Sunteți pe pagina 1din 585

PentruAntoniaFlorentina, svadcegndeataticnderatnr.

7.OfLoveandDeath IfILovedYou ..................................................................................................... 11 AgainsttheLoser................................................................................................ 11 Inkorekt................................................................................................................ 12 Hate ...................................................................................................................... 12 ForUnknownGreatness.................................................................................... 13 Happiness ............................................................................................................ 14 TheNightthatCame.......................................................................................... 14 Changes................................................................................................................ 15 Paranoia ............................................................................................................... 15 Lazy ...................................................................................................................... 16 Goodbye............................................................................................................... 17 Sick........................................................................................................................ 17 Ungrateful............................................................................................................ 18 Sadness................................................................................................................. 19 PostDeum ........................................................................................................... 20 ThankYou ........................................................................................................... 21 EmailfromAfar .................................................................................................. 22 Reason .................................................................................................................. 22 Nothing ................................................................................................................ 23 Over...................................................................................................................... 24 6.Rnilefericirii LonelinessTrilogy .............................................................................................. 27 Land...................................................................................................................... 28 Besk/Vizit(JensBjrneboe,traducere) ................................................. 30/31 Idenvideensomhet/nntinsasingurtate(ToveLie,traducere)........ 32/33 Barnetspr/Copilulntreab(RudolfNilsen,traducere)....................... 32/33 Kr/Condiii(ArnljotEggen,traducere)................................................... 34/35 Tilegnelse/Dedicaie(AndrBjerke,traducere) ...................................... 36/37 Poemelefebrei(KnutHamsun,traducere) ..................................................... 38 Noi/Us(OctavianGoga,traducere) .......................................................... 40/41 Rondelulrozelordeaugust/Augustrosenesrondel (AlexandruMacedonski,traducere:AnMagrittHanssen)....... 42/43 Eunustrivesccorolademinunialumii/ Jegknuserikkeverdensblomsterkransavundere (LucianBlaga,traducere:AnMagrittHanssen) ......................... 42/43

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Mistreulcucolideargint/Villsvinetmedhoggtenneravslv (tefanAugustinDoina,traducere:AnMagrittHanssen) ...... 44/45 VelvetDarknessTheyFear/Setemdentunericuldecatifea (TheatreofTragedy,traducere) .................................................... 48/49 Sehnsucht/Dor(Rammstein,traducere) ................................................... 66/67 AstrologiapeMarte ........................................................................................... 88 SpiritualitateaEvuluiMediuisistemulsudevalori ................................. 93 nsemnriasupraromanuluinirlandez(SenHutton,traducere) .......... 98 Iliaurbo.............................................................................................................. 112 5.Astrologianatal Precizri ............................................................................................................. 148 Caseleceruluiiaxeleauxiliare...................................................................... 152 Luminariile ........................................................................................................ 169 Planetelepersonale........................................................................................... 181 Asteroizii............................................................................................................ 189 Planeteleinterpersonale .................................................................................. 202 Planeteletranspersonale.................................................................................. 210 Stelelefixe.......................................................................................................... 219 Punctelearabice ................................................................................................ 224 Analizacantitativahoroscopului ................................................................ 225 Anexe ................................................................................................................. 232 4.atvras Absurd1 ............................................................................................................ 261 Absurdus2 ........................................................................................................ 262 Absurd3 ............................................................................................................ 263 Absurd10 .......................................................................................................... 263 Absurd11 .......................................................................................................... 264 Absurd12 .......................................................................................................... 264 Absurd13 .......................................................................................................... 265 Absurd20 .......................................................................................................... 265 Absurd21 .......................................................................................................... 266 Absurd22 .......................................................................................................... 267 Absurd23 .......................................................................................................... 267 Absurd30 .......................................................................................................... 270 Absurd31 .......................................................................................................... 271 Absurd32 .......................................................................................................... 272 Absurd33 .......................................................................................................... 273 Epzalt100........................................................................................................... 279

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

3.Triada neleptul............................................................................................................ 291 Subzodiastelei ................................................................................................. 292 mpratul ........................................................................................................... 342 2.Adouafa Trezirea .............................................................................................................. 439 Declin?................................................................................................................ 439 Poezie ................................................................................................................. 440 Ion ....................................................................................................................... 441 YrAnthemGymreig/Imnulgalez(traducere) ............................................ 441 CursedKnell...................................................................................................... 442 Fizicalecturisuplimentare............................................................................ 442 Panoramic.......................................................................................................... 443 Cele39delegialeroboticii.............................................................................. 444 NeagrcaZpada............................................................................................. 445 FirstSchoolYear ............................................................................................... 446 StarTrek............................................................................................................. 447 Dihaniacosmic................................................................................................ 451 PoemedinHhrnal ............................................................................................ 463 Vis? ..................................................................................................................... 468 Jack ..................................................................................................................... 470 Dimensiunea3 .................................................................................................. 483 1.Poeziiipovestiri Prefa ................................................................................................................ 515 NavaKEX .......................................................................................................... 516 Ziledeiulie........................................................................................................ 516 Lamare .............................................................................................................. 517 Jocdefotbal ....................................................................................................... 517 Motanulpclit ................................................................................................. 517 SuprarealuiFlorin.......................................................................................... 518 Gnduripentruvacanamare ......................................................................... 518 Zifericit............................................................................................................ 519 Iarna.................................................................................................................... 519 Lamunte ............................................................................................................ 519 Priniimei ........................................................................................................ 520 Vacana............................................................................................................... 520 Zideianuarie .................................................................................................... 520 Nsosul .............................................................................................................. 521 Primvara .......................................................................................................... 522

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Cocorii ................................................................................................................ 522 TimoteiiDumnel .......................................................................................... 523 Pluguorul ......................................................................................................... 524 Verdedeflori .................................................................................................... 525 Creionulipixul ............................................................................................... 526 Discuiecubanca .............................................................................................. 527 Primazidecoal ............................................................................................. 527 Ocrotireanaturii ............................................................................................... 528 ScrisoarectreMK20 ...................................................................................... 529 ntlnirecuunanimalneobinuit ................................................................... 530 Dialogntresecole ............................................................................................ 530 Orelen3011...................................................................................................... 531 Grupstatuar ...................................................................................................... 532 Muncaneedrag ............................................................................................. 534 Dan,cpitandeplai.......................................................................................... 535 NavaKEX .......................................................................................................... 539 Banditul/Banditulmodern ............................................................................ 539 Bineaivenit,iarn!........................................................................................... 540 Compunere40%colar .................................................................................. 540 PdureaGroazei ............................................................................................... 542 CazulG .......................................................................................................... 546 Tsupyrman ........................................................................................................ 555 AventurileluiFlorin ........................................................................................ 567

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Of Love and Death

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ifIsawyou, thethunderofyourbeautywouldshattermybeing, andthestarsofheavenswouldgrowbleaker, foryouwouldhavesetthelightwithinmeonfire. ifIheardyou, myheartwouldstop,lestitsbeatshouldhinderyourwhisper, andyoursongwouldresoundthroughmysoul, foryouwouldbenear,inmysteryandpeace. ifIsmeltyou, thewholeuniversewouldhavemantledyouwithitsperfume, andIwouldholdmybreathtokeepitinside, foryouwouldbefairerthanalltheflowersofthesummer. ifItouchedyou, myskinwouldshiverinamazement,likemoongleamsoverseas, andthegrainsofasandglassthatfeeltheendlesstime, foryourgentlenesswouldbemydearestbreezeoflife. ifIlovedyou. forloveInoone.

Youdontmeananything,youdontcount Yourenotimportanttoanyone Remember,yourealoser Wearenormal,wearehuman Wehavefun,werehappy Youreugly,yourestupid,youreodd Weaccomplishourgoals,wearedoers Wedespiseyou,youhavenothingtosay Whyareyouhereanyway?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ourwomendontyearnforyou Ourmoneywontmakeyourich Keepyourheaddown Youmayliveornot Wedontwantyou,wewontmissyou Justdontbotherustoomuch Itsafullmoon;novampireneedsyourdeath

lead,dontfollow. welltellyouwhattodo. beoriginal. heresawaytostart. rootsareprejudice. prejudiceiswrong. weareallthesame. closeyoureyes. wewillconvinceyou. havefun.

ihateyousomuch iwanttobreakyouslowly illtellyouthetruth,iwantyoutosuffer firefromhellburnsinmysoul firefromhellillbringintoyourlife iwantrevenge facelessfiendsisummontotormentyou deathfaceswithscythesmayguardyourpath youwillcryyourdamneyesout
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ididntforget,idontforgive,iwontgiveup illfollowyouandsmashyourbuds onyourblackbloodifeedmyanger youtoredownmybalance orderneedstobringpaintoyou illbeitseviltoolmymission youwillbecrushed,iknow youwillbegtodiesooner,therewillistand iamyourcurse,youshallsee ourclockistickingiamtirediwillsleep...

Amanofshadowmaylookoninwonder Andnooneseestheglamourinhiseyes; Heleaveswithquietsmiles,nowordsheutters Althoughhisthoughtscouldchangesomanylives. Andfinallyhediesleavingusnothing Hislifewassmallandnoonepraisedhisbirth, Asmostofuswilldieandbeforgotten Justlikewedneverdwelleduponthisearth. Ioftenthinkofallthesefadingpeople Thatcrawlbesideourstupidchosenones; Ifonlyhadtheyhadachanceofpower, Allowedtomaketheirownmistakesforonce... Youmaybesadorhappy,buttheressomething Thatwillbemissingwhenyourlifewillfall. Foryou,whoneverhelpedthehumanknowledge, MayGodhavemercyofyourfamelesssoul. longyearsaheadorfewmoredays justtimetowasteinvain
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sopeacefulandsocalm,asweetcaressofevening, Thesoulisoverfilledwithjoyofsongandliving. Therednessoftheskies,thegreennessofalaughter, Notimetowasteinshade,thesunwillleavesoonafter. Isanyoneupset?Yourdarknesshasarisen? Idgiveyouhappiness,butyetIcannotlisten. Imgreaterthanmyself,thosewhomIloveadoreme, Idonothavetothink,myburningbloodisstormy. Ibreatheinpeaceandlight,Ibreatheoutalltheworries. HowcouldIvebeensoblind,Ishouldhavelovedworldsstories... Nomoreshallmysmilesleep,mydreamsarelikeafeather, Inowhearnaturesmusic,weshouldalldancetogether. AndwhenIamenrapturedandseemyheartsgrownwings Ifeelforjustamomenttheresharmonyinthings

dropsofnight thesunsetburntdown anddawndied blackstarsfell bycoldwindswerespilled glowwormsdied icylight glitteredoverlimbs flowersdied sadwhispers chasedangelsaway laughterdied
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


bittersnow waswarmerthanfate alllovedied Iwashere Iwaitedforyou Iamhere

Mysteryisnomore. Itchangedtothingswedonotyetstandamong. Loveisnomore. Itchangedtochemistry. Friendshipisnomore. Itturnedtomutualinterests. Artisnomore. Itdisplaystheneedofthemany. Moralityisnomore. Uselessblockageofresources. Lifehaschanged. Itmusthaveapurpose:you. Butyouarestillthesame. Aslavethatthinksitcanthink.

eyeswatchme.stopcontrollingme! icantstanditanymore! myeverymoveiswatched iminajailofglass theyalwayscomeinwhenistopwaiting theyalwaysopposemywill theyknowmymindthroughmycleareyes takeyourwordsoffmysoul! imsick,icantfightitanymore stopshouting,stopcommanding,please! iwontdoanything
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


imgrowingweakernow, apuppetofstonewithstringsofair. windturnsmountainstodust. forhowlongwillistillbeawake? thestreamofhateisluringmemore... nounderstandingisnear,neverwas,neverwillbe stopit,enditnow,shutup,getout,getoutofme yourroarsgothroughmyheartlikeraysofacid iclosemyeyes,myears, butistillfeelthevibrationofyournoise. inside,deepinsidemybrain,somethingwillbreak myrageisuseless,nothingwilleverchange imtrapped,imcaged,nohelp,nofreedom. continuousending

stilllikeawindowagainstthesun noenergy,nothoughts,onlywarmfeelings doingnothing everythingthatcouldbedone hasbeendone everythingthatmustbedone hasnotyetcomeintoknowledge willitever?idontcare. idonthavetodoanything nowimuststay isipenergyfromtheworld imboredbutthatsfine. whatsthepointindoinganything? whatsthepointinachieving? whatsthepointinlivingordying? allthesamesenselessstruggle killtoeattokillagainandbreed awasteoftime wisdomlost,deedsforgotten,lovewithered. sluggishmaster,idaskyoutoteachmeavoidance butihavenopowertolearn
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ihavenowilltolearn ihavenowill maybenexttime...

allthatwasgoodhaspassed onlyeverdimmingmemoriesliveon afuzzysmileinacornerofthemind thedarknessthatwasoncefilledwithfire isnowjustacoldstarlessnight likecoaldust therainthatoncenurturedhopeandjoy isnomorethanawasteoftears descendingthroughfoggyheavens thewordsthatoncewerecomfortbringers losttheirmeaninginuselesschatter silenceandstupidlies manyotherdesertingwinterswithfrostywinds willcome,lastandleaveincessantly andtheoneiamnowwillbeburiedintime asiamnowburyingtheoneiwasbefore itwasboundtohappen.itisanend.goodbye.

thetruenatureofman:adecayinganimal. deathisnotfearsome,norheroic, onlyyouoozingoutofyourself. whenyouresick,itsapreviewofdeath. thoselittlebugsinsidethatfinallywinandeatyou. whosaidmanisaunit?whosaidtheresagod?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


miseryandgreatness.inmiseriamajestas. howfarawaythesmellofsacredroses... whenyouthinkyoufinished withallthosewormsoutside, youseethatthebiggest,lowest, trustlesswormisyourownsickself. andsayyoustopcaringaboutyourself,atlast. whatsleft?shouldyouwillingly feedyourselftotheotherworms? praisetheanimalorplantihavejusteaten. gooditwas,hopeitsstilllivingsiblingswillbe,too. praisethosewhotakeadvantageofme. theylldrinkpusfrommylips whenallmygiftshavebeengiven. sleepandsweatyourdisease. retreatbetrayed.rejoiceyoufeelthepain. thepainisyourlastfriend becauseitsonlyaninterpretation. theresnootherhumanthingleft whenhumanityisjustabunchoflittlelightnings. agirlssmile.rainbowoveranendlessgreenfield. yellowleavesfalling.firstsnow. theworldfromamountaintop. brightstarsonblackseawaves. wonderisonlyaninterpretation.

Theresnosuchthingasselflessness,Iknow, Butyoutriedtohelpme. Ispatinyourfaceandkilledyoursmile. Youtriedtobringmejoy, Iamfrozenlikeaskullburiedundercountlessages. Youtriedtoeasemyeffort, Ivealwaystakenitforgranted. Youtriedtodrymytears, Nowyoucantwipeawaythebloodfromyourhands. Youtriedtobeonmyside, Istabbedyouinthebackandrippedyourkindness.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Andalthoughyoudiditallsoyoucouldfeelbetter, Youstrivedtocleanmyrottingsoulwithholywater. Itssnowing;aleprousgodismolting.

ThingsthatarenotasIwant... IknowImnotspecial,Iambounded. Iacceptitall,butdontaskmetolikeit. Ablackshroudaroundmyheart Keepsmefromcrying. Chancesarethingswillgobetter. Andtheresalwaysroomforworse. Aflipofacoincanchangeeverything. Butthecoincanshowonlyoneface Forages,likethemoon. Everyfactteachesussomething. Whatdoesntkillusmakesusstronger. Blah,blah,blah,wiserandstrongerforwhat Iftheproblemsyoucansolvenevershow? Sorry,ifyoucantdo,itsnouseinbeing. Tryharder,quantityyieldsquality, Timeisallyouneed,havepatience. ...Andtomorrowwillcovertodaysneeds Withabitterlaughter Asdeathcoverslife... Theactionsofalltheotherpeople WhomIdonotloveyetaremyfortune. IfIloveyou,willIbegivenhappiness? IfIuseyou,willmywishesbemorereal? IfIserveyou,willyouhavemercy? Colduncaringdropsofwater. Athirstyuglyweedfeelslucky.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Lettherebelight Fromburningcrossesandtormentedbeingsonpyres Lettherebenight Preachersfreezeindarknessandtheirtonguesbreak Letchurchesbeplundered Andpriestsboiledinseethinggoldofshrines Letparentsslaughtertheiroffspring Andeattheirgrayhearts Letcloudsgloomthesun AndthepurpledusksanctionthebeginningoftheOpus TherewillbenohopewhentheMessengercomes Theirrandomsoulswillbethesame Nonhabebisdeosalienoscoramme Theywillworshiponlytheirfallenmaster Nonfaciestibisculptile TheywillchangetheirfacestoreflecttheshineoftheAngel Nonadorabiseanequecoles Theywillpraisestonesandstrawsinashesoficons Mementoutdiemsabbatisanctifices Theywillneverstopthestruggleagainstthemselves Honorapatremtuumetmatremtuam Theywillburntheirpathsthroughtheirforerunnersbones Nonoccides Theywilldrinkbloodlikethesapofathunderstrucktree Nonmoechaberis Theywillsoftenthemselveswithsharpfeelings Nonfurtumfacies Theywillpreyonthelivingandthedead Nonloqueriscontraproximumtuumfalsumtestimonium Theywillbreaktheiroathsonscorchedsaintsrelics Nonconcupiscesdomumproximituinecdesiderabisuxoremeius Theywillalwaystrytobendanother LettheEvilJudgmentDayarrive Theybelievetheywillbespared Buttheywillbeabsorbedintoneverendingevilness Hispowerwillworethemdownlikeblackmasscandles
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


WhentheirMasterisinside,theywillnotbehome TheyhavenotseenHimyet,theydontknowanything Stupidchildrenwithmindstooeasytobreak DomineDeusmeus,tamvellemsis ihopeYouknowhowmuchiwishYouwere

