512
SL1513
SL1514
SL1515
SL1802400
SL200300
SL200301
SL200302
SL200303
SL200304
SL200305
SL200306
SL2006B
SL2007B
SL2008B
SL2009B
SL20181B
SL2018B
SL2025
SL2034
SL2035
SL2042
SL2049
SL20501
SL20511
SL20521
SL27353
SL27355
SL3003
SL3006
SL3011
SL3016
SL3017
SL3018
SL4001
SL4002
SL4003
SL4004
SL4005
SL4006
SL4008
SL4021
SL4022
SL4023
SL4024
SL4025
SL40611
SL40612
SL40691
SL40692
SL5100
SL5102
SL5104
SL5108
SL5129
SL56043
SL56045
SL56047
SL641401
SL641402
SL647701
SL647702
SL700100
SL700200
SL700300
SL700400
SL700500
SL700600
SL700700
SL700800
SL700900
SL701000
SL701100
SL701200
SL701300
SL701500
SL701501

Pagina
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
95
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
98
92
92
92
92
92
92
92
92
92
92
148
114
114
114
114
114
114
114
115
115
115
115
115
115
115
108
107
111
111
109
109
109
128
128
80
80
80
80
80
80
102
102
102
102
102
102
102
102
102
102
102
102
127
127
156
156
79
79
79
79
80
128
128
128
190, 279
190, 279
190, 279
190, 279
78
78
79
79
79
79
79
79
79
79
79
79
79
79
79

Cod
SL701502
SL701600
SL701601
SL701602
SL701700
SL701800
SL701900
SL801000
SL801001
SL801002
SL801003
SL801005
SL801006
SL801007
SL801008
SL801009
SL801010
SL801011
SL801200
SL801201
SL801202
SL801203
SL801301
SL801302
SL801303
SL801400
SL801500
SL802000
SL802001
SL802002
SL802003
SL802005
SL802006
SL802007
SL802008
SL802009
SL802010
SL802011
SL802200
SL802201
SL802202
SL802203
SL802301
SL802302
SL802303
SL802500
SL802501
SL802502
SL803000
SL803100
SL803200
SL803300
SL803400
SL803500
SL804101
SL804102
SL804201
SL804202
SL890001
SL890002
SL890003
SL890004
SL890005
SL890006
SL968960
SL991000
SL991001
SL999937
SL999938
SL999941
SL999942
SL999943
SL999946
SL999947
SL999996
SL999997
SL999998
SL999999
SM810000
SM810100
SM810800
SM811000
SM811400
SM811500
SM811700
SM812200
SM812300
SM812400
SM812600
SM813600
SM813900
SMS142
SMS210
SN000100
SN000102
SN000115
SN000120
SN000300
SN000302
SN000400
SN000402
SN000403
SN000500
SN000600
SN000801
SN000802
SN000803
SN000812
SN000814
SN000816
SN001001
SN040000
SN077101
SR020001
SR020003
SR020005
SR030000
SR040000
SR2311
SR2313
SR2401
ST16023
ST16024
ST1700
ST300400
ST300402
ST300403
ST300407
ST300411
ST300425
ST300435
ST300436
SW117004
SW117006
SW117024
SW117031
SW117033
SW117040
SW117054
SW117055

Pagina
79
79
79
79
79
79
79
137
137
137
137
137
137
137
137
137
137
137
138
138
138
138
137
138
138
146
146
137
137
137
137
137
137
137
137
137
137
137
138
138
138
138
138
138
138
149
149
149
151
151
151
151
151
151
144
144
144
144
170
170
170
170
170
170
80
294
295
309
294
294
295
295
295
294
294
294
295
295
348
348
348
348
348
348
348
348
348
348
348
348
348
348
348
41
41
41
35
48
42
46
46
46
36
36
39
39
40
48
42
48
50
31
40
18
18
18
19
19
174
174
174
82
82
81
315
315
315
315
315
315
315
315
208
208
208
208
208
208
208
208

Cod
SW117056
SW117124
SW117133
SW117140
SW117141
SW117154
SW117156
SW1191
SW1196
SW119612
SW129351
SW129371
SW131411
SW131412
SW131413
SW13641
SW13651/4
SW136511
SW136512
SW136513
SW148081
SW148082
SW148083
SW148281
SW148282
SW148283
SW152011
SW152012
SW152013
SW152014
SW168806
SW168810
SW168811
SW168812
SW168813
SW168814
SW174901
SW201841
SW201842
SW201843
SW201844
SW3081
SW3082
SW3083
SW4518
SW6411
SW6412
SW6413
SW65341
SW65346
SW8414
SW84141
SW84142
SW84143
TE20002
TE50011
TH041
TH308
TH8011
TI000401
TI000501
TI000601
TI000701
TI10327
TI10527
TI117173
TI120273
TI123203
TI12927
TI14027
TI14127
TI14227
TI15907
TI16027
TI16627
TI17527
TI186273
TI19007
TI21421
TI22621
TI22721
TI22921
TI23011
TI8066
TI8093
TI8094
TI8099
TI8100
TI8101
TI8102
TI8103
TI8104
TI810603
TL1218
TM000401
TM000501
TM000601
TM000701
TN060002
TO00101
TO00201
TO00301
TO00302
TO00303
TO00304
TO00305
TO00401
TO00502
TS004089
TS004090
TS004280
TS004281
TS01966
TS02566
TS04866
TS057167
TS057168
TS057312
TS057335
TS057414
TS057661
TS057937
TS057968
TS057969
TS058240
TS058241
TS085650
TS14866
TS431300
TS43233
TS43236
TS43239
TS461348
TS539020
TS53947
TS55224
TS552390
TS555870
TS557320
TS557400