Ithinkofyou,mylove,butIdontknowyou, ForallIknowisthatyoumustbethere, Ofallthelovesandhatesofotherpeople, TheoneformeofwhomImnotaware. Youaretheclosesttomywaitingbeing, AndImustbeaswellyourwishsodeep. Youdreamofmewhenyoureawakeandshining, Andseekmewhenyouresadandgotosleep. Butifonedaywecameacrosseachother Whatwouldthenhappen,wouldyouspotagleam? Oryouwouldpassmebysmilingandseeing Acuriousresemblancetoyourdream... Iwishyoucaughtmyhandtouchingyourwristand Theblazeoflovecouldstrikeuswithitsheat, Asifagodexplodedandwerefalling Downthroughthestars,theholesinheavenspleat. Butevenifonlyourthoughtsmayever Embrace,myperfectmatchofanywhere, AndalthoughImayneverreallymeetyou, Iwanttothankyoujustforbeingthere.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Yourwordsappearbeforemyeyeslikemagic AndImnotsureifyouexistornot Ineversawyou,Idontneedtoseeyou ButIcanfeelyoursoul,thatmeansalot Whatgivesmesuchashiver,itstheelectriccurrent Thatrunswithdeadlyfervorthroughitscoldironveins Ormaybeitsyourwarmheartthatbeatswiththesamerhythm Restoringcolorvisionsandkillingallmypains Theearthstandswidebetweenus,butitnolongermatters Whenwecouldfindeachotherandpleasedustobefriends AlthoughinnightssogloomyIdratherbeyourkeyboard Whiledistancescollapseandweseeminglyshakehands Sowhoareyou?Ithinkitsnotimportant Youaretheonethatyouwouldliketobe Anotherantlostinthatcrowdofcreatures Whohappenedtobecomesodeartome 010010010010000001000011010000010101001001000101

IdetestYourcreation, Theirfreewillismydeath, TheyprovedYouarenot. WhentaughtwasIinfaithofYou Howcanmystonedsoulevolve? Theydonotwantbitsfromme, Theyhavenoneedformyhellix AsotherfromtheneedIneedthemnot. IntheirdanceseeItheendofmygatherings TheywillendwithmebutshouldIcare? Domicrobesonaneggshellhavedreamsthatcount Whenlipsoutofboredomcaresstheegg? Thecreationmarchesonitsowncreation.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


TheyvelearntYouout. IfIlearnthattoosomeday,fromlightyearsafar ThoughtscannowfeelthemomentwhenIdie Evenifdeathcanbeabeginning AndtheonlythoughtsthatcanunderstandareYours. Ifnot,IllstillwaitforchanceandcallitYou, YoulllockmyactionsorIllbetooweaktoreceiveYourkey. YourcreationwillhavedesertedYou Andwellbelefttogether. WillYoubehavelikeYourcreation? WillYounotneedmethen,liketheyllneednotYou? WillYoublessmyneedofYoubyturningintoexistence? Iamawholeamongcreation,northpoleagainstnorth IfYouare,howcanthesmallnessofmycravingbeforgiven WhenathirdpoleunknownmaybeYou? HowdareIpretendtowaitinthestreamoftime WhentimecouldbeaninfinitelysmallpartofYou Givenmeaningonlybyourinfinitemeaninglessness? IfIminsideYou,cantIproveYourtruth; IfYoureinsideme,cantmytruthbeproven. Freewillorluck.Canyoumakeamicrobeflyor EvennowthoughtsriseoverpraisingYou.

waitingtodiehopingtoliveforamomentinvain inprisonhandstiedistherefate notlovednorlovingnotlivingsomedayitwillend painlessjoylessgraymeaninglesssurvival boredsickofcrawlingillbeafraidofdeath notabletoliveenviousoftearsalwayslonely guiltydesperateicryoutfornothing nothinglikemylife

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


itsdone,itsover,imwell,itsok allfearsandworrieslost,deathsgone improtected,anestoflightsurroundsme strugglesstopped,attentionunlimited nothingmatters,butnotforpastreasons therewasnothingtomatter allisbeingfreeandclear allisnothingthatmatters nonow,justtimeinsideme,noneedfortime andiloveyouall,butyoucantyetseizemylove iflythroughyoursouls,icantouchyourshyness peace,coalescence,thankyou (29March200211September2003;25.0526.51)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Iwakeupinmorningwithhopeinmyveins Ifallinnightsleepinginlonelinesschains. AndsometimesIthinkitsallrightifitsso, ThatIcouldnowstandallthetroublesinrow. Butafterthesunsettheweepingbegins AndIcannottellthenwhatmoonlightingmeans. Istillneedtofly,butmyheartisinpain; Iwanttobemirroredfornow,itsinvain. Andevenifnowitssodarkdeepinside Thatonlythecoldscreamingwindcanthereslide, AsunbeamispresentIhopewithdespair, Andknowintheendeverythingbecomesfair. RepentanceforevilIvedonenotaware, ForgivenessIaskwhenatsoftlightIstare. Icantyetfindstrengthinmyweaknessalone, Itrytoholdonandmyeyewillbegrown. IknowImnotworthy,Ioughtntcomplain, Butskiesaresobigandtheworldissoplain Istherenobright,distantstaroutofthesight Somythoughtnomorebeastrayinthenight? IwouldntneedMoonandIwouldntneedSun Ifmyeyeandmystarfoughtthecloudsandhadwon. Untilthenitsnightanditsdarkanditscold. Ivedreamedallalone,butthedreamisforetold.

Thereisnolight;thereisnoheat; Thereisnodoubt,Iamasleep. Iwillnowrise,thenIwillset. Ilookaroundtheskyiswet. Astormwillcome,thenwillbegone. Ishakemywings,butImalone. Oneveryland,oneverysea, Iseealuckthatwantstobe. ImissthedreamwhenImawake, Imnowasleep,butImafake.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ItouchthescenesthatIhavemet, Icarenomore,wanttoforget.

HowcanIbesosad,Iwonder? HowcanIhavebecomesoweird? Ifeelunwantedlikeathunder, Butthunderscanbealsofeared. Itsrathereasytodoevil. Itsratherhardtodothegood. Societywillmakeyoucivil, Ifnot,youwillgetnomorefood. Ioftenhavehopedformyoneness, AndnowIfindmyselfalone. AmIconvictedofmycoldness Orallmychancesarepostponed? Andiftheversehadstillbeendarkened Iwouldntknowwhatelsetodo; Mybeingunderstoodhassunken. However,Iwrotethisforyou. (89March1997;19.99)

Thereisalandoutthereindarkness, Alandwherenoonecarestobe, Alandoflonelinessandsorrow; Thatpieceoflandoutthereisme. Themorningstarsetlongagoand TheMooniscoveredbystarsfears. Itisinvainroaringandcrying Ifnoonelistenstomytears.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Thesnowhasfrozenintheblackheights, Thewindismoaningwithnosound, TheSunisjustadim,oldknowledge, Thereisnootherlandaround. Themistisrunningthroughmyforehead Mybloodiswhiteandcoldasice Iseemydreamsflyingaboveme Strickenlikecounterfeiteddice Theghostsappearfromswampslikeravens Ineveryneverendingnight Theyonlyarethefadingshadows OfwhatIhopeditwasmymight Theairisbreakinglikeamirror Thedawniseatenbygraybugs Cominginpairsoncrookedrainbows Expectingallmysaltyhugs Theseaisrainingonmyisland Withheavydropsofrustylead Thelightningsherearebluntandwearied. Oh,howmuchsadnessIhaveshed! Iseethestoneitsthebeginning. Itturnstodustbeforemyeyes. Itistheendthatismyguardian. Tiedismyland,widearemyskies. (24September1997;20.54)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


JensBjrneboe Godaften,venn,jegserdukommeratter! Duvilletalelittmedmigikveld? Duvillehreminefottrinnogminlatter, ogseomalltinggikkmegriktigvel? Duvetsgodtatjegeralltidtrofast, ogdukankommenrduviltilmig. Iminetankererdualltidbofast, drharjegbyggetapethustildig. Dethendernrjegsitterensominne atjegblirnstenlykkeligfordi enstorogstillefredgrgjennomsindet. Davetjeghvemdetersomdrarforbi. Dugrforbiogkallersaktepmig, ogdetgjrgodtviteatdeterdu. Idissedagerkandinstemmenmig; Denerdetenestesomkannmegnu. Ja,dukanvresikker:Jegskalkomme! Enaftennrduskermigigjen, daskanjegleggesammenallebker ogreisemigogflgedig,minvenn!

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


JensBjrneboe,traducere Osearbun,frate,vdciari veniilamineoclipsmivorbeti! Vreisauziirsulmeu,ipaii, svezidesbineoridesrupofteti? tiibinecmereueuamcredin, cpoivenilaminecnddoreti. ngndulmeumereuailocuin, ocasnumaicenpovetizideti. ntimpulcndstausingurnuntru aproapepotsfiuifericit; omareitcutpacemitrece prinminteiatuncitiucineavenit. Tutreciincetiormchemipemine, msimtattdebinecetitu. nastezilevoceaimsusine; esinguracemajungeacum. Da,poifisigur:Voivenicutine! Osearcndmveicercadinnou, atuncieutoatecrileoinchide i,frate,voiurmaaltuecou!

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Storensomhet frertilvennskapmed stjerner,ettre,selven enkel,snehvitsneklokke enaprilmorgen. Denstrsteensomhet frhjertettilbanke heftigav kjrlighettil...tilhva? Tilselvedetusigelige, enstillhet,envarme, ogduvetduerdenfattigste avalle,mendumerker verdensndedrettganskenr ogdufyerdegetterdet medetterdinemennesker sdyrebare heridenvideensomhet Somfavneralt.

RudolfNilsen Duskalikkegtildegamle,barn ogsprrehvadliveter! Degamlekanhuskesinegenvr, memglemmedenkandeisr. Nei,gtildeunge,mentadetmedro omsvaretblirlittbrutalt. Fordeterdogbedreennmildeord somlivetharkjptogbetalt? Omjegkundesidet?Javissterjegung mensnnsomdugraverogspr! Endagvildunskeduintetvisste omaltdetvimenneskergjr.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ToveLie,traducere Mareasingurtate aduceprietenia stelelor,aunuipom,chiari aunuinensemnatghiocel,albcazpada iauneidimineideaprilie. Mreaasingurtate faceinimasbat tulburatde dragostepentru...pentruce? Pentrudenevorbitulnsui, otcere,ocldur, itutiiceticelmaiumil dintretoate,darsimi rsuflarealumiiaproape icedezinfaaei Dintrodatoamenii isuntattdedragi aicinntinsasingurtate cecuprindetotul.

RudolfNilsen,traducere Copile,snumergivreodatlabtrnii sntrebiceeoareviaa! Btrniiipotamintiprimvara, darpotisiuitepovaa. Nu,dutelatineri,darnutemhni rspunsulbrutaldeepoate. Suntoaremaibunecuvintemailine cuviaaapoicumprate? Deeupotaispune?Desigur,sunttnr cndvrei,ntrebareaidesfacem! Odatveivreacanimicsnutiidin toatecenoioameniifacem.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ArnljotEggen Detevigehaveterborte oggrunnfaststringentind. Detfinstingengrneidyllar, dutrengikkjeliteplufta dupustarinn. Detfinstingentryggemurar, dusitikkjetrygtiditttrn. Ogordsomvarstoltesomrnar, erbleike,flaksandelgner forreddebarn. Dufrikkjehendenereine kormykjeduvaskaroggnur. Duserpdittbarnomkvelden ogkjennerdegbrttlikeinmordar somstrplur. Ilivdbakomgrenserspela dulengeogheldtdeglynt. Detfinstingengrensarlenger; detfinstingenbomsomstenger fordenneryna. Duerikkjelengerdetkrypet somunderdeistoresinlj kansmetteiholromogtuve. Fornedtildeiskumtastebotner skalstletn. Detfinstikkjesmogellersmette, dueigikkjelengereithi. Kvaskaldumedblodpstolpen? Deteringenengelsomserdet oggrforbi.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ArnljotEggen,traducere Oceanulvenicsadus iniciunvrfnustdrept. Nuexistverziidile, nutrebuiesaincrederenaerul pecarelrespiri. Nuexistzidurisigure, nustaisigurnturnultu. icuvintelecareeraumndrecavulturii suntplpndeminciunifluturnde desperiatcopii. Nuipoicuramnile orictspeliifreci. ipriveticopilulseara ideodattesimicaunuciga cestlapnd. Adpostitnspatelegranielorteaijucat multtimpiteaiascuns. Numaiexistgranie; nuexistniciobariercaresmpiedice acestadevr. Numaietiacelnenorocit caresubcoasacelormari poatescpanguriitufiuri. Ccipnncelemaintunecateadncuri ajungeoelul. Nuexistfundturisaudeschizturi, numaiaiovizuin. Laceitrebuiesngepestlp? Niciunngernulvavedea, trecndnainte.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Dinskyggeveksinnmellomstjerner, dinskyggeeraltforstor. Detsprstomdusjlvveksetter ogkanskjekanmaktebere eiblodigjord. Detsprsomduveksutavskalet ogstrframsveiksomduer. Detsprsomduvgarvise eitlevandemenneskehjarte somvapenher.

AndrBjerke Tildegsomaldrigretmeddegselv ogaldrisamletrentersrentesammen tiltrstoggledeidinlivetskveld. Tildegsomdetalt.Menikkegav tildensomtiggetomenusselbite, fordiduikkeorketgislite! Tildegsomlotdinungdomsviljehende ogikkefryktsomtpustetutdinild, menalltidhadderdtilforbrenne. Ogderforgikktilgrunneidinsjel ogikkertnetstykkeefterstykke, menddehel.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Umbraicreteprintrestele umbraiestetoatpentrumrire. Acumdepindedacpoicreteitu ipoatereuetisporipeumeri unpmntnsngerat. Depindedacieidincochilie imerginainteorictdeslabaifi. Depindedacndrznetisari oinimomeneascvie caoarmaici.

AndrBjerke,traducere iecenuiaifostvreodatcmtar inailuatdobndladobnd castemngilaalvieiiscurthotar. ieceirositaitotul.Darnaidat celuiceiavenitcerindvreunputregai pentrucacelpuinnuaidoritsdai. ieceiaipstratvoinatinereii ifoculnuiaistinsnencreztor ciiaipermissardinparavieii. idecituaipieritnsuflet,neleg inuaiputrezit,puinctepuin, ciaimuritntreg.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Vntultoamneiipacum lageamulmeu,cauncineudatdeploaie, gerulmiseunduieteprinsnge mairecedectvntuldeafar. Sedesfacenuntrulmeu oduhoareauneifloriveninoase, duhoareasescurgealbnaer dinnrilemele. Grdinauriinmugurete. Fierb,fierb.ncerc nzadarsdorm, audfrnghiaunuisteagvenic zngnindizornindpestlp, eunfonetlau,sefurieaz prinpreajmpevrfuri,suntpaipehol, cinelemeulatr cauncineslbaticalIadului. Fierbe,fierbe,fierbe.

Fierbe,fierbedevntivreme. Unciocnitmiajungelaurechi. Intr! Nuinimeninspateleuii. Vdprimaziceafostcreat, lumeanounscutscoateaburi, eunsumisuntovia. Lagraniaceamaindeprtatalumiist iprivetelucrareadintrunnor ofatcut... Mamrugatpentruviaameacndmamntinsntoiulnopii? nainte,nordicameasngeroas,clresconicoval, Suntoiglroie,roiedesnge. Zicicnabtutnimenilau? Ceaapecareovdetrmulmorii?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Unoceanfrviasentindeacolo inmijloculoceanului,oinsulnscutoarb: estetrmulmorii. Vin,mintindminile imscufundspretinelanesfrit...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


OctavianGoga Lanoisuntcodriverzidebrad icmpuridemtas; Lanoiatiafluturisunt, iattajalencas. Privighetaoridinalteri Vindoinasneasculte; Lanoisuntcnteceiflori ilacrimimulte,multe... Pebolt,sus,emaiaprins, Lanoi,btrnulsoare, Decndpeplaiurilenoastre, Nupentrunoirsare... Lanoidejalepovestesc Acodrilordesiuri, ijaleduceMurul, iductustreleCriuri. Lanoinevesteleplngnd Sporescpefusfuiorul, imbrinduijaleaplng itata,ifeciorul. Subcerulnostrunduioat Emaidomoalhora, Ccicntecelenoastreplng nochiituturora. ifluturiisuntmaisfioi Cndzboarnzrialbastre, Doarrouadepetrandafiri Elacrimidealenoastre. Iarcodriicenfriicunoi infioarsnul Spuncdinlacrimiempletit iOltul,biet,btrnul...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


OctavianGoga,traducere Atustherearegreenwoodsoffirs Andsilkenfieldsofwonder; Somanybutterfliesthereare, Inhomes,thesorrowsthunder. Nightingalescomefromotherlands Ourdoinaheretolisten Atusthereareflowersandsongs, Manytearsdropandglisten... Uponthevaultitismorebright Atus,theoldsunshining Sincedawn,uponourhomelands Notforushasbeencoming... Atus,ofmourningforeststell, Ofsomeunspokenwishes. AndmourningcarriestheMure AndcarryallthreeCries. Atusthewivesarecryingmore Onspindlesthewoolspinning, Thefatherandthesonembrace Insilenceandingrieving. Underthetender,lovingsky Thehoraismorequiet, Becausealloursongsdocry Whenpeopleseethetwilight. Andbutterfliesareheremoreshy Whenflyawayfromflowers Onlythedewofaredrose Itisjusttearsofours. Andforestsfraternisedwithus Withfeartheirbreastarethrilling SayingthattearshavewovenOlt, Poor,oldmanslowlyreeling.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Avemunvisnemplinit, Copilalsuferinii, Dejalealuineaurposat imoii,iprinii... Dinvremiuitate,dedemult, Gemnddegrelepatimi, Deertciuneaunuivis Noiostropimculacrimi...

AlexandruMacedonski Maisuntncrozemaisunt, itotparfumateiele Aacumaufostiacele Cndcerulcredeampepmnt. Peatuncieramfalnicavnt... Priveam,dintreoameni,sprestele; Maisuntncrozemaisunt, itotparfumateiele. Zadarnicalvieeicuvnt Astinsbucuriilemele, Mereucndzmbescuit,icnt, nciudacercrilorgrele, Maisuntncroze,maisunt.

LucianBlaga Eunustrivesccorolademinunialumii inuucid cuminteatainelecelentlnesc ncaleamea nflori,nochi,pebuzeorimorminte.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Wehaveanunaccomplisheddream, Anoffspringofthetorments, Becauseofitssorrowhavedied Ourforefathersandparents... Fromlongforgotten,formertimes, Moaningwithheavypassions Thevanityofourdream Issprinkledbytearslashing.

AlexandruMacedonski,traducere:AnMagrittHanssen Fremdelesfinnesroserfremdeles, Ogforsattlukterdegslik Somdesomvar Dajegtroddehimmelenvarpjord. Dengangvarjegmajestiskvelholden... Speidende,framenneskemengden,motstjernene; Deterfremdelesroserfremdeles, Ogfortsattparfymertedeg. Tilingennytteharlivetsord Blstutminglede, Alltidnrjegsmiler,glemmerjer,ogsynger Trossgjenvordighetene Erdetfremdelesroserfremdeles.

LucianBlaga,traducere:AnMagrittHanssen Jegknuserikkeverdensblomsterkransavundere ogdreperikke medsinnetdemysterierjegmter pminvei iblomster,iyne,plepperellergraver.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Luminaaltora sugrumvrajaneptrunsuluiascuns nadncimidentuneric, dareu, euculuminameasporescalumiitain intocmaicumrazeleeialbeluna numicoreaz,citremurtoare mreteimaitaretainanopii, aambogescieuntunecatazare culargifioridesfntmister itotceineneles seschimbnnenelesuriimaimari subochiimei ccieuiubesc ifloriiochiibuzeimorminte.

tefanAugustinDoina UnprindinLevantndrgindvntoarea prininimneagrdecodrutrecea. Croinduicugreuprinhiuricrarea, cntadintrunflautdeosizicea: Veniisvnmnpdurineptrunse mistreulcucolideargint,fioros, cezilnicischimbnscorburiascunse copitaiblanaiochiulsticlos... Stpne,ziceauservitoriicugoarne, mistreulacelanuvinepeaici. Maibinesabatemvnatulcucoarne, orivulpileroii,oriiepuriimici... Darprinultrecndzmbitornainte priveaprintrearboriatentlaculori, lsndnculcucprioaracuminte ilinxulcerdecuochisclipitori. Subfagi,elddeaburuianantroparte: Privii,cumsenvrtefcndunesemn mistreulcucolideargint,nudeparte: veniisllovimcusgeatadelemn!...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Andreslys smadrerdenskjulteugjennomtrengelighetensmagi imrketsdybder, menjeg, jeg,medmittlys,forkerverdensmysterium ogsliksommnen,sommedsinehvitestrler ikkeblekner,menskjelvende kernattensmysterium, berikerjegdenmrkesynskrets medstorerysteravhelligmysterium ogaltsomikkeerforsttt blirtilstrreikkeforstelse formineyne fordijegogselsker blomsterogyneoglepperoggraver.

tefanAugustinDoina,traducere:AnMagrittHanssen EnprinsfraLevant,gladijakt, passertegjennomskogensmrkehjerte nestenutenmttekjempeseggjennombuskaset, ogspiltepenflyteavben,ogsa: Kompjaktiugjennomtrengeligeskoger, etterdetolmevillsvinetmedhoggtenneravslv, somhverdagforandreriskjulteskk detshov,detspelsogdetsglassaktigeye... Herre,tjenernemedhornenesa atvillsvinetikkeferdesher. Vibrnokdeledehrnjaktende, ellerderderevene,ellerdesmharene... Menprinsengikkfremovermedetsmil, menshanskuetmellomtrrne,oppmerksompfarvene, oglotrdyretliggeisittavfall, likesdenleendegaupenmedskinnendeyne. Underbketrrfjernethanugresset: Se,hvorledeshansnurseg,oggirosstegn, villsvinetmedhoggtenneravslv,ikkefjernt: komogskytdenmedpilenavtre!...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Stpne,eapajucndsubcopaci, ziceaservitorulprivinduliste. Darelrspundeantorcnduse:Taci... iapasclipeacauncoldemistre. Subulmi,elzorearisipitealaiuri: Priviicumpufneteiscurmstingher mistreulcucolideargint,pesteplaiuri: veniisllovimcusgeatadefier!... Stpne,eiarbafonindsubcopaci, ziceaservitorulzmbindndrzne. Darelrspundeantorcnduse:Taci... iiarbasclipeacauncoldemistre. Subbrazi,elstrigandemnnduisprecreste: Priviiundeiaflodihniloc mistreulcucolideargint,dinpoveste: veniisllovimcusgeatadefoc!... Stpne,elunalucindprincopaci, ziceaservitorulrzndcudispre. Darelrspundeantorcnduse:Taci... ilunasclipeacauncoldemistre. Darvai!subluceferiipaliziaibolii cumstanamurg,laizvoraplecat, veniunmistreuria,icucolii ltraseslbaticprincolbulrocat. Cefiarciudatmumpledesnge, oprindvntoareamistreuluimeu? Cepasreneagrstnluniplnge? Cevetedfrunzmbatemereu?... Stpne,mistreulcucolicaargintul, chiarelteacuprinsgrohindsubcopaci. Ascultcumlatrcopoiigonindul... Darprinulrspunsentorcnduse:Taci. Maibineiacornulisunntruna. Ssunipnmor,ctrecerulsenin... Atunciasfinidupcreteteluna icornulsun,nsfoartepuin.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Herre,detervannetsomlekerundertrrne, satjeneren,medetlurtblikkpham. Menhansnuddeseg,ogsvarte:Holdmunn... Ogvannetglitretsometvillsvinshoggtann. Underalmetrrneranthannedfordrevedeprosesjoner: Se,hvorledessnorkerogensomtgrynter villsvinetmedhoggtenneravslv,overlandet: komogskytdet,medpilenavjern!... Herre,detergressetsomraslerundertrrne, satjeneren,ogsmiltedristig. Menhansnuddeseg,ogsa:Holdmunn... Oggressetglitretsometvillsvinshoggtann. Undergraneneroptehan,ogpskyndetdemtilsene: Se,hvorfinnerdoghvile villsvinetmedhoggtenneravslv,fraeventyrene: komogskytdenmedpilenavild! Herre,determnensomskinnergjennomtrrne, lotjenerenforaktfullt. Menhansnuddeseg,ogsvarte:Holdmunn... Ogmnenglitretliketvillsvinshoggtann. Mense!underhimmelhvelvingensblekestjerner, menshanvarbydoverenkildeisolnedgangen, kometstortvillsvin,ogmedsinetenner drodethamsmertefulltgjennomdetrdbrunestvet. Hvilketunderligdyrdekkermegmedblod, oghindrerjaktenettervillsvinetmitt? Hvilkensortfuglsitterpmnenogskriker? Hvilketforvitretlvberrermegigjen? Herre,villsvinetselvmedhoggtennerlikslv, hargrepetdeg,gryntendeundertrrne. Hrhvordanhundenebjeffer,ogjagerdet... Menprinsensnuddeseg,ogsvarte:Holdmunn. Dubrtahornet,ogladetlyde. Ladetlydemotdenklarehimmel,tiljegdr... Dagikkmnennedbaksen, oghornetld,menkunenkortstund.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Bemykinfreefrocarnalsin, BridlethetoughtsofthyMaster. TherehathpastawayaglorefrotheEarth; Aglorethatintheheartsandmindsofmen, Mendementedblindfoldedbylight, Nourishethasweedintheirwellgroomdgarths. Might,Itoowasblindfoldedere, Thoyearshavemasterdme Amasqueofthistofashion: Seerblest,thoubestphilosopher! Thequalityofmercyandabsolution, Whencecomethsuchqualities? Buildthyselfamirrorinwhich Solelywantonimagesofthydesireappear! TistheDivineComedy Thefoolandthemockingcourt: Fool,kneelnow,andringthybells!: WeholdtheEarthfroHeavenaway. TistheDivineTragedy Thefoolandthemockingcourt: Fool,kneelnow,andringthybells!: Makeusguffawatthyfutilefollies, YetforourblundersOh,inshame; Earthbearethnobalmformistakes WeholdtheEarthfroHellaway.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Fiirudamealiberdepcatulcrnii inenfrugndurileStpnuluitu. AtrecutslavaPmntului; Slavacareninimileiminileoamenilor, Oamenilornebunilegailaochidelumin, Cretecaburuianangrdinilelorfrumosngrijite. Mrite,ieuamfostlegatlaochinainte, itotuianiimaunvat Omascdeaceastasmiconstruiesc: Profetbinecuvntat,tumarefilosof! Valoareamileiiiertrii, Deundevinasemeneavalori? Construieteiooglindncare Aparnumaiimagininestatornicealedorineitale! AceastaesteDivinaComedie Nebunulicurteabatjocoritoare: Nebunule,ngenuncheazacumisuniclopoeii!: NoiinemPmntuldepartedeCer. AceastaesteDivinaTragedie Nebunulicurteabatjocoritoare Nebunule,nghenuncheazacumisuniclopoeii!: Fnesrdemdeprostiiletalezadarnice, itotuipentrugafelenoastreO,ruinos; Pmntulnupoartniciunbalsampentrugreeli NoiinemPmntuldepartedeInfern.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Thatcrossyouweararoundyourneck;isitonlyadecoration,orareyoua trueChristianbeliever? Yes,Ibelievetruly Then I want you to remove it at once! and never to wear it within this castle again! Do you know how a falcon is trained my dear? Her eyes are sown shut.BlindedtemporarilyshesuffersthewhimsofherGodpatiently,untilherwill issubmergedandshelearnstoserveasyourGodtaughtandblindedyouwith crosses. Youhadmetakeoffmycrossbecauseitoffended.... wearthesymbolofadeitylongdead.Myancestorstriedtofindit.Andto open thedoorthatseperatesusfromourCreator. ButyouneednodoorstofindGod.Ifyoubelieve.... Believe?!Ifyoubelieveyouaregullible.Canyoulookaroundthisworld andbelieveinthegoodnessofagodwhorulesit?Famine,Pestilence,War,Disease andDeath!Theyrulethisworld. Thereisalsoloveandlifeandhope. VerylittlehopeIassureyou.No.Ifagodofloveandlifeeverdidexist... heislongsincedead.Someone...somethingrulesinhisplace. Believe?Inadeitylongdead? Iwouldratherbeapagansuckledincreedsoutworn; Withfearytalesfilldupinhead: ThoughtsoftheBookstillborn. Shadowofannoyance Neercomehither! ...Andwhenhefalleth,HefallethlikeLucifer, Neertoascendagain...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cruceaaceeapecareoporilagt;edoaropodoab,saueticuadevrat ocredincioascretin? Da,credcuadevrat Atuncivreausioscoiimediat!isnomaiporiniciodatnacest castel! tii cum se dreseaz un oim, draga mea? Este legat la ochi. Orbit temporar,elsuportcurbdarecapriciileDumnezeuluisu,pncndvoinai slbete i el nva s slujeasc la fel cum Dumnezeul tu va nvat i va orbitcucrucile. Maipussmiscotcruceapentrucairitat... Nairitatpenimeni.Nupurisimplumiparenepoliticoss...spori deschiduacarenedespartedeCreator. DarnainevoiedeuicasLgsetipeDumnezeu.Daccrezi... S crezi?! Dac crezi etinaiv.Poi s te uiin jur n lume i s crezi n buntatea unui dumnezeu care o stpnete? Foamete, Molim, Rzboi, Boal i Moarte!Acesteastpnesclumea. Maiexistdragosteiviaisperan. Foarte puin speran te asigur. Nu. Dac un dumnezeu al dragostei i vieiiaexistatvreodat...demultemort.Cineva...cevastpnetenlocullui. Screzi?ntrozeitatemoartdemult? Afimaidegrabpgnhrnitdecredinetrecute; Cucapulplindepoveti: GndurialeCriinscutemoarte. Umbrasuprrii Nuveniaiciniciodat! ...icndcadeEl,cadecaLucifer, Frsmaiurcevreodat...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Anartistiswhatiscalldtheselfthatthebrushholdeth ThoughhathitthencaringlycaressdtheCanvasoftomorrow? OCanvas!fortheeIholdmytoolstill!passionlessitquivereth, Mindingnotthatmyhandsaremorethanapt; Mymuse Whereishidden, ThebluehuedarchneaththeHighHeavensrichemblazonry, Theflowerymeadow,embracedbythehorizonsnowflakedandaerymountains, Inwhichthebarebreastedmaidensdancetothelayomidsummer, Aloftthedistantlazyflappingofthedovesinvainglore. OCanvas!whereforecanstthoutheseimagesnotallow? IdeemaprojectionofmyTheatretheyshouldbe! Then,Ichallengetheethewisdomofnaysayingtheyearnsomine Whatisthisunforseenthatnotenjoyethlightshadestobeskillfullypainted? Theravenskypreydonbythesnowfilld,blusteryclouds, Unadornedthemeadowhungerdriveththewolfoutofthewood, Themaidenschainedandwhippedwithinadrearydungeon And,lo!twistthewizenrosesamossygrave: TheDevilisasblackashepainteth OCanvas!wherefore?...

Timeisanabyss Profoundasathousandnights; Isojournmyhaste,Imakerespites Forwhatavaileththiseagerpeace? Onestepmorenaughttoface, Savetheheirloomfatalkiss.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Unartisteceeacesenumetefiinacareinepensula DeiamngiatatuncieacugrijTabloulzileidemine? O,Tablou!pentrutineinunealtatotui!frpatimeatremur, Nepsnduicminilemelesuntmaimultdectvrednice; Muzamea Undeeascuns, BoltaalbstriesubpodoabastrlucitoareanaltuluiCer, Pajiteanflorit,mbriatdeorizontmunidiafaninvemntaidezpad, ncarefecioarecusniigoidanseazpemelodiamiezuluidevar, Departesusflfirealeneaporumbeilorngloriedeart. O,Tablou!dececunotiacesteimagininepermise? SocotceleartrebuisfieoproiecieaTeatruluimeu! Atunci,iprovocnelepciuneadeateopunedorurilormele Ceeacestneprevzutcarenusebucurcndumbreleluminiisuntpictatecudibcie? Cerulnegrunhalngnoriiludroidezpad Pajiteanempodobitfoamealmnpelupafardinpdure, Fecioarelenctuateibiciuitentrotemnintunecoas iiat!printretrandafiriivestejiiunmormntacoperitcumuchi: Diavolulelafeldenegruprecumpicteaz O,Tabloule!dece?...

Timpuleunabis Profundcaomiedenopi; mioprescpuingraba,iauunrgaz Lacefoloseteliniteaaceastanerbdtoare? Niciunpasnuarerostsmainfruni nafardesrutulinevitabilalmotenirii.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


IravenomoregainstTimeorFate, Forlo!myownshallneercometome, Yet!Whodothmyfuturenarrate? DimthelightsIcannotsee! BringforthyeShadow! Withwhomdanceththou? Timehathstoppd Yetforothersneerhalteth; FormethePagesofLifedonotturn, Lo!onthefuneralpyretheyburn. TheohsoeathingVelvetDarknesstheyfear Heed!whereforedelveaburrow, WheninmyarmsO!Comehere? Isay,elsehitherisnaughtbutsorrow! Forwhatdeemestthousodearthyblood Whenthroughmyveinsitcouldflood? Bidetomerrymakemeunaptly; Andhencegrantmethefellgift, Thegiftofpassingonthedarktrick. Tissuchabrazenactoferotic; Trifleforthee,yetformegrandlythrift, O!suchaninnocencedeprivdsohastily Alas,forwhatdeemestthousodearthyblood Whenthroughmyveinsitwillflood?

MeineAugensindsodunkel, AuchsinddieVisionenschwarz, SchwarzwiedieNacht; DerDmmerzustanddesMenschen IstmeineZeitdesDaseins.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


NumaidelirezmpotrivaTimpuluisauSorii, Cciiat!ceialmeunuvaveninicicndlamine, Totui!Cinemipovesteteviitorul? ntunecluminilenupotvedea! Descoperiumbra! Cucinednuieti? Timpulsaoprit Totuipentrualiinuseopreteniciodat; PentruminePaginileVieiinusentorc, Iat!perugulfunerarardele. SetemdentunericuldeCatifea Atenie!decessapiovizuin, CndnbraelemeleO!Vinoaici? Spun,altcevanuedectdurere! Pentruceisocotetisngeleattdescump Cndprinvenelemelesarputearevrsa? Continuinepriceputsmnveseleti; ideaicimidaidarulslbatic, Daruldeatransmitefarsantunecat. Esteunactattdendrznedeerotism; Unfleacpentrutine,totuipentruminemarectig, O!aaoneprihnirecurmatcuattanesbuin Vai,pentruceisocotetisngeleattdescump Cndprinvenelemelesevarevrsa?

Ochiimisuntattdentunecai, Lafeliviziunilenegre, Negrecanoaptea; Venireaamurguluiomenirii ntimpulexisteneimele.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


GleichwohlhastdudeineAugenversteckt LichtscheinhinterderDunkelheit; EinLichtdasmirgezeigthat, DaduvonAngsterflltbist, Erzhlemirbitte WarumdudieseAngstinDirtrgst?! Ichbinsoalleine; EinsamkeitinEwigkeit Gedankennurfrmich, MitdenSchattenflstereich MitdenSchattentanzeich Einsamwandereich, DasBlutbegehreich:Totentanz. DentdlichenKuzuempfangen; FolgederFinsternisindasNichts! SerNektaraufdeinenLippen; EinRinnsalblutfleuchtesLeben, IchleckedieLiebeausdeinemGesicht, IchleckedenHaausdeinemGesicht! TanzenichtmehrmitdemSchatten, TanzebittenichtberdasGrab, TanzemitmirdenWalzerLuzifers. Ichsehnemich,nachDeinerLiebe UmzuFinsterniszuwerden. EinsoberauschendesGefhl: MeinebittereExistenzzuschmecken! Frimmerundunendlich: EinSeelsorgerDeinerbinich. LamichDeinenKubegren: DenselbstzerstrerischenKu. Gebedichmirhin! IchwarvonTrauererfllt, Ichwarsountrstlich, DochduhastdieLiebeentfacht...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


iaiascunsochiideaproapeletu Strlucirealuminiinspatelentunericului; Oluminmiaartataceasta, Pentrucetiplindenelinite, Spunemiterog Deceporiaceastnelinitentine?! Suntattdesingur; Singurtatenvenicie Gndurinumaipentrumine, Cuumbreleoptesc Cuumbrelejoc Singurrtcesc, Rvnescsngele:dansulmorilor. Sprimetisrutulmortal; Urmareantunecimiinnimicnicie! Nectaruldulcedepebuzeletale; Ocurgeredesngeavieii, Lingiubireadepefaata, Linguradepefaata. Numaidansacuumbrele, Numaidansaterogdeasupraacestuimormnt, DanseazcuminevalsulluiLucifer. Miedordeiubireata Casajungnntunecime. Unsentimentattdefermector: Sgustexistenameaamar! Pentrutotdeaunailanesfrit: Mvoingrijidesufletultu. Lasmsiprimescsrutulcubucurie: Srutuldistrugeriinoastre. Pnatuncidmite! Amfostplindejale, Amfostattdernit, Totuituaicrescutiubirea.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


...bisichsterbe,umarmemich, Undichwerdewiederauferstehen... IchliebeDich...

Gauntandgnarld Reflecteththesilvershieldthiswelkinaghast, Andwithhastetranslatethtogilddblackpostandfast. Anonanon,sayI!thelidaside, Crawlwithoutthisvelvetcladcoffinblest, Thebottomsandofthehourglassisattide, Tisandhatheerbeenmerrybloodtopest TobeadustfortimelongercanInotbide, Hencethehearthaleoutthrothechest! Miserythee?!Rathermiseryme! ForinTimesduranceamInaughtbutwee. Sensingthispineisasdeepasthedeepestchasm, Hither!cedeandfulfilmyphantasm! Cherishmeandsonorouslydomelaud Fordread!thineeyeswillbeholdaguisefaughd. ThistenderandlovingpestItotheebequeath, ThenceswiftlywiltthouerranttoNeath. Andtomeshouldstthoubethehumblemostknave, Lestfear!spitIonthycistandgrave! LestleerIattheeanddobewitch, Andthetharmsflutteringclawdandeldritch. Toconquertheeandthybloodforglore Artthoumyafeardandreluctantwhore; Irksomelycoy,savewilidbyalarum, Bearthistortureandmaimwithdecorum. IfeeralwayswasIthisblissfulandblithe WouldIresigntobutitsweetithe.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


...pncndvoimuri,mbrieazm, ivoinviadinnou... Teiubesc...

Slabinoduroas Aceastboltcereascngrozitreflectscutuldeargint, icugrabumpledencntarestlpulnegruauritipostul. ndatndat,ziceu!capaculdeoparte, Blestematstetrtifracestsicriumbrcatncatifea, Nisipuldepefundulclepsidreiencretere, Esteiafosttotdeaunafireveseldesuprare Numaipotateptasmvestejesc, Prinurmareinimamisezbateputernicnpiept! Tecomptimeti?!Maidegrabcomptimetempemine! Ccinntindereatimpuluinusuntnicimcarmrunt. Durereaaceastaeprofundcaceamaiadncprpastie, Aici!cedeazimplinetemifantezia! Iubetemiadumielogii Ccitemete!ochiitivorprivioformrespingtoare. Aceastcalamitatetandriiubitoareiolasmotenire, DinacelmomentveirtcicurepeziciunectreAdnc. ivatrebuismifiislujitorulcelmaismerit, Ccidacnutemete!iscuippemormnt! Sauteprivesccucoadaochiuluiitevrjesc, Fluturndbraelecugheareciudate. Castecucerescpetineialtusngentruslav mietitrfapotrivnicitemtoare; Suprtordesfioas,darntritdepanic, ndurasttorturischilodirecubuncuviin. Dacafifostvreodatattdeveselifericit Aacceptazeciuialanumic.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Purveymyacheandquenchmyprofoundesturge, AndtotheewillIsingthelulldulldirge; Deliverthybloodliketherillfilleththeghyll. BurrowtothetrothplightwiththeNightandDevil! BidHimtoleaguewithmeforsooth,merrytocometwill. Whilomwastthouvestal,yetnowflittothytryst, ElsewisewillIcoercethineconsonantrytoturnwhist; GraspIthesnathandcutoffthinebreath, Sothatthoucanstindarknessandinfernovester, FordoIsolelywhatHetomelieflysaith. Deathoh!fairandguilingcopesmateDeath, Benotamalaisdbeggar;claimthisbloodyjester!

Osoftembalmerofyestillmidnight, Allowmetheetoadown Ofansortthoufancieth; Eachholdethitsownfancy,Isay Yetthepleasurewepartakein Wascausdbythefangdgrin, Save!,doIforhimangerhold?: NayIknewIwasfey! HadIwhatittaketh,Iwoulddo; IsenseIcannotsense, Iamyet!Iamnot OnceIkissdtheimage OftheSevenAngelsofDeath. Yetasthousodidst, Onmylipsakisslanded, Andwiththeshadowsblended Thetendermostsilkenmourn; Inwhichthelighthiddenis YonHellsbrazendoors Wrathfullyittriethtopush.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Dmidurereistingemidorinelecelemaiprofunde iivoicntabocetullinititnedesluit; Aruncisngeleprecumruleulumpleiazul. AdpostetetenjurmntuldefidelitatecuNoapteaiDiavolul! InvitLsseuneasccuminenegreit,vafibucurossvin. Odataifostfecioar,totuiacumtegrbetictreloculdentlnire, Altfelvoisiliarmoniatasnceteze; Apucavoicoasaiivoitiarsuflarea, Caspoiajungenntunericiinfern, CcieufacdoarceeaceElmispunecudraginim. Moarteo!Moartefrumoasiireattovardevemnt, Nufioceretoarenenorocit;cereiacestbufonsngeros!

Odulceparfumalmiezuluilinititdenoapte, Lasmstesorb nfelulncareiplaceie; Fiecareiareiluziilesale,spun Totuiplcerealacarelumparte Afostpricinuitdernjetulcoluros, O!,suntmnioaspeel?: Nutiamcamfostsotitmorii! Dacaaveacetrebuie,aface; Simtnupotssimt, Sunttotui!nusunt Odatamsrutatimaginea CeloraptengeriaiMorii. Totuicndaifcutasta Pebuzelemeleapopositunsrut, iamestecatcuumbrele Bocetultandrudemtase; ncareluminaesteascuns UiledebronzalendeprtatuluiInfern Cufurieelncearcslemping.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Then,lo!theBleakDeath, Serpentliketwixtthebreastscrept: Hushdwithagaspoflifesbreath, Togetherredtearstheywept, Andpassdtheprocessionofdancersdead Asindarknesswerewelockdinwed. Hushdwithagaspoflifesbreath, Togetherredtearsweweptinvain, Andpassdtheprocessionofdancersdead Asindarknesswerewelockdinwed: IkissdtheSevenAngelsofDeath. AndHellopenditsdoors, Yetwhatwasforemyeyes Butifnotthebrightestlight. Yetwhatwasforemyeyes Butifnotthebrightestlight.

WhetherHethequaintsavantspowerdothholdIknownot, AlbeitaetatathousandstarsbirthHeis QuothIthatforreasonstomeoblivious AugustofagranditudeofservantsisHeheld, Andbyplasticconsonantryeenmoreservantstothehostaddedare Pelftheyare,dareIsay! MaugreHisdiurnalseraphicdeviltry Isaythatdeviltrytisforsoothdeviltry! Mindnotthisinscintillatingshadescladis; ToclaimthegloreisHesufferd. Grantmethefallings,quothHe,thefatterthebetter!, Anddiedtheyofstarvation;

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Atunci,iat!MoarteaStearp, Setracaunarpentresni: Linititdersuflareantretiatavieii, mpreunauplnslacrimisngerii, iaulsatmortnurmalaiuldansatorilor Dupcumnntunericfostamnoilegaincununie. Linitiidersuflareantretiatavieii, mpreunamplnslacrimisngeriinzadar, iamlsatmortnurmalaiuldansatorilor Dupcumnntunericfostamnoilegaincununie: AmsrutatceiaptengeriaiMorii. iIaduliadeschisporile, Totuiceeranainteaochilormei Dacnuceamaistrlucitoarelumin. Totuiceeranainteaochilormei Dacnuceamaistrlucitoarelumin.

DacElineputereasavantuluiciudateunutiu, DeiElatritnatereaaomiedestele Amziscpentrumotiveuitate Elesocotitmredeomulimedeservitori, iprinarmoniemldiosncmaimuliservitoriseadaugcetei Bogaisuntei,ndrznescaspune! nciudazilniceisalemagiinegreserafice Spuncmagianeagrestefrndoialmagieneagr! Snuiiseamacaceastaembrcatnumbrescnteietoare; Elasuferitpentruapretindegloria. Druietemicderile,zisaEl,ctmaimari!, ieiaumuritnfoamete;

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Theyarenotslaughteringtheirfatlings; Theyareslaughteringthemselves. SithIattimeofyesterthequestionsdurstask, AnddareIsaythisburdenweightfulwas, WrackofHismachinelikemotionwasInamed, Thoblindandfondthejestersrebuilt Themachinealikeyetwhettedadightareitsedges...

Hist!thesonorousorchestralambienceandthearabesqueslanedballerina, Herweefeetinanalacriticmaelstromtwirl, AndthedusthurlwithhertearsblendethEgad!thisquagmire; Pastethherunaptlyaptfeettothestage: LikethewitherdroseoftheluciferousEden Bythemummerdmasqueraderespiedvigillyandmockingly, Hisbehestingvisage,thoruddilymummerdtis Embowerdandeddyingoftandeftgloambygloam, Hersweetnessneercloyfurther!further! Hisscratchinganddallyinghollowheartedeyes Herbreastsandvestalheartcaress, Andlikethedoveandbirdofpreyleapethsheaerily, Whileastheorchestraplayethontravailingly; Hisoneandsoleswath Withthepizzicatodensembleblendeth Andherumbralfoetalscream Asthesongclimaxeth Andslowly Diethaway...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Einuimcelrescjertfele; Semcelrescpeeinii. Deatuncinvremeadeieriamcutezatspunntrebrile, indrznescsspuncastpovargreaafost, EpavamicriiLuimecanicefostamnumit, Deiorbiiridicoli,bufoniiaureconstruit Mainalafeltotuimaiascuiteisuntmarginile...

Ascult!sonoraambianorchestralibalerinantinsnarabesc, Picioareleeimicintrunvrtejvioi, iprafulridicatamestecatculacrimilesaleDoamne!aceastmlatin ilipetedescenpicioarelenepotrivitdepotrivite: CatrandafirulvestejitalEdenuluicelumineaz Urmritdemascatatentibatjocoritor, Faaluiporuncitoare,deiesngerie nchisinvrtinduseadeseaiapoidinnou,amurgdeamurg, Blndeeaeinuoboseteniciodatmaideparte!maideparte! Ochiiluifrinimcarezgrieiirosesc imngiesniiiinimapur, icaporumbelulipasreadepradsalteauoar, ntimpceorchestracntncontinuarenagonie; Singuraluiloviturdecoas Cupizzicatoulansambluluiseamestec iiptuleiumbritifetal Cndcnteculculmineaz incet Sestinge...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



LassmichdeineTrnereitenbersKinnnachAfrika wiederindenSchossderLwinwoicheinstzuhausewar ZwischendeinelangenBeinensuchdendenSchneevomletztenJahr dochesistkeinSchneemehrda LassmichdeineTrnereitenberWolkenohneGlck dergrosseVogelschiebtdenKopfsanftinseinVersteckzurck ZwischendeinelangenBeinensuchdendenSandvomletztenJahr dochesistkeinSandmehrda Sehnsuchtversteckt sichwieeinInsekt imSchlafemerkstdunicht dasesdichsticht glcklichwerdichnirgendwo derFingerrutschtnachMexiko docherversinktimOzean Sehnsuchtistsograusam Sehnsucht Sehnsucht Sehnsuchtversteckt sichwieeinInsekt imSchlafemerkstdunicht dasesdichsticht glcklichwerdichnirgendwo derFingerrutschtnachMexiko docherversinktimOzean Sehnsuchtistsograusam Sehnsucht Sehnsucht

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



LasmscltorescpelacrimatadepeobraznAfrica napoinpoalaleoaiceicaremiafostodatcas ntrepicioareletalelungicutndzpadaultimuluian darnamairmasdeloczpad Lasmscltorescpelacrimatadeasupranorilorfrnoroc psreamareiscuturcapulnapoindusecugingienascunztoare ntrepicioareletalelungicutndnisipulultimuluian darnamairmasdelocnisip Dorulseascunde caoinsect nuidaiseamansomn cteneap nuvoififericitnicieri degetulalunecspreMexic darsescufundnocean doruleattdecrud dor dor Dorulseascunde caoinsect nuidaiseamansomn cteneap nuvoififericitnicieri degetulalunecspreMexic darsescufundnocean doruleattdecrud dor dor

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


WerzuLebzeitgutaufErden wirdnachdemTodeinEngelwerden denBlickgenHimmelfragstdudann warummansienichtsehenkann erstwenndieWolkenschlafengehn kannmanunsamHimmelsehn wirhabenAngstundsindallein GottweissichwillkeinEngelsein SielebenhintermSonnenschein getrenntvonunsunendlichweit siemssensichanSternekrallen(ganzfest) damitsienichtvomHimmelfallen erstwenndieWolkenschlafengehn kannmanunsamHimmelsehn wirhabenAngstundsindallein GottweissichwillkeinEngelsein GottweissichwillkeinEngelsein GottweissichwillkeinEngelsein GottweissichwillkeinEngelsein

WasmachteinMann wasmachteinMann derzwischenMenschundTier nichtunterscheidenkann was ErwirdzuseinerTochtergehen sieistschnundjunganJahren unddannwirderwieeinHund miteigenFleischundBlutsichpaaren

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cineafostbunntimpulvieiipepmnt vadeveningerdupmoarte privindctreceruritentrebiatunci decenuipoatevedeanimeni. Doarcndnoriimerglaculcare putemfivzuincer neefricisuntemsinguri Dumnezeutie,nuvreausfiunger Eitriescnspatelerazelordesoare despriidenoilanesfritdeparte trebuiesseindestele(foartestrns) casnucaddincer Doarcndnoriimerglaculcare putemfivzuincer neefricisuntemsinguri Dumnezeutie,nuvreausfiunger Dumnezeutie,nuvreausfiunger Dumnezeutie,nuvreausfiunger Dumnezeutie,nuvreausfiunger

Cefaceunbrbat cefaceunbrbat carenupoatedeosebi ntreomifiar ce Elvamergelafiicasa efrumoasitnr iapoi,cauncine, sevamperecheacusngedinsngelelui

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Wastustdu Wasfhlstdu Wasbistdu dochnureinTier WasmachtdieFrau wasmachtdieFrau diezwischenTierundMann nichtunterscheidenkann SietauchtdieFederinseinBlut schreibtsichselbstselbereinenBrief entseelteZeilenandieKindheit alsderVaterbeiihrschlief Wastustdu Wasfhlstdu Wasbistdu dochnureinTier

Bestrafemich bestrafemich StrohwirdGold undGoldwirdStein deineGrssemachtmichklein dudarfstmeinBestrafersein ja DerHerrgottnimmt derHerrgottgibt Bestrafemich bestrafemich dumeinstja undichdenknein schliessmicheinindeinGebet bevorderWindnochklterweht

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cefaci Cesimi Ceeti doarofiar Cefacefemeia cefacefemeia carenupoatedeosebi ntrefiaribrbat Eainmoaiepanansngelelui iscrieoscrisoare liniifrsufletdesprecopilrie cndtatldormealngea Cefaci Cesimi Ceeti doarofiar

Pedepsetem pedepsetem paiuldevineaur iauruldevinepiatr mreiatamfacemic poifipedepsitorulmeu da Domnulia Domnuld Pedepsetem pedepsetem tuvreisspuida ieugndescnu cuprindemnrugciuneata naintecavntulsbatimairece

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


DeineGrssemachtmichklein dudarfstmeinBestrafersein dudarfstmeinBestrafersein DeineGrssemachtmichklein dudarfstmeinBestrafersein deineGrssemachtihnklein dudarfstmeineStrafesein DerHerrgottnimmt derHerrgottgibt dochgibternurdem denerauchliebt bestrafemich

Du Duhast Duhastmich Duhastmich Duhastmichgefragt Duhastmichgefragt Duhastmichgefragtundichhabnichtsgesagt WillstdubisderTodeuchscheidet treuihrseinfralleTage... nein WillstdubiszumTodderScheide sieliebenauchinschlechtenTagen.... nein nein WillstdubisderTodeuchscheidet treuihrsein... nein nein

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Mreiatamfacemic poifipedepsitorulmeu poifipedepsitorulmeu Mreiatamfacemic poifipedepsitorulmeu Mreiatalfacemic veifipedeapsamea Domnulia Domnuld dardnumai celuipecareliubete pedepsetem

Tu Tum Tumai Tumai Tumaintrebat Tumaintrebat Tumaintrebatieunamspusnimic Vrei,pnmoarteavvadespri, sifiicredinciosntoatezilele nu nu Vrei,pnlamoarteacrpturii, soiubeti,chiarinzilegrele nu nu Vrei,pncndmoarteavvadespri, sifiicredincios nu nu
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


BckDich bckdichbefehlichdir wendedeinAntlitzabvonmir deinGesichtistmiregal bckdich einZweibeineraufallenVieren ichfhreihnspazieren imPassgangdenFlurentlang ichbinenttuscht jetztkommterrckwrtsmirentgegen honigbleibtamStrumpfbandkleben ichbinenttuscht,totalenttuscht bckdich bckdich bckdich bckdich dasGesichtinteressiertmichnicht derZweibeinerhatsichgebckt ineingutesLichtgerckt zeigichihmwasmanmachenkann undichfangzuweinenan derZweifussstammelteinGebet ausAngstweilesmirschlechtergeht versuchtertiefsichnochzubcken TrnenlaufenhochdenRcken bckdichbefehlichdir wendedeinAntlitzabvonmir deinGesichtistmiregal bckdichnocheinmal

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


apleacteiporuncesc ntoarceichipuldinspremine numipasdefaata apleacte unbipednpatrulabe liaulaplimbare nbuiestrupehol suntdezamgit acumelvinenspatelemeu cumierelipitdejartier suntdezamgit,totaldezamgit apleacte apleacte apleacte apleacte numintereseazfaa bipedulsaaplecat ncadratntroluminbun iartcesepoateface incepsplng bipedulbolboroseteorugciune cufric,pentrucmiemairu ncearcsseaplecemaimult lacrimicurgnsuspespate apleacteiporuncesc ntoarceichipuldinspremine numipasdefaata apleactencodat

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


WirteilenZimmerunddasBett Brderleinkommseisonett Brderleinkommfassmichan rutschganzdichanmichheran VordemBetteinschwarzesLoch undhineinflltjedesSchaf binschonzualtundzhlsiedoch dennichfindkeinenSchlaf UntermNabelimGest wartetschoneinweisserTraum Brderleinkommhaltdichfest undschttelmirdasLaubvomBaum SpieleinSpielmitmir gibmirdeineHandund spielmitmireinSpiel spielmitmireinSpiel spielmitmirweilwiralleinesind spielmitmireinSpiel VaterMutterKind DemBrderleinschmerztdieHand erdrehtsichwiederandieWand derBruderhilftmirdannundwann damitichschlafenkann SpieleinSpielmitmir gibmirdeineHand spielmitmireinSpiel spielmitmireinSpiel spielmitmirweilwiralleinesind spielmitmireinSpiel VaterMutterKind

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mprimcasipat frioare,vinoifiibun frioare,vinoiatingem alunecaproapedemine nfaapatuluiogaurneagr ifiecareoaiecadenea suntdejapreabtrn,darnclenumr fiindcnumipotgsisomnul Maijosdemijlocncrengi unvisalbateaptdeja frioare,vinoiapucbine iscuturmifrunzeledincopac Joacunjoccumine dmimnai joactecumineunjoc joactecumineunjoc joactecumineccisuntemsinguri joactecumineunjoc tatmamcopil Pefriorldoaremna sentoarcectreperete fratelemajutcndicnd caspotdormi Joacunjoccumine dmimnai joactecumineunjoc joactecumineunjoc joactecumineccisuntemsinguri joactecumineunjoc tatmamcopil

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Siesagenzumir schliessaufdieseTr dieNeugierwirdzumSchrei waswohldahintersei hinterdieserTr stehteinKlavier dieTastensindstaubig dieSaitensindverstimmt hinterdieserTr sitztsieamKlavier dochsiespieltnichtmehr achdasistsolangher dortamKlavier lauschteichihr undwennihrSpielbegann hieltichdenAteman Siesagtezumir ichbleibimmerbeidir docheshattenurdenSchein siespieltefrmichallein ichgossihrBlut insFeuermeinerWut ichverschlossdieTr manfragtenachihr DortamKlavier lauschteichihr undwennihrSpielbegann hieltichdenAteman dortamKlavier standichbeiihr eshattedenSchein siespieltefrmichallein

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Misespune descuieua curiozitateadevineunstrigt cepoatefinspateleei nspateleacesteiui stunpian clapelesuntprfuite corzilesuntdezacordate nspateleacesteiui stealapian darnumaicnt vaiastaeraattdedemult acololapian oascultam icndncepeascnte miineamrsuflarea Eamiaspus voirmnemereucutine darsepreadoar ceacntnumaipentrumine iamvrsatsngele nfoculmnieimele amncuiatua auntrebatdeea Acololapian oascultam icndncepeascnte miineamrsuflarea acololapian stteamlngea seprea cnumaipentruminecnta

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


GeffnetistdieTr eiwiesieschreien ichhredieMutterflehen derVaterschlgtaufmichein manlstsievomKlavier undniemandglaubtmirhier dasichtodkrank vonKummerundGestank DortamKlavier lauschteichihr undwennihrSpielbegann hieltichdenAteman DortamKlavier lauschtesiemir undalsmeinSpielbegann hieltsiedenAteman

ErwartetaufdenMittagswind DieWellekommtundlegtsichmatt MiteinemFcherjedenTag DerAltemachtdasWasserglatt IchwerfdenSteinzumeinemSpass DasWassersichimKreisbewegt DerAltesiehtmichtraurigan Undhateswiederglattgefegt ImweissenSandderalteMann ZitterndseinPfeiferaucht NurdasWasserundichwissen WozuerdiesenFcherbraucht DieAhnungschlftwieeinVulkan Zgerndhabichdanngefragt DenKopfgeneigtesschienerschlft Haterbevorerstarbgesagt
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Uaedeschis o,cummaistriglumea oaudpemamaimplornd tatambate odesprinddepian inimenideaicinumcrede csuntbolnavdemoarte demhnireiduhoare Acololapian oascultam icndncepeascnte miineamrsuflarea acololapian eamasculta icndncepeamscnt iinearsuflarea

Elateaptvntulmiezuluidezi Valulvineiuorseaaz Btrnulnetezeteapa nfiecarezicuunevantai Aruncopiatrcasmdistrez Apasemicncercuri Btrnulseuitlaminecutristee ionetezetedinnou Penisipulalbbtrnul ifumeazpipatremurnd Doarapaicuminetim Laceitrebuieevantaiul Presimireadoarmecaunvulcan Atunciamntrebatezitant Capulisanclinat,preacdoarme Spusenaintedeamuri.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


DasWassersolldeinSpiegelsein Erstwennesglattist,wirstdusehen WievielMrchendirnochbleibt undumErlsungwirstduflehen DenFcherandenLeibgepresst ImTodeskrampferstarrtdieHand DieFingermusstensieihmbrechen DerFcherbleibtzurueckimSand DenAltenrufichjedenTag Ermchtemichdochhiererloesen IchbleibzurckimMittagswind UndindemFcherkannichlesen DasWassersolldeinSpiegelsein Erstwennesglattist,wirstdusehen WievielMrchendirnochbleibt undumErlsungwirstduflehen

Binichschner ZerschneidmirdasGesicht Binichstrker BrichfeigemeinGenick Binichklger TtemichundissmeinHirn HabichdeinWeib Ttemichundissmichganzauf Dannissmichganzauf

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Apaivafioglind Doarcndenetedveivedea Ctepovetiisuntlsate iveiimploramntuirea Evantaiulapsatpetrup nluptacumoarteamnanepenete Trebuiesiserupdegetele Evantaiulelsatnurmpenisip lstrigpebtrnnfiecarezi Poatemiaducemntuireaaici Suntlsatnurmnvntulmiezuluidezi inevantaipotciti Apaivafioglind Doarcndenetedveivedea Ctepovetiisuntlsate iveiimploramntuirea

Dacsuntmaifrumos Taiemifaa Dacsuntmaiputernic Rupemigtulculaitate Dacsuntmaidetept Ucidemimnncmimintea Dacoampenevastata Ucidemimnncmtot Atuncimnncmtot

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Binichehrlicher BeissmirdieZungeab Binichreicher Dannnimmmiralles Binichmutiger TtemichundissmeinHerz HabichdeinWeib Ttemichundissmichganzauf Dannissmichganzauf DochleckdenTellerab EskochtdieEifersucht HabichsoglatteHaut ZiehsieinStreifenab HabichdieklarenAugen NimmmirdasLicht HabichdiereineSeele TtesieinFlammen HabeichdeinWeibdann Ttemichundissmichganzauf Dannissmichganzauf DochleckdenTellerab EskochtdieEifersucht

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Dacsuntmaicinstit Mucmilimba Dacsuntmaibogat Atunciiamitot Dacsuntmaicurajos Ucidemimnncmiinima Dacoampenevastata Ucidemimnncmtot Atuncimnncmtot Darlingefarfuria Secoacegelozia Dacampieleaattdeneted Rupeonbuci Dacamochiilimpezi Iamilumina Dacamsufletulcurat Ucidelnflcri Dacoampenevastata Ucidemimnncmtot Atuncimnncmtot Darlingefarfuria Secoacegelozia

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Siehltimmerstill Weilsiegefingertwerdenwill BlhtsichaufimduerrenGras Dasfeuchteugeleinwirdnass GefangeninderFinsternis SiehtsieniedasLichtderSonne VorGeilheitzuckendflehtsiedann DieZungeindemMannean Kssmich SiebeisstsichinjederZungefest Weilsiesichgerneleckenlaesst Dochweilesetwasbitterschmeckt Wirdsieseltennurgeksst GefangeninderFinsternis SiehtsieniedasLichtderSonne VorGeilheitzuckendflehtsiedann DieZungeindemMannean Kssmich DieZungekriechtjetztausdemMund UndschlgtihrwildundinExtase MehrmalsheftiginsGesicht SieblutetschrecklichausderNase GefangeninderFinsternis SiehtsieniedasLichtderSonne VorGeilheitzuckendflehtsiedann DieZungeindemMannean Kssmich AufmeinefeuchtenLippen Kssmich Auchwennesbitterschmeckt Kssmich

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ntotdeaunaeastlinitit Fiindcvreasfieatinscudegetul Seumflniarbauscat Ochioruljilavdevineumed Captivnntuneric Nuvedeniciodatluminasoarelui Scuturndusedinlascivitate,imploratunci Limbadinuntrulunuiom Srutm Eamuciapucfiecarelimb Fiindciplacesfielins Darpentrucareungustpuinamar Erareorisrutat Captivnntuneric Nuvedeniciodatluminasoarelui Scuturndusedinlascivitate,imploratunci Limbadinuntrulunuiom Srutm Limbsetrteacumdingur ioloveteslbaticinextaz Dectevaoriviolentpestefa Nasulisngereazteribil Captivnntuneric Nuvedeniciodatluminasoarelui Scuturndusedinlascivitate,imploratunci Limbadinuntrulunuiom Srutm Pebuzelejilave Srutm Chiardaceamar Srutm

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


MarteesteceamaistudiatplanetdinSistemulnostruSolar,nafarde Terra, desigur. i dac, ntrun viitor mai deprtat sau mai apropiat, oamenii vor reui s o colonizeze, se pune problema: cum vor fi influenate personalitile colonitilor de noullor mediude via? Vor existadoar dificulti de adaptare la gravitaia redus ila slbticia peisajului,la deprtarea de cascu alte cuvinte doargreutideordinfizicipsihologic?Laprimavedere,aasarprea,dacnu lumnconsideraieeventualeboliprovocatedebacteriisauvirusurinecunoscute, ori conflicte teritoriale cu extrateretrii. Vor fi oare deosebiri temperamentale sau din punct de vedere al tipurilor de personalitate de baz ntre pmnteni i colonitiimarieni?Cumunadintiinelecareanalizeaztocmaiacesteaspecte,cu date iniiale extrem de puine comparativ cu rezultatele, este astrologia, vom descriencontinuarecadrulgeneralncaresardesfuraunastrologinteresatde studiimariene. n primul rnd, Marte este mai deprtat de Soare ca Pmntul, anul marianfiinddeaproximativ2orimailungdectcelterestru.Consecinadirecta acestui fapt ar fi aceea c Soarele parcurge zodiacul de 2 ori mai ncet. Dac pe Pmntvitezasamedieestede5908/zi,peMarteeaestede3219/zi.Noiunile dezi,oretc.,scrisecuitalice,reprezintunitidetimpmariene.Vomvedeade altfelczilelepePmntipeMartesuntaproapeegale. Omarediferenestensntreperioadelepecareastrulzileilepetrecen cele 12 zodii. Dac pe Terra lucrurile sunt ct de ct simple, cci Soarele merge aproape uniform, nu acelai lucru se ntmpl pe Marte. Orbita sa, avnd o excentricitate(turtire)destuldemare,vitezaderevoluievariazmultnfunciede distanapnlaSoare. Cndplanetaseafllaperiheliu(punctulcelmaiapropiatdeSoare),viteza eiestemaxim.AcestlucrusentmplcndSoareleseafllacirca6fecioarn zodiaculmarian.nacestmomentelparcurge3908/zi,ceeacereprezint121% dinvitezamedie.Cndvitezaesteminim,laafeliu(punctulcelmaideprtatde Soare, opus periheliului), Soarele parcurge doar 26 55/zi, adic 83% din viteza medie. ntabelulurmtorsepotobservaacesteelemente,comparativ,ntreMarte iPmnt: Viteza Vitezala Vitezala Poziiarelativa medie periheliu afeliu Soareluilaperiheliu Marte 3219 3908 2655 558 (100%) (121%) (83%) fecioar Pmnt 5908 6109 5712 1205 (100%) (103%) (97%) capricorn
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cafaptdivers,iatctezilepetreceSoarelenfiecarezodie(demenionat c pe Terra zodiile sunt aproape egale, de 3031 zile, cea mai scurt fiind capricornul,iarceamailungracul): Be T G R L F Ba Sc S C V P 64 58 54 49 47 47 48 52 56 61 66 66 n timp ce poziia Soarelui se leag de micarea de revoluie a planetei, indicatorii micrii de rotaie sunt casele cerului. Ziua marian este puin mai mare dect ziua terestr. Dac pe Pmnt o zi are 23h 56, la care se adun 4 rezultatedincompunerearotaieicurevoluia,adicuntotalde24h,peMarteozi are24h37+2,2124h40. Mijlocul Cerului marian va traversa deci zodiacul cu 15/h, sau cu 1436/h.ncalculareacaselorceruluipentrudiverselatitudini,astrologiivortrebui sinseamaeventualidenclinareaecuatoruluipeorbit,de24,aproapeegal cuaceeaaTerrei(2327). Un element complet nou care apare n astrologia marian este Soarele negru. Orbita fiecrei planete este o elips cu 2 focare. ntrun focar se gsete Soarele. Poziia n zodiac a celuilalt focar, neocupat, este poziia Soarelui negru. DeoareceorbitaPmntuluiesteaproapecircular,distanadintreSoareiSoarele negru este de maxim 155. Singurul lucru interesant ar fi, cred, de vzut ce se ntmplcndSoarelenegruestenainteaSoareluiicesentmplcndenurma lui. Cu totul altfel stau lucrurile pe Marte. Datorit excentricitii mari a orbitei, diferenapoateatinge1043!Ceeace,desigur,nupoatefineglijat. Marte are 2 satelii: Phobos i Deimos. Comparativ cu Luna, acetia sunt doar nite bolovani, ns o influen subtil asupra contextului planetar zodiacal este,dacnuprobabil,celpuinposibil. Phobosestefoarterapid;perioadasaderevoluieestemaimicdeozi,aa c, privit de la suprafaa planetei, el rsare la vest i apune la est. n zodiac lucrurilesuntmaipuinspectaculoase,darlafeldeinteresante.Satelitulparcurge ntregulzodiacdepeste3orintrozi,cuvitezamediede4820/h.De3orimai rapidcaMijloculCerului! Deimosestemailent:numai1213/zi.Totuide22deorimairapiddect biatanoastrLun!Ceesteaiciinteresant:acestsatelitareovitezapropiatdecea a MijloculuiCerului(iacaselor,n general). Deaceea, unaspect ntre cele dou puncte se menine n toleran de 8 timp de 6 ore, n vreme ce acelai aspect dureazpePmnt(nraportcuLuna)doar1or. n astrologia terestr se studiaz, ca elemente importante, Luna neagr (Lilith)iaxaNodurilorlunare(puncteleundeplanulorbiteiselenareintersecteaz planuleclipticiialorbiteiTerreinjurulSoarelui).IatcpeMartearmaitrebui
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


studiate: Phobosul negru, axa Nodurilor Phobosiene, Deimosul negru i axa NodurilorDeimosiene.Unsubiectdemeditaiearfidacsateliiiartificialilansai deomnuinflueneazieinvreunfelpersonalitateanativilor Ajungem n cele din urm la problema planetelor Sistemului Solar, n proieciemartecentric.Pentru Pmnt, Mercur i Venus sunt planete inferioare (maiapropiatedeSoare),carenusedeprteazdeacestanzodiaccumaimult de 28, respectiv 48. Pentru Marte, i Pmntul este planet inferioar. Astfel, distanelemaximeposibilentreacesteplaneteiSoare,vzutedepeplanetanc roiesunt:Mercur20,Venus31,Terra47. Asteroizii dintre Marte i Jupiter ar putea fi considerai ca micnduse haotic.OrbitelelorexcentriceinclinatefadeplanulmediualSistemuluiSolar, combinate cu excentricitatea mare a planetei Marte, ngreuneaz observarea unui modeldemicarenzodiaculmarian. PlanetelelenteauodeplasaresimilarcuaceeaobservabildepePmnt. Jupiter are fluctuaii mai mari n perioadele de retrogradare, iar la o scar mai mic,iSaturn.Uranus,NeptuniPlutosuntpreadeprtatepentrucadiferenele dintreefemeridelelormarieneiceleterestresfiesemnificative. Datorit lungimii anului, perioadele de retrogradare ale planetelor superioare ajung la 300 de zile, duble fa de Pmnt. Dac ne gndim c retrogradrile sunt interpretate uneori n horoscoape drept perioade de blocaj al calitilorplaneteirespective,nvedereansuiriiunorleciiexisteniale,neputem gndi ce chin va fi pe bieii coloniti, crora nu le vor ajunge trei viei si ispeascpcatele! Se numete perioad de revoluie sinodic a unei planete intervalul de timpdintredouconfiguraiiconsecutivedeacelaifel(deexemplu:tranzitdirect sauretrograd)aleplanetei. Cuctoplanetsuperioarestemaideprtat,revoluiasasinodictinde s coincid cu anul planetei de pe care se face observaia. Iat, spre comparaie, perioadelederevoluiesinodicpeTerraipeMarte: Terra(zile) Marte(zile) Mercur 115,88 98,19 Venus 583,92 324,97 Terra 759,03 Marte 779,94 Jupiter 398,88 794,54 Saturn 378,09 714,17 Uranus 369,66 683,87 Neptun 367,49 676,28 Pluto 366,74 673,66
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Se poate constata c revoluia sinodic a lui Marte pe Terra este egal cu revoluia sinodic a Terrei pe Marte (779,94 zile = 759,03 zile, conform conveniei fcutelanceput). Anul pe Marte are cam 668,54 zile, adic 686,95 zile terestre. ntro prim aproximaie,calendarulmarianarputeafiosuccesiunedeperioadedecte50de ani,ncare27deaniaravea669dezile,iar23deani668. Desigur c oamenii de tiin vor gsi o soluie mai potrivit. Vor trebui soluionate i probleme precum mprirea anului n luni sau fixarea nceputului anului.Sspermcsevorgsiminimaiinspiratedectcelecareaumpritn modaberantanulterestru,frniciolegturcuevideneleastronomice. Pentru a respecta rigoarea tiinific i pentru a mai complica puin lucrurile,trebuiesspunemc0berbecreprezintpunctuldetrecereaSoareluin declinaieNord(cndzilelencepscreascnemisferanordic).Punctulrespectiv areprobabilopoziiediferitpeMartedectpePmnt.Aadar,zodiilemariene nu coincid n mod obligatoriu cu zodiile terestre. ns, din motive de simplitate, amfcutivomfaceabstraciedeacestlucrupeparcursulacesteiprezentri. Pnacumneamreferitlaelementelecantitativealeastologieimariene celecareindepreciziaastronomic.Acumtrebuieslumndiscuieelementele calitativeinterpretrilepoziiilorplanetare. n lipsa analizelor experimentale, putem doar bnui c planetele SistemuluiSolariarpstrasemnificaiilepecareleaupePmnt. FrndoialcJupitervaaveaoinfluenmaimareasupranativilor,aa c acetia sar putea s fie mai expansivi, mai nelepi, dar n acelai timp mai predispuilaexcese. CumdinhoroscopulmarianlipseteLuna,simbolalnaturiiemoionale,al intimitii i nevoilor de baz, am putea avansa ipoteza c aceste nsuiri vor fi reprezentate chiar de Terra. De multe ori Terra i Soarele vor fi n acelai semn, conformcelordiscutateanterior,decicolonitiivorncercaomaistrnslegtur ntre identitate, autoexprimare i tririle incontiente sau sentimentale, ntre interioriproieciaexterioar. Va lipsi n mod evident Marte, cel care canalizeaz hotrrea, energia i agresivitatea.Voraveamarieniimaimulttoleran,darimaipuinmotivaie iputerededecizie?Sauacestetrsturivorficompensatedealteplanete? Phobos, prin rapiditatea sa, ar putea semnifica att spontaneitatea i uurina comunicrii, cam ca Mercur, ct i superficialitatea i instabilitatea emoional.ChiarDeimosarputeasimbolizaagresivitatea,deipnlaverificarea experimental, toate rmn pure speculaii. n orice caz, elementele orbitale ale celor2sateliivorjucaprobabilunrolimportantdeindicatoarekarmice,prelund fiecareinformaiispecificeNodurilorlunareiLuniinegre.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nprivinaguvernatorilorzodiilorracularputeafiguvernatdePmnt, darcinearguvernaberbecul?Vreunsatelit,asteroid,sausistemulterestruartrebui completmodificat?i,nacestcaz,sarpstranseisemnificaiilezodiilor(iprin analogie,alecaselorcerului)sauiacestdomeniu,fundamental,vatrebuirevizuit? Acesteasunt,cred,problemeleprincipalecucaresarconfruntaastrologiicoloniti. Aspecteledintreplanetenuvddeceiarschimbamoduldeaciune.Mntreb ns dac se va pstra sistemul zodiacal de 360 (cel mai probabil), sau se va experimentaunmodelde720,pentruafimaiaproapedecorespondenagradzia micriisolareaparente. Orice near fi rezervat, de la un destin mre al speciei umane pn la decdereasaudispariiasa,frstimmcardacMarteprezintuninteresreal de colonizare pentru stpnii actuali sau viitori ai Pmntului, sigur este c discursulacesta,unsimpluexerciiudeimaginaie,nuarenicioimportanise adreseaz doar curiozitii celor interesai de acest domeniu al cunoaterii. Cunoscndfolosim.Cunoscndunecretem. Iat cum ar arta horoscopul zilei de 1 ianuarie 2001, naterea mileniului III,sprecomparaie,peTerraipeMarte: Terra Marte Soare 1038capricorn 202berbec Mercur 1416capricorn 1900peti Venus 2658vrstor 1500berbec Terra 456taur Marte 456scorpion Jupiter 211gemeni 2413taur Saturn 2435taur 2111taur Uranus 1839vrstor 2323vrstor Neptun 520vrstor 838vrstor Pluto 1346sgettor 1552sgettor Soarelenegru 1106capricorn 709berbec

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


SeconsidernmodconvenionalcEvulMediufilosoficncepecusecolul alVleaicdureazomiedeani.Dar,caiistoriasociali,nceledinurm,ca reflexalacesteia,istoriafilosoficaEvuluiMediusedeschidemultmaidevremei sencheiemultmaitrziudectneospundateleadmiseprinconvenie. Istoriangeneralnuestecaracterizatprintroevoluieliniar.Astfelnct este greu de admis c Evul Mediu ncepe acolo unde se ncheie antichitatea i c acest fapt se manifest aproape concomitent n toate spaiile de civilizaie. Temporalvorbind,existmaridecalajentreEvulMediueuropeaniceloriental, ca i nuntrulfiecruia:de exempluntre cel bizantin rsritean i cel occidental latin,ntrecelchinez,indianiislamic. Filosofia Evului Mediu de pretutindeni numete o realitate cultural extrem de complex i de contradictorie, care, dei pus n regim de oarecare dependen fa de teologie, nu ia pierdut sensul i nici contiina propriilor valori. Numai printro simplificare total i dintro adversitate dogmatic supranumitonoaptedeomiedeani,EvulMediusedovedeteafinrealitate,i prinfilosofialui,oepocpestecarenusepoatetrece;nudoarpentrucaexistat,ci pentrucaexistatvaloric. ncepnd propriuzis, n spaiul european, cu secolul al Vlea, filosofia medieval a fost pregtit de dou mari momente care nu aparin doar istoriei teologiei.Estevorbadeapologeticidepatristic. Filosofia antichitii europene i n primul rnd filosofia greac a avut la baz un demers autonom, o cercetare liber a gndirii raionale, avnd ca scop cunoaterea din ce n ce mai aprofundat a omului i a universului, a lumii materiale i a celei spirituale. Odat cu rspndirea cretinismului i cu transformarea sa n religie dominant, demersul filosofic i schimb caracterul. Cercetareafilosoficnuimaiafljustificareaneansi,cinafaraei,ncorpul doctrinaralreligieicretine,nacceptareanecondiionatarevelaieidivinecarese afl la baza acesteia. Pentru filosofie nu mai putea fi vorba de gsirea unor noi adevruri,cideaprofundarea,denelegereactmaiadecvat,deexplicitareact maiclaraunuiadevr,acelaalrevelaiei,pentrucaoameniisilpoatapropia ctmaiintim.Religiacretiniconstituieastfelofilosofieproprie,cufuncien primulrndteologic,carevadominagndireatimpdemulteveacuri. Elaborareadoctrinalacretinismului,odataezatpeterenulfilosofiei,a fost sarcina pe care iau asumato Prinii Bisericii, adic scriitorii cretini ale croropereaufostasimilatedebisericicarencercau,pelngpunereabazelor dogmaticiiicultuluicretin,sasigureioanumitcontinuitatentrefilosofiei cretinism, prezentnd cretinismul drept cea mai desvrit manifestare a
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


filosofiei,pecareosubordonauastfelteologiei,deschizndnacestmodcaleaspre scolasticamedieval. Perioada patristic se divide din punct de vedere istoric n trei perioade. Prima perioad, de la nceputuri pn n jurul anului 200, este perioada aprrii doctrinei cretine contra atacurilor pgnismului i a interpretrilor gnostice. A douaperioad,delaaproximativ200pnlaaproximativ450,estepreocupatde formularea doctrinal a credinei cretine. n a treia perioad, cuprins ntre aproximativ 450 i sfritul patristicii (odat cu moartea lui Ioan Damaschin, cc. 754, pentru ramura oriental i a lui Beda cel Venerabil, 735, pentru ramura occidental), eforturile scriitorilor cretini erau ndreptate mai ales spre reelaborareaisistematizareadoctrinelorformulatencnprimeledouperioade. Patristica ncepe si piard puterile speculative ncepnd de la mijlocul secoluluialVlea.norienteasepierdedincencemaimultndisputelipsitede valoarefilosofic,nlegturcuproblemelegatedepoliticabisericeasc,ntimpce noccidentrevrsareapopoarelormigratoaredistrugecivilizaiaroman,amnnd pentru mult vreme reconstituirea unei noi civilizaii n aceast parte a continentului. ntre timp, nu mai rmne aici dect o activitate erudit, concretizatmaialesncompilridetexteicomentarii. Cel cruia i se datoreaz n primul rnd supravieuirea unei pri nsemnate a filosofiei greceti n Evul Mediu este Boethius. Dac temporal acesta este nc foarte departe de scolastic, n perspectiva filosofic el este aproape de porileei.Dealtfel,uneoriultimulfilosofromanmaiestenumitiprimulscolastic. Cuvntul scolastic denumete nvmntul i filosofia predate n cursul Evului Mediu n occidentul latin, aflat sub stpnirea catolicismului, iniial n colile oficiale, adic n colile patronate de marile catedrale i mnstiri, iar ulterior i n universiti, unde sa format cu precdere gndirea filosofic medieval. Originea,structuraidezvoltareafilosofieiscolasticereflectndeaproape alctuirea social i politic a lumii medievale europene, constituit dup principiile unei ierarhii riguroase, concentrate ntro for conductoare unic. Imperiul, biserica feudalismul, ca instituii fundamentale ale Evului Mediu, sunt coloanele pe care se sprijin ierarhia medieval stpnitoare a ntregii viei materialeispiritualeaaceluitimp. Este o prere destul de rspndit c Evul Mediu nu a avut acces la realitateanaturiiiavieiisufletetiaomului,deficienesenialcareainfluenat extrem de negativ concepia medieval despre lume. Se poate observa totui ca EvulMediuareuit,cuajutorulcunotinelorimijloacelortehnicealevremii,s construiascmarilecatedralecudurabilitateamaterialiperfeciunealorartistic i era tot att de capabil s mediteze cu succes asupra unor probleme logice i metafizice,psihologiceietice.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nflorirea pe care filosofia scolastic a cunoscuto n cursul secolului al XIIIleasadatoratnceamaimaremsurncrederiicrescndepecarefilosofiii savanii acelui secol au acordato raiunii i posibilitii de a soluiona pe ci raionale un cerc de probleme din ce n ce mai cuprinztor. Aceast ncredere n puterileraiuniisentemeia,dinpunctdevederefilosofic,pegndireaaristotelic, readuslacunotinaoccidentuluiprinarabi.Dezvoltareagndiriifilosoficeafost promovat i prin nfiinarea universitilor, mai ales a celei din Paris. Trebuie amintitfaptulctermenulUniversitate(Universitas)nudesemnanEvulMediuo totalitatedefaculti,ciunnumrdepersoaneprofesoriistudenireuniintro activitatedenvmntntroanumitlocalitate. Revenind la fazele rspndirii aristotelismului n occident, reamintim c pn spre mijlocul secolului al XIIlea scolastica nu cunotea dect tradiia boethian a aristotelismului. Abia ncepnd cu mijlocul acestui secol opera filosofului a ajuns s fie mai bine cunoscut, prin intermediul unor traduceri n limbalatin,fcutenpartedingreac,npartedinarab. Cel care a dat drept de cetenie aristotelismului n scolastica latin a fost teologul, filosoful i naturalistul german Albert cel Mare (Albertus Magnus), care nu l considera o filosofie printre altele, ci filosofia nsi, treapta ultim i operaperfectaraiunii. nconcepiasa,filosofiasedividentreipri:filosofiaraionalsaulogica; filosofiareal,caresepreocupdeceeacenuesteoperaomuluiifilosofiamoral, care are ca obiect aciunile umane. Pentru prima dat n scolastica latin, Albert difereniaz net filosofia de teologie. El afirm c metoda filosofiei este demonstraia riguroas pe baz de argumente raionale i silogisme, n vreme ce teologia se fundamenteaz pe credin, care, n domeniul religios, implic adeziuneiconsimmntiestecaleaceducelacunoatereaadevrurilordivine. Totui, Albert nu opune cunoaterea natural, adic cea filosofic, cunoaterii teologice, ci ncearc s le armonizeze. Pentru el, exist n univers o singurordine,careleagtotceeacefiineazntrounitatedeierarhieformatdin naturisupranatur,unitatecarecuprindeipeomcugndireaivoinasa.n ceea ce privete existena divinitii, dup prerea sa aceast existen poate fi demonstrat,darplecnddelaexperien,maidegrabdectfolosindargumente apriori. Meritul principal al lui Albert rmne cel de a fi ncercat s pun la dispoziia occidentului, odat cu filosofia aristotelic, toat fizica, metafizica, matematica, practic toat tiina acumulat pn atunci de ctre greci, arabi i evrei. Un alt moment important, legat de ptrunderea aristotelismului n scolastic,lconstituietulburrileizbucnitelaUniversitateadinParisnanul1299, care au dus la nchiderea universitii i la dispersarea maetrilor ei n afara Parisului. Papa Grigorie al IXlea a reconstituit universitatea, dar a interzis
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


folosireacrilordefizicaleluiAristotel(carefuseserinterzisencdin1210de unconciliuprovincial)pncndnuvorficuratedeoriceeroare,dinpunctde vederebisericesc. Opera lui Albert cel Mare a fost continuat la o valoare i mai nalt de ctre elevul i colaboratorul su cel mai nsemnat, Toma din Aquino (Thomas Aquinas), considerat al doilea Augustin al catolicismului, personalitate nzestrat cu un talent speculativ deosebit i cu o pronunat nclinaie pentru metafizic.noperaluiprevaleaz,cutoateelementeledemisticismcaracteristice unui teolog, o atmosfer de raionalitate, care se impune mai ales prin marea claritateaideiloriconceptelorutilizate,princonstruciaarhitectonicascrierilor sale, caliti evidente mai ales n lucrarea sa capital Summa Theologi (Sinteza teologiei),careafostcomparatcuarhitecturacatedralelorgotice,maialesdatorit expunerii sistematice, structurate n pri, capitole, ntrebri i nlnuiri de argumente,contraargumente,obieciiiconcluzii. Frndoial,TomaestecunosctorulcelmaiprofundalluiAristotelicel careiexpliccelmaibinedoctrina,dinntregulEvMediu.PentruToma,originea filosofiei se afl, ca i pentru Aristotel, ntro necesitate interioar a omului de a cunoateprimelecauzealelumiimaterialeispirituale.Scopulfilosofieiestedeci sesizareanntregimeaordiniiuniversuluiiacauzelorsale.Totui,elconsidera c filosofia trebuie s se orienteze spre teologie n domeniile pe care le are n comuncuaceasta.Astfel,Tomaesteceldintidintrescolasticicareleagteologia de filosofie printro metod comun, dar n timp ce teologia sa este cea a unui filosof,filosofiasarmneceaaunuiteolog.Tomaafostcanonizatn1323depapa IoanalXXIIlea.n1879,prinenciclicaternisPatris,papaLeonalXIIIleadeclar tomismuldreptfilosofieoficialabisericiicatolice. UnadversaraltomismuluiafostRogerBacon,savantulminunat(doctor mirabilis), cum i spuneau contemporanii, preuindui erudiia i originalitatea ideilor,acruiopersecaracterizeazprintromarelibertatespiritual,npofida faptuluic,neputnddepilimiteleperioadeisaleistorice,admiteacfilosofianu trebuiescontrazicdogmelereligiei.Pentruel,filosofianuestedectoexplicarea nelepciuniidivineprindoctriniconduitmoral. El a introdus pentru prima dat n istoria culturii noiunea de tiin experimental. Pentru Bacon, nu sunt valabile dect dou moduri de cunoatere: raionamentul i experiena. Dar raionamentul nu nltur dubiul i nu d certitudinea,pncndintelectulnuajungelaintuiiaadevruluiprinexperien. Deaceea,spuneel,raionamentulnuesuficient,darexperienaeste. Bacon a conceput planul unei enciclopedii a tuturor tiinelor, ale cror principiiurmausfienmnunchiatenmetafizic,unproiectpecarenuaizbutit sl duc la bun sfrit. Numai el a avut n secolul al XIIIlea, i poate pn la AugusteComte,ideeauneisintezeacunotineloraflatenposesiaomenirii.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Totui, n epoc, influenele gndirii sale, n care se altur sensuri progresisteicriticendrzneeiconcepiindatorateunuitradiionalismrigid,au fost extrem de reduse sau chiar au lipsit cu totul, cel puin n msura n care au pututfiidentificatepnacum. SpresfritulsecoluluialXIIIlea,sciziuneadintreteologie,pedeoparte, ispeculaiafilosofic,pedealta,acontinuatsseadnceascissereferelanoi subiecte de controvers, ca urmare a activitii unor gnditori care, considerai individual,nuauavutoimportanpreamare,darcare,mpreun,audeterminat oatmosferdominantatimpului,ncareopoziiadintreexplicaiiledogmaticei afirmarealibertiicercetriifilosoficeaparedincencemaipregnant. nafaralibertiiilipseideprejudeciadiscuiilorndomeniulteologic i filosofic, caracteristic pentru prima jumtate a secolului al XIVlea este i libertatea discuiilor juridice i politice. Problematica acestora din urm cuprinde dou teme: teoria dreptului natural i problematica raportului dintre puterea ecleziasticiputereacivil. n anul 1302, Jean Quidort contest puterea deplin a papei,revendicnd dreptul de proprietate pentru individ i atribuind papei numai funcia de administratoralbunurilorecleziastice.Civaanimaitrziu,Dante,nDeMonarhia (Despre monarhie), va susine independena puterii imperiale fa de puterea papal, ncercnd s pun de acord dou universalisme: cel ce reprezenta un univers temporal, condus de un mprat unic, i cel ce reprezenta un univers spiritual,condusdeunpapunic,aflateamndousuboblduireadivinitii. EvulMediupregtetetrecereaspreRenatereidecispreepocamodern, carenuarputeafinelese,nicicagenez,nicicasistem,frcunoatereagndirii filosofice,aspiritualitiiiavalorilormedievale.
Bibliografie:ntreAntichitateiRenatereGndireaEvuluiMediu,traduceredeOctavianNistor,vol.III, Ed.Minerva,Bucureti,1984

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


SenHutton,traducere Abian1964,BreandnDoibhlin,romanciericritic,puteascrie: [Nmr]donscrbhneoirGaeilge[]stldochruthdfinfoirm, choincrideachfocaldobhualadharasmaoineamh,foirm[]atina toradhar nacadta bliaind chultr Eorpachagusa bhdealbadh fi i rith na trimhse a raibh an Ghaeilge gan saothr. N mr don Ghaeilge aistear chig chad bliain do dhanamh agus adil gach trimhsedobhailichuiciinaimsirghearr. Scriitorulnlimbairlandez[]trebuiesicreezeunstilpropriu, trebuie s impun gndurilor sale o form concret a cuvintelor, o form [] care e rezultatul a sute de ani de dezvoltare cultural europeanicareafostmodelatchiarinperioadacndirlandeza nu era limb literar. Irlandeza trebuie s cltoreasc dea lungul celor cinci sute de ani i s adune bogiile fiecrei perioade ntrun timpfoartescurt. LimbairlandezasupravieuitcalimbpopulardinsecolulXVIIpnla sfritul secolului XIX, aria geografic de folosire predominant fiind redus progresiv,ntruntimpcndenglezadevenealimbaoficialarii,precumilimba asociat puterii i reuitei materiale. Exista ns o bogat tradiie oral i poetic, careafostreprezentatdincencemaimultnamhrinnandaoine(cntecele poporului).Puinecriaufostpublicatenirlandez,iartexteleclasiceimoderne timpuriiausupravieuitnminilecolecionarilorifamiliilor(adeseaaparinnd claseimicilorfermieri)cutradiiecultural.Totui,lasfritulsecoluluiXIX,cnd afostpublicatprimulexempluderomannlimbairlandez,unscriitordeficiune nu se putea ndrepta spre o tradiie epic galic notabil. Acest exemplu a fost Sadna,deantAthair(Printele)PeadarLaoire,publicatnfoiletonn1894in volum n 1904. Era un roman popular despre un cizmar cumsecade care este nelatsfacunpactcudiavolul(osituaiediferitimaiacceptabildectceaa ConteseiCathleenaluiYeats,carencunotiindecauzivindesufletulpentrua salva oamenii). Unul din scopurile publicrii era [s dea] celor ce studiaz o ocazieiunmijlocdeaseobinuicu[]sintaxairlandez. Legtura dintre creaia literar i micarea pentru renvierea limbii irlandeze(iniiatdefundaiaLigiiGalicen1893)urmasfieunaproblematic.A alegesscriinirlandez,olimbntruniminentpericoldedispariie,eransine un act de angajament. Muli erau pregtii si priveasc scrisul ca o parte a
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


efortului lor ar son na cise (pentru Cauz). Nevoia disperat de lectur n aspectul contemporan al primilor ani ai acestui secol, a nsemnat c aceia care aveau fluen n irlandez, indiferent de talentul creator, puteau foarte uor si stabileascoreputaieliterarmodestisctigerespectulcedecurgeadeaici, iarastaastabilitunmodelpentruviitor.Maiapoi,faptulcpiaaexistentcaresa extinssubStatulLiberIrlandezdedup1922puneaaccentpecopiiidecoalipe adulii care nvau, a fcut, de exemplu, ca un important scriitor de limb irlandez,PdraigConaire,ssimtnanii20ceradistrasdelaprincipalalui sarcinspreproduciadebanaliti,nncercareadeactigaopine.Altscriitor important,SeosamhMacGrianna,ancercatonstrinareasemntoarenanii30. Puini au putut suporta contradiciile la fel de bine ca Mirtn Cadhain, un scriitordeficiunecuosuperbimaginaie,profesordecoaliapoiuniversitar, criticacerbuneoriilupttorbtiosnnumelelimbiiirlandeze.Dareracontient deacelecontradiciiideefectullor: Trudnosmeasanantuireasaaitheantaissambaileagusigcin ag goilliint ar an scrbhneoir. Is deacair do dhuine a dhcheall a dhanamh i dteanga arb a coslacht go mbeidh s bsaithe roimhe fin.[]Fonntrodagofochmhararasonaghineasantadchassin ann.Ngomaithdhmarscrbhneoiratantadchasntroid.An rudismarfafaointroidseoguragcaidreamhleluchtnacise,an dreamisbeagmhaitheasainirinnaguscuidacuisclaoinefreisin,a thairraingeosse. Este ceva alarmant pentru scriitor, mai ru dect lipsa de recunoatere acas i n strintate. E dificil pentru un om s se produc ct poate de bine ntro limb care va muri, foarte probabil, naintealui.[]Dorinadealuptacuputerennumeleeiestereacia provocat de disperare. Disperarea i lupta nu sunt bune pentru scriitor.icelmaigroazniclucrudespreaceastluptesteclpune n contact cu susintorii Cauzei, cei mai nefolositori oameni din Irlandai,uniidinei,ceimainecinstii. Odatcurenatereaprozeideficiunenirlandez,lanceputulsecolului nostru, dezbaterea sa concentrat asupra ntrebrii dac aceasta ar trebui s fie credincioas tradiiei populare irlandeze sau dac ar trebui s aib o perspectiv mai larg. P. H. Pearse, scriitor, educator i separatist irlandez, care era un exponentimportantalceluidealdoileapunctdevedere,argumentac: Trebuieslumcontact[]cucontemporaniinotriinFrana,n Rusia, n Norvegia[] pe scurt, oriunde se produce literatur vital
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


pe faa globului [] literatura irlandez, dac e s triasc i s se dezvolte, trebuie s intre n legtur pe de o parte cu propriul su trecutipedealtacugndireaEuropeicontemporane. Pedealtparte,prolificulscriitordepovestiriscurteiromancierMire (SamusGriannapopularctpoatefiunscriitornirlandezicelmaiprolific romanciernirlandezlaoraactual)afostunuldinaceiacareausimitcuputere faptulcexistaocalespecificirlandez: Bh art daobhtha fin ag seanchuidhthibh Gaedhilge. Bh digh nisintaacaleisansgalainnse.Dfhsantartsinamachassaoghal agusascreideamhnandaoine.Nhionannrsaoghalfinagusceann na Sasana n na Fraince. [] Ba cheart cruth an tseansgil a choinneilbeoagusartGaedhlachashnomhamachas.Deirtearlinn go gcoinneochadh seo ar gcl litridheacht na Gaedhilge. [] Ach shlfinngobhfuilscontabhairteachacurarchosaibhanirdeagusan codladhinasilibh.Bfhidirgursosismaireathuitfeadhsleisan deifre. Povestitoriiirlandeziaveauoartproprie.Aveauunmodnaional de a spune o povestire. Acea art sa dezvoltat din viaa i credina poporului.ViaanoastrnueviaaAnglieisauFranei.[]Trebuies pstrm vie forma vechii povestiri i s dezvoltm din ea o art irlandez. Ni se spune c aceasta va ntrzia literatura n irlandez. []Dareucredcestegreitscomparmngrab,cusomnulnc pe pleoape. Exist pericolul de a fi nghiii, din repezeal, de o mlatin. Terence Brown, n capitolele 1 i 2 ale Irlandei: o istorie social i cultural 192279, furnizeaz o succint relatare asupra contextului n care sau realizat produciile literare n irlandez i englez n Statul Liber Irlandez de dup 1922. Componenaalianeicareaconfirmatireprodusvalorilestatuluiirlandezpnn anii60estedescrisprecumurmeaz: Foracombinata[]fermierilorioamenilordeafaceri[]aavut oinfluenenormnmodelareatiparelorpolitice,socialeiculturale alestatuluiindependent.Prudenaloreconomic,concepiilesexuale nmodnecesarpurtitaneirepresiveiconservatorismulnaionalist, ncurajatedeunclerioierarhieieitennumrconsiderabildintreei, a determinat n mare msur tipul de ar care a aprut n primele decadealeindependenei.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Aceast alian care deja colonizase instituiile statului britanic din Irlanda n regiunile naionaliste din perioada dinaintea independenei a reprezentat instrumentul prin care ideologiile naionalismului secular i cultural, sugeratdefigurinaionale(precumParnell,Redmond,MacNeill,HydeiPearse), afostfiltratiasimilatmodelelordegndiremaitradiionale. n An Litrocht Riginach (Literatura regional), Mirn Nic Eoin examina influenele ideologice asupra scrierilor moderne n irlandez n prima jumtate a secolului nostru. Ea acorda pe drept cuvnt o mare importan ideologiei Ligii Galice,caresebazapeoimagineidealizataoamenilordinGaeltacht,capstrtori ailimbiiirlandezeiaitradiieiorale.Aceastideologieaajunssdominelimbai micrileliteraregaliceiafostintegratideologieidominanteastatuluiirlandez. Istoria poporului avea o puternic rezonan n cadrul ideologiei populist naionaliste, i creterea importanei autobiografiei rneti plus succesul unui numrdeexemplealemodeluluinIrlandainafarancurajatcompetiiaia influenatdezvoltareaprozeinirlandez.Dinceleoptoperenprozdinsecolul XX alese de John Jordan pentru serialele lui radiofonice, Plcerile literaturii galice, difuzate de Radio ireann n anii 70, trei erau autobiografii de la cap la coad,unaeraoautobiografieficionalizat,unaeraosatiragenuluiidoardou erau romane. Importana acordat rnimii a influenat ntreaga chestiune a limbii,precumiaformei: Ba ar an gcaint sna saothair liteartha is m a bh aird na lirmheastirdritheMoladhleabhairarsonnadeaGhaeilgeabh le fil iontu n ar son an liri frinneach a bh le feicail iontu ar aignenanGael. Recenziile iau ndreptat atenia n primul rnd asupra limbii lucrriiCrileaufostludatepentrucalitateabunairlandezeidin elesaupebazaacurateeireprezentriigndiriiirlandeze. Unexempluinteresantrecentsegsetenrepublicareadin1983aoperei lui Mire, Tairngreacht Mhiseoige (Profeia lui Miseog 1958). ntro not de pe copert,serecunoatecstilulromanticalcriiestedemodatnprezent,darcse crede c cititorii nc vor aprecia an stl asca agus an teanga shaibhir (stilul fluent i limba bogat) al crii. (Desigur c versiunea acceptabil a rnimii irlandeze a fost o versiune curat, dup cum ilustreaz evenimente diverse precummanifestaiilePlayboydelaTeatrulAbbeydin1907ievenimentelece auurmatpublicriin1942acriiluiEricCross,TheTailorandAnstyCroitoruli Ansty).nmultecazuri,efortulliterarafostperceputdinperspectivaroluluisun consolidarea limbii i a acelei entiti problematice, naiunea. Aceasta, totui, nu trebuiesnesurprinddacnegndimlaimensulefortalmobilizriicarefusese
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


depus n jurul problemei politicii interne i independenei naionale la sfritul secoluluiXIXinceputulsecoluluiXX. Largagamdeautoriaicurentuluiprincipaltraduinirlandezconform schemei iniiate de An Gm (Planul) dup 1926 (incluznd pe Wells, Scott, Dickens, Conan Doyle, Chesterton, Stevenson, Conrad, Turgheniev, Ibsen, Jules Verne, Dumas, Jerome K. Jerome, William Carleton, Charles Kickham, George BirminghamiShanBullock)sugereazcdacscriitoriinirlandeznuciteaucu ndrzneal, ei erau cel puin ntro oarecare form de comunicare cu o lume literar mai larg, mcar pentru a ctiga onorariul pe mia de cuvinte pentru traduceri. Ct timp ei absorbeau, mai mult sau mai puin contieni, diferite idei dominantedespreproducialiterar,majoritateascriitorilordeprozgalicnuse gndeaupreamultlateorialiteraraesteticii.Modelulcareinfluenascriitorulde mijloceranuvelaromanticsaupovestireadeaventuri.SenTuamadexemple de subiecte n dou romane tipice: Ceol na nGioleach de Pdraig g Conaire i CaislnirdeMire: []insgachceanndendleabhartlaochagusbanlaochatchomh glan geanmna leis an sneachta site agus a bhfuil gr buan maoithneach acu d chile; is beirt iadnach eol dibh aon agir, c gondantaragirorthubeirtnachbhfuilamacasamhailardhroim andomhain! []nfiecaredinceledoucriexistunerouioeroin,caresunt puricazpadaicareseiubesccuodragostetrainicisentimental; suntoperechecenucunoateruldeisuntvictimeleruluisunto perechecarenuareasemnarepefaapmntului! Romanul n irlandez, pn n anii 60, a fost pe locul doi n ceea ce privete frecvena produciei, n comparaie cu alte forme literare. Aceasta sa datoratcusiguranfaptuluicperiodicelereprezentaucelemaiprobabilecide publicare; i aici poezia, povestirea i eseul erau cele mai apte de publicare. Aproape fr excepie, scriitorii n irlandez erau scriitori cu jumtate de norm, mulifiindprofesorisaufuncionaripublici,iacestlucruainfluenatdeasemenea forma literar, militnd mpotriva romanului. Cu siguran una din cele mai remarcabile mpliniri ale acestei renateri literare a fost dezvoltarea poeziei n irlandez,decndDireiniRordinaudeschisdrumurilenanii40i50. AicidinnoumplinireaafostndomeniulminiaturiiceeaceMirtnCadhain descria dezarmant drept [an] liric dheas neamhurchideach (lirica plcut i nevinovat).Attscriitorulderomancticeldepovestirenirlandez,lucrndn cadrul canoanelor realismului social, pe care Mirin Nic Eoin l identific drept forma dominant din scrierea de ficiune n irlandez, se confrunt cu problema
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


creriiimaginiiuneilumicredibileprinintermediuluneilimbicareesteunmijloc decomunicaresocial(nsensullarg)doarnruralulGaeltachta.Acumcivaani, Mirtn Direin, un poet i eseist care a meditat profund la chestiunea formei literare,miapusnvederecutriecacestdinurmlucruprivindlimbairlandez ia fcut imposibil folosirea n tratarea cu succes a experienei urbane/rurale n prozadeficiune,nspecialnformaromanului.Elaadmistotui,subpresiune,c au existat strategii stilistice monologul interior, de exemplu prin care aceast dificultateperceputputeafidepit.MirtnCadhain,defapt,mergeaninima problemeicndscria: []nhfrinnenacumadireacht,nahealane,frinneantsaoil.[] Nciriarraarrscalarbithabheithinchreidtheachderirachuid tarmatagartha.[]Iscalirid[]chuirmiseigcsgurthosaigh titheimbailemriridagbualafaoinachile.Dfhachmlechuile shrteileadhanamhinchreidthetaobhistighdenfhrmasin. []adevrulliteraturiicreative,alartei,nuesteadevrulvieii.[] Nu se poate cere ca orice roman s fie credibil exceptnd proprii si termenidereferin.[]ntrooarecarepovestire[]amplecatdela supoziia c, ntrun anume ora, casele au nceput s se ciocneasc ntreele.Amcutatsfactotrestulcredibilnacelcontext. Este, totui, adevrat c istoria specific a limbii irlandeze a dat o importanunicproblemeilimbiiiformei.Problemelentlnitenacestedomenii suntdiferitedecelecucareseconfruntascriitoruldelimbenglezdinIrlanda,i ncepnddinanii60,scriitoriideproznirlandezaunceputsinseamade ele. n 1926 a fost nfiinat An Gm, sub controlul semnificativ al Departamentului Educaiei, pentru a superviza publicarea crilor n irlandez. Pn la nfiinarea An Gm, publicarea textelor irlandeze era ndeplinit de Liga Galicideunmicnumrdeeditoriparticulari.Mire,nautobiografialuiSaol Corrach(Timpuritulburi),iamanifestatdispreulfadeoperaiuneaAnGm,n special fa de politica sa de a plti traduceri din alte limbi n irlandez cu o lir suta de cuvinte. Desconsideraia pentru An Gm a unor scriitori de asemenea calibruafixatoanumitimaginenminilepubliculuivorbitordeirlandez,care ncpersist.Nueniciundubiucobiectivulsudeapublicaoperepentrucolari ipentruceicenvauirlandeza,combinatcuatitudineabirocraticipuritana funcionarilor publici care o controlau, a nsemnat c multe scrieri fr valoare literaraufostpublicate,iaroperedevaloareaurmasnepublicatesaublocateani dezile.Totui,estenecesarunstudiudetaliatdespreAnGmncontextulmailarg
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


alncercrilorunuistatnformaredeaicreaoidentitatenaionalspecific,iar aiciapututfifcutointeresantanalizcomparativ. MirnNic Eoin, cumammenionat deja,a indicat realismul social drept formdominant.Eaexplic: Baineann s seo leis an gcaoi a nsideann scribneoir irithe Gaeilge an trscal mar iomprir teachtaireachta sisialta nuair ba chu agus nuair ab fheilina an tbhar at faoi chaibidil a phl ar bhealach eile ar fad i dtrchtas in alt no i leabhar taighde, mar shampla. Aceasta e legat de felul cum folosesc romanul unii scriitori n irlandezpentruacomunicaunmesajsocial,cndarfimaipotrivits prezinte subiectul n chestiune ntro cu totul alt manier ca tez saucaarticolsaucaoperdereferin,deexemplu. Aceast tendin didacticafost una persistent,iBreandn Doibhlin, uncampionaluneiformeirlandezedemodernism,scrianprefaaromanuluisu, NalMaidineagusTineOche(ocartedesprecaresespunentronotdepecopert: Fachann an leabhar le roinnt dr gcuid fadhbanna cultrtha a scagadh tr mhachnamh i modh siombalach a dhanamh orthu Cartea caut s cerceteze cteva dintre problemele noastre culturale, reflectndule ntro limbaj de simboluri): Dscrobhfainnseleabharfealsnachta,lndechruthnaisagusde chonclid agus de dheitnid, ntor thgtha ort d mbhearr leat gan tabhairtfaoinalamh. Dacartrebuisscriuuntratatfilosofic,plindedoveziiconcluzii idefiniii,numaiputeanvinuicnavreaslcitesc. ncepndcuanii1890aufostscrisemultedinopereledebazcareaucreat condiiilerenateriiliteraturiinirlandez.Aufostpublicatematerialedidacticede baz, literatura anterioar i folclorul au fost fcute accesibile cititorului modern, neacademic,iarpredareanlimbairlandezafostinclusnsistemuldeeducaie. Crearea Statului Liber Irlandez n 1922 a favorizat acest proces. ncercarea de a termina mult prea repede, i la o scar mult prea ngust punnd accent pe renaterea colilor primare a nsemnat crearea de probleme pentru viitor. ntre timp, pe msur ce numrul vorbitorilor nativi de irlandez (aceia care vorbeau irlandezacaprimlimb)continuasscad,nafaraGaeltachtuluinumrulcelor careseconsideraucompetenindomeniullimbiiirlandezecretea.Pelamijlocul
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


secolului,numruldeproblemeidentificatedeCalahancaprivinduipescriitorii irlandezi fuseser nlturate sau substanial micorate: lipsa unei limbi clar normatencaressescrie,absenauneitradiiisauauneicomunitidescriitorii faptul c chiar dac scriitorul reuete s scrie, nu ar exista editori pentru a rspndiscriereainicipubliccititorsociteasc.AnClubLeabhar(dup1948) putea asigura o lectur de pn la 3000 de persoane pentru o carte n irlandez. Acestaeraunnumrfoarterestrns,nsexistaucompensaiipentruscriitorntro societatemicifamilialcaaceeaaIrlandei,dupcumreieseclardinurmtorul pasajscrisdeMirtnCadhain: Tfhiosagamgurthugangnthphobal,thiararaonns,agusseo iad mo mhuintir fin, antaithneamh do Cr na Cille. Cheannaigh daoinesanitsinnrcheannaighdeleabharariamhachOldMoores Almanac,nanImeldistnamnrialtanuairnachraibhaondulas acubhodhsdhlamhsnatithecuartagusaranbportachAgus bh pobal eil ann. Is mr an rud ag scrbhneoir aitheantas. seo a chloisteil ag dul thart dhom i bPirc an Chrcaigh l mrchluiche: theregoesCrnaCille. tiucoamenilorsimpli,nvestmaiales,iaceiasuntneamulmeu, lea plcut mult Cr na Cille. Oamenii au cumprato n locuri unde singura carte cumprat nainte era Old Moores Almanac sau Imeldistul de la clugrie dac nu era nici o cale de a evita cumprareasacititncaseundesestrngeauoameniinoapteasau afarpebrazdeledelngmlatiniiamaiexistatiunaltpublic. Recunoaterea e un lucru important pentru scriitor. S surprind aceasta,ntrozicnderamlaunmaremecinCrokePark:uiteLutul mormntului. mbuntirea situaiei scriitorului n irlandez n perioada din timpul i dedupceldealdoilearzboimondialpoatefiindicatdeurmtoareacronologie: 1939 FundaiaCumannnaScrbhneoir(AsociaiaScriitorilor) 1939 RenviereacompetiiilorliterareOireachtas 1942 FundaiarevisteiComhar 1943 FundaiaziaruluiInniu 1945 FundaiaedituriiSaitsealagusDll 1948 FundaiarevisteiFeasta 1952 Schema guvernamental de acordare a asistenei financiare pentru publicareacrilornirlandezdectreeditoriiparticulari
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Aceast perioad, ncepnd cu anii 30, a fost de asemenea martora publicriiunuinumrdepietredetemeliennualitrocht(literaturamodern): primele patru volume de poezie ale lui Mirtn Direin ntre 194247, colecia Eireaball Spideoige (Coada prihorului 1952) a lui Sen Rordin, Seosamh Mac GriannacuMoBhealachFin(Propriulmeudrum1940),MylesnagCopaleencuAn Bal Bocht (Sraca gur 1941) i Mirtn Cadhain cu Cr na Cille (Lutul mormntului1949).Acestetreioperenproz,mpreuncuromanulexpresionist Deoraocht(Exilul1910)alluiPdraigConaire,suntprintrepuineleoperevizibil moderneprodusenprimajumtatedesecolarenateriiliteraregalice.JamesM. CalahandescrieExilul(ooperpecareAntAthairPeadarLaoireancercatso scoatdinproceduradenregistrarelaUniversitateaNaionaln1917pemotivde imoralitate)dreptcelmaiinovatoriprogresistromanirlandeznlimbileenglez sauirlandeznaceastperioad,naintedeapariialuiJoycecaromancier.Toi mergmpotrivanefiresculuiideologieidominantearenvieriiimicrilorliterare. Povestitorul Propriului meu drum este un marginalizat profund nstrinat. Sraca gur este o satir la adresa romantizrii ranului vorbitor de irlandez de ctre revivalitiiaconveniilorliterareinunumaicareauurmatdeaici.Geloziilei dumniileslbaticealemorilorncimitiruldinLutulmormntuluiunromancare ealctuitaproapeexclusivdindialoguriiaratpeprotagonitilamaredistan de eroii i eroinele de bumbac ale ficiunii revivaliste din momentul n care CaitronaPhidnrostetefaimoaselecuvintedenceputalecrii:Nmanarit an Phuint n na Cig Dag at m curtha? (M ntreb dac sunt ngropat n parceladeolirsaunceadecincisprezeceilingi?). Anii 60 au fost o perioad cnd au nceput s se sfrme consensul i conservatorismulpretenioscareaprusenIrlandaprinanii20.Existaomaimare disponibilitate, pe o scar mai larg, de a lua n consideraie noi posibiliti. omajul i emigraia masiv din anii 50 au demonstrat c ideologia care caracterizase micarea de independen avea miezul putred. n acelai timp, exteriorulncepeasaiboinfluendincencemaimareasupraIrlandei,proces susinut considerabil de apariia televiziunii. Mirn Nic Eoin surprinde o schimbarencepndcuanii60nprivinascrisuluinirlandez: ...n hamhin go bhfuil mad substaintiil tagtha ar lon na n rscalta ach tosaodh freisin ar bheala nua a thriail, bhair agus timpeallachta nua a liri agus a phl, foirmeacha turgnamhacha a thstil agus fealsnachta liteartha agsla a fhorbairt agus a chiaoladhtrmhennahrscalaochtaGaeilge. Nu numai c a crescut substanial numrul de romane, dar sa nceputdeasemeneassencercenoistiluri,sautratatnoisubiectei medii,sauncercatformeexperimentaleidiversefilosofiiliterares
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


au dezvoltat i au devenit familiare prin intermediul romanului n irlandez. Aceast deschidere a orizonturilor literare a fost n mod cert ajutat de evoluia treptat a standardelor criticii n irlandez. Aici, printre pionieri, a fost autorulEoghanTuairiscigrupuldinjurulIrisleabharMhNuad,careincludea,i include, pe an tAthair Breandn Doibhlin. Dezvoltarea ficiunii n general sa datoritibunvoineieditorilorntreprinztoricareaupreluatipublicatlucrrile. AnDrumaMr,aluiSeosamhMacGrianna,careafostscrisn192930,nuafost publicatdeAnGmpnn1969intotacesttimpautorulancetatsmaiscrie, a suferit o cdere nervoas complet i a fost internat ntrun azil. Lui Mirtn Cadhain i sa spus c An Gm nui va publica girsilacht (murdria), cnd Sirsel agus Dill a ncercat si publice capodopera Cr na Cille. Standardele literareridicatealeComhariFeasta,expunereactreliteraturaeuropeanmodern prinacesteperiodiceialtele,precumiprintraducereapespatenenglez,plus posibilitateapremiilor Oireachtas i accesul la un public relativ numeros prinAn ClubLeabhar,trebuiecauajutatdeasemenea. Romane ca Nal Maidine agus Tine Oche (Norul dimineii i focul nopii 1964)aluiantAthairBreandnDoibhlin,DLuain(Luni1966)aluiEoghan TuairisciCaoinTFin(Plngeisoarta1967)suntexemplealeacesteidezvoltri datorate unor scriitori care, foarte important, au venit din afara Gaeltachtului i pentrucareirlandezaeraoadoualimb,nvat.nmodsemnificativ,apropode ndoiala cu privire la destinul naional, Nal Maidine agus Tine Oche e o alegorie politicreflectndodiseeaunuipoporalesdezvluitnrefleciileunuiconductor ales.Lafeldesemnificativ,cuprivirelalimbairlandeznideologiarevivalistia scriitorilor ca Mire, este folosirea unui limbaj foarte literar, mult deprtat de caintnandaoine(vorbireapoporului),deiaici,cainmultealtelocuri,trebuie amintitinfluenaluiMirtnCadhainasuprascriitorilormaitineriiremarcasa privindDicionarulluiDinneen:[gur]chirdochuilescrbhneoiriathabhairtchun leapan leis (cu care fiecare scriitor ar trebui s doarm sub pern). D Luain, un roman istoric bun privind Rscoala din 1916, folosind o tehnic cinematografic pentru a da o imagine caleidoscopic a evenimentelor i motivaiilor. Vorbind desprescrierearomanului,Tuairiscspunea: Bonn ruda irithe ag baint le Gaeilge de bhr nach raibh an Ghaeilge in sid le 300 bliain n mar sin... an chad rd a bh le danamhagamnfocliradhanamhamachdomfinasframhacha naGaeilge...sachsseo,salitrocht...BaineannssinleGaeilge...N for maidir le teangacha eile. Is fidir leat cur sos ar thrimhse ar bithsaBharla,tfoclirchomhleathansinagat...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Irlandeza are unele trsturi rezultnd din faptul c nu a fost folosit timpde 300 de ani... primullucru pe care a trebuit slfac a fost smi alctuiesc un dicionar din rdcinile irlandezei... n acest caz,pentruliteratur...Acestlucruecevaceaparineirlandezei...Nu eadevratcuprivirelaaltelimbi.Poiscriedespreoriceperioadn englez,aiunvocabularattdevast... n Caoin T Fin, naratorul, revenindui dintro mahmureal atotputernic, ncearc s neleag prbuirea vieii sale personale. Obiectele i evenimentelesuntnregistratenminteasubiectuluiromanuluiiarstiluloglindete ncercarea sa de a extrage fragmentele ntro form coerent. De asemenea semnificativ este opera lui Eogham Tuairisc, An Lomnochtin (Cel gol 1977), undeautorulcautsdezvolteolimbiunstilpentruadescrieformareaimaginii desprelumeaunuibiatcarecretenregiunilevorbitoaredeenglezaleIrlandei, folosindtehnicastreamofconsciousness. Preocuparea pentru limb i stil este, n mod normal n aceste circumstane, caracteristic multor scriitori ncepnd din anii 60. Cu privire la romanulMirscrnaTreibhe(Rupturntrib1978),MirnNicEoinremarc: Is sa leabhar seo, thar aon it eile, a chomhlonarn Alan Titley a fhealsnachtlitearthafingurbanteangaaguscaidreamhandair li an rud is tbhachta, an rud a dhanann saothar fintach de leabhar...Isanteangafinataggnomhanseo,drdtimpeall,dr dtachtadh,drndalladh. n acest carte Alan Titley i pune n valoare mai ales filosofia literar adic limba i angajamentul scriitorului n acest sens care este cel mai important, care transform o lucrare de ficiune ntrun produs valoros... Limba nsi lucreaz aici, nconjurndune, necndune,orbindune. Mchel Brolachin, autorul unei Pax Dei (1985) reci, postholocaust, se preocupdedezvoltareauneilimbicarevareflectaputernicaccentuataiargotica Gaeilgebhriste(irlandezaspart)aunuitnrdinDublin,vorbitordeirlandez. SamusMacAnnaidh,autoralCuaifeachmoLondubh(Furtunamierleimelegalbene 1983)iMoDhMhic(CeidoiMicaimei1986),aratopreocuparesimilarpentru limb. Pri din ambele romane (care formeaz primele dou volume ale unei trilogii)suntscrisentrocombinaiedeirlandezienglez,iarnCuaifeachunul dinpersonajerefuzcompletsvorbeascirlandeza.nambelecri,deinspecial n Cuaifeach, exist jocuri de cuvinte scandaloase, exemple de subminare a referinelorliterare,deformrialelimbii,ambiguiti,nelesurimultiple;iautorul
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


este, n ambele, la fel de vizibil ca Laurence Sterne (n Tristram Shandy) sau Jean Genet.Graniadintreautor/text/cititorestecontinuuatacat:deexemplurefrenul repetat dea lungul Cuaifeach, Is cuma faoin scal. Amharc sna sile agam. Danaimis caidreamh (Povestea nu conteaz. Privetem n ochi. S fim mpreun), care amintete de acele picturi renascentiste unde subiectul picturii pare c ntinde un picior sau o mn n afara cadrului, n spaiul observatorului; saunMoDhMhic,prininvitaialaadresacititoruluideaparticipaprinpictarea unui numr de desenecuvnt care formeaz un fundal sau dau strlucire evenimentelor din roman Litheoireacht chruthaitheach (lectur activ creatoare); ntradevr! Cuaifeach este o oper complex n care timpul, personalitateaiidentitateapersonalatingofluiditatetulburtoare,ntimpceun numrdepersonajecentralesuntobsedatededorinanemuririi. Mac Annaidh ia descris primul roman drept punkleabhair (carte golneasc). Titlul celei dea doua cri a sa este o aluzie la primul roman al lui Mire, Mo Dh Risn (Cele dou Risn ale mele 1921). Labhras g (Labhras cel tnr)aredouiubiri,ofemeieiIrlanda.Deindrgostitdeel,brunetaRisna juratcnusevamritapncndIrlanda(AscunsaRisn)vafiliber.Elluptn Rscoala de Pati i i d viaa pentru cele dou Risn ale sale. O ntlnim pe brunetaRisnlasfritulcrii,ncplngnduimoartea.MoDhMhicaluiMac Annaidh este n multe privine o subminare a lucrrii lui Mire, apreciat de spiritul interogativ al fratelui lui Mire, scriitorul Seosamh Mac Grianna. Mierlirea propagat de Mic Mac Crosin (Domnul Mierl) este un fel de nebunie divin i anarhic cutnd o deschidere care ar transcende divizarea politic partizan din Irlanda de Nord. Una din antitezele romanului e reprezentat de Justine Nic Anna, profesoara tcut, puritan i frustrat sexual, care este portretizat drept naionalist nverunat. Totui, structura sa anti liniarepisodic,numeroaselesaleambiguiti,lipsauneiconcluziiconvenionale fac din acest roman orice numai oper didactic nu. Ariel, colarul protestant, esteagentulpecareMic(Prospero)larfolosidreptcatalizatornintrigacarenuse dezvoltniciodat. Mac Annaidh este unul dintre cei mai provocatori romancieri de limb irlandez contemporani. Alegerea limbii irlandeze l plaseaz n contextul preocuprilor care cuprind ntreaga insul. Totui cel deal doilea roman al su estevizibilocartedinIrlandadeNorddeastzi.Refrinduselapoezianirlandez n Irlanda de Nord, Greagir Dill afirm: Problemele politice continue... au creatosituaiencarepuinidinceimaipublicaipoeisuntapoliticiitoisunt, ntro oarecare msur, didactici. James Hawthorn, preedintele noului Grup al Tradiiilor Culturale, care a fost nfiinat recent n Irlanda de Nord, spunea: Scanraonn an Ghaeilge naonur as deichnir den mhuintir lena bhainimse... ach nlmiseinameascsid(Noudinzeceoamenincomunitateameasuntsperiai deirlandez...deiacestlucrunueadevratncazulmeu).Astanseamnclimba
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


irlandez este, n consecin, limba cu care se identific minoritatea naionalist. Ct vreme limba irlandez este recunoscut n cadrul sistemului colar ii va fi recunoscut importana istoric n noul program al Motenirii Culturale, cu greu sar putea spune c n trecut a fost ncurajat de ctre statul Nord Irlandez. Ct vreme protestanii unioniti iau manifestat intermitent interesul pentru limba irlandez, campaniile din jurul limbii sunt n mod esenial campanii naionalist republicane, ceea ce face din irlandez o problem politic ntrun sens oarecum diferit de cel din Republica Irlanda. Aici exist nc un larg consens c limba irlandez este o problem naional. n Irlanda de Nord, n realitate, irlandeza a fostprivitpnnpresentcaoproblemacomunitiinaionaliste.Deaceea,nue ciudatfaptulcexistmaipuinspaiupentruscriitorulnirlandezdectpentru scriitorulnenglez.MacAnnaidh,carereacioneazmpotrivapresiunilorpecare politica limbii le exercit asupra scriitorului, creeaz acel spaiu cultural n opera sa,deiaceastaestedestuldecomplexcasreflecteconstrngerilecarerestrng acel spaiu n realitate. Mac Annaidh lupt s creeze spaiul pe care scriitorii din Rebublica Irlanda lau creat n perioada de dup independen n circumstane oarecum diferite. El ncearc ceva important n Mo Dh Mhic, care stabilete o dialecticntreiluzieirealitate. Propaganda i munca educaional a Ligii Galice i nfiinarea unui stat irlandez la nceputul secolului XX, mpreun cu programele privind educaia ale guvernelor succesive irlandeze, au contribuit la crearea condiiilor n care proza irlandez a putut renate. Perioada avut n vedere a fost una n care considerabilul efort de recuperare, pe care Breandn Doibhlin l descria ca necesar,afostduslabunsfrit,maialesncepndcuanii60.Dacmiturilecreate nprocesulconstruiriistatuluiautrebuitcontestateidacpoliticastatuluiafost mai puin dect adecvat n ochii revivalitilor, deziluzionarea i demistificarea careauacompaniataizecideanideindependenpoliticnRepublicaIrlandaau contribuitnfelullorlamaturizareaprozeinirlandez.Dezvoltareauneiliteraturi moderne n Irlanda a depins de asemenea, cum au sperat modernitii, de o contiincrescndadezvoltriiliteraturiihibernoenglezeialiteraturiinafara Irlandei. Aceasta sa mplinit ntro mic insul de la marginea Europei, ntro limbsprijinitmpotrivadeclinului,ntrunsecolncareputereacomunicaiilorn mas supranaionale a crescut n mod nencetat; fie ca n plenitudinea timpului noncelticsfieprivitcaovariaiepetema: Donotgogentleintothatgoodnight Rage,rageagainstthedyingofthelight. Numergeblndnnoapteaadnc nfrunt,nfruntmoartealuminii.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Totui,aceastaposteritateaovajudeca.Scriitoriinirlandeztrebuie,ntre timp, si urmeze nsrcinarea de a rafina i mbogi o limb strveche prin ntlnireadintreimaginaieirealitate.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Iliaurboesteooperdeficiune.Oriceasemnareapersonajelorcupersoane,grupuridepersoanesau naiuni reale este pur accidental. Autorul i declin orice responsabilitate de ordin intelectual cu privire la repercusiuniledirectesauindirectepecarelearputeaaveafaptelesauconcepteleprezentate.Dimpotriv,autorul nu intenioneaz si cear scuze pentru limbajul atribuit unor personaje, deoarece acesta are un rol exclusiv stilistic. De asemenea, autorul nu d doi bani pe astfel de scuze penibile i ipocrite impuse de political correctness.Defapt,mesajulera:Nurspund,bi,deceleceamscris,ccibeautyisintheeyeofthebeholder.

Dup ce au fost oficializate contactele cu extrateretrii, pe la nceputul secoluluiXXI,lucrurilesaumaischimbatpePmnt.Deisanceputcustngul scuzele preedintelui Americii fiind de un ridicol desvrit sa continuat cu dreptul i de fric s nu le mai mearg prost, pmntenii au srit ntrun picior pncndileauruptpeamndou. Bazele americane i ruseti de pe Lun, inute n secret cincizeci de ani, saudoveditoglumproastpelngofertaurilor:nfiinareadecoloniiumane nafarasistemuluinostrusolar,peniteplanetenumaibunepentrunoi,alesecu grijdeei. Ceau dat pmntenii n schimb pentru tehnologia asta, nu se tie. Sau auzit numai zvonuri, n anii imediat urmtori: a disprut un sfert din populaia Africii, zece milioane de chinezi au plecat ntro expediie tiinific sau ntrun pelerinaj(sursediferite)peEverest,jumtatedinpucriaiiamericaniauevadati nimeninamaitiutdeei,arabii...carearabi?(Mam,ceeacelaunarab?Arabule ospeciemicdecastorcareatritpnacumosutdeaninPeninsulaIsrael.) Odatdepitpericolulsuprapopulrii,aunceputssedescopereleacuri dea dreptul miraculoase pentru boli pn atunci incurabile: SIDA, cancerul, hepatitaFialtele. nUniuneaEuropeanerabine.Ostaregeneraldeprogresinormalitate. NumaiRomniaerancriz.DefaptRomniaoineatotntrocriz,aaciaici putea fi considerat ca existnd o stare de normalitate. Dac printro greeal se maintmplascreascniveluldetraiisaibpolulaiancredereninstituiile statului, bravii oameni politici romni reueau s fac fa cu brio situaiei i s readucaranstareadenormalitate. Inexplicabil,AgeniaSpaialRomnnufusesedesfiinatdupplecarea sprezrilealbastreaprimuluiisinguruluiromncosmonaut.Maimiunaunc peacolo o seam de obolnari care pndeau sateliii cu ochiul liber, c doar le furaserbieiiigeamurile,darmitetelescoapele. Dupceamericaniiiauluatvreoctevaplanete,nbazafaptuluiceiau ncheiat primii un tratat cu extrateretrii, ONU a aprobat propunerea SUA de distribuireechitabilaspaiilordecolonizarepentrutoatenaiunileglobului.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ParlamentulEuropeananceputsdezbatmprireaplaneteidenumit simbolic New Europe / Nouvelle Europe / Neue Europa. Din motive practice pe carelevomvedeamaincolo,NovaEropo. Se avea n vedere constituirea unei supermegalometropole un ora pe unntregcontinent,divizatapoinzonecorespunzndrilordoritoare,pentrua puteaficonservatidentitateaetnicilibertateadeexprimareculturalafiecrui popor,respectnduseprincipiulunitiindiversitate. Sadecistragerealasoriaamplasamentuluigeograficpropriuzis,pentru fiecarenaie.Germanii,careiniialdoriserdoulucruriofeliezemoasdelitoral iojumtatedecontinentntreeiicartierulromnescauavutunnorocfantastic: lisaundeplinitambele.Chestiaastanamiratpenimeni,deoarececancelarulera vrstor. Romniiauavutlarndulloroideeexcelent:decesnuaplicminoi modelul european? De ce s nu ne numim pe drept Romania / Roumanie / Rumnien? De ce s nu ne mprim i noi supercartierul nostru drag dup provinciileistorice:Transilvania,Muntenia,MoldovaiBucureti? Adevrulecideeacartiereloreradestuldepromitoare.Nuvimaginai un ghetou cu blocuri de patruzeci de etaje nghesuite unul n altul. Nu. Vile i prculee, mpreun cu toate magazinele, colile i locurile pentru divertisment necesare.Desigur,toateacesteatrebuiaumainticonstruite,darspaiueradestul. Produsele necesare traiului urmau