Pagina
208
208
208
208
208
208
208
216
216
216
211
211
206
206
206
197
207
207
207
207
194
194
194
194
194
194
184
184
184
184
189
189
189
189
189
189
211
184
184
184
184
192
192
192
216
197
197
197
207
207
203
203
203
203
32
32
371
369
371
306
306
306
306
231
231
231
231
231
231
231
231
231
231
231
231
230
230
230
232
232
232
232
230
230
230
230
230
232
232
232
232
232
232
309
307
307
307
307
311
175
175
175
175
175
175
175
175
175
84
84
84
84
83
83
83
83
83
161
161
161
161
162
162
162
162
162
88, 165
83
84
86
86
86
88
160
90
88
90
88
87, 164
87, 164

Cod
TS56170
TS56171
TS570400
TS570410
TS57530
TS579320
TS579470
TS58000
TS585390
TS585400
TS585410
TS585430
TS585440
TS585490
TS585550
TS585560
TS600210
TS60042
TS60765
TS60766
TS6462150
TS646230
TS660030
TS660050
TU050100
TU050102
TU050107
TU050108
TU050109
TU050110
TU050111
VB00861
VB00913
VB0096
VB010102
VB010104
VB010201
VB020105
VB020109
VB020203
VB030100
VB030501
VB050102
VB050201
VB1013
VB1022
VB10401
VD000100
VD000101
VF2005020
VF2005050
VF2005080
VF2005090
VF4347
VF4348
VF4349
VF4356000
VF4366000
VP000101
VP000102
VP000103
VP000201
VR110001
VR110002
VR120001
VR120002
VR120005
VR211001
VR221002
VR310001
VR332001
WG000100
WG000102
WG000103
WG000105
WG000106
WI200100
WI20050
WI20070
WI3040
WI3050
WI3060
WI3070
WI3080
WI3099
WM04207
WM21020
WM21040
WM44651399
WM4468211
WM4468212
WM4468213
WM4468231
WM4468232
WM4468233
WM44851199
WM44851399
WM44871321
WM44871341
WM44871371
WM46699332
WM46699333
XC012
XC1004
XC1010
XC1048
XC1056
XC1062
XC1085
XC1087
XC1089
XC1090
XC4029
XC4030
XC610301
XC611100
XC710101
XC710700
XC810000
XC810800
XC811400
XC811600
XC812200
XC812701
XC812702
XC812703
XC813300
XC813700
XC814700
XC814800
XC815300
XC816700
XC819400
XC819500
XC819600
XC819700

Pagina
87
87
169
169
89
162
162
89
163
163
163
163
163
163
161
161
90
90
86
86
87
164
89
89
297
297
297
297
279
296
296
314
314
314
314
314
314
314
314
314
314
315
315
315
314
314
314
72
72
100
100
100
100
103
103
103
110
110
278
278
278
278
74
74
75
75
75
74
74
74
74
293
293
293
293
296
81
81
81
81
81
81
81
81
81
179
179
179
179
179
179
179
179
179
179
179
179
179
179
179
179
179
349
349
349
349
349
349
349
349
349
349
349
349
301
301
300
300
349
349
349
349
349
349
349
349
349
349
349
349
349
349
349
349
349
349

partenerul tu de ncredere!

Oricare ar fi activitatea companiei


tale, avem produsele potrivite!
gam complet

consiliere

acoperire naional

nivel ridicat de serviciu

livrri n 24 h

transport asigurat

i eficientizm afacerea i te ajutm


s faci economii la buget!
economiseti bani

scuteti timp

calitate optim

un singur furnizor, o singur factur

ISO

OPI

EOSA

Certificrile ISO garanteaz


nivelul ridicat de serviciu
pe care l putem acorda
partenerilor notri.

Premiul Emerging
Reseller acordat de OPI,
ne poziioneaz alturi
de cele mai mari firme
de profil din Europa.

n 2008, RTC a devenit


membru al EOSA (European
Office Supply Alliance,
Uniunea european a
distribuitorilor de papetrie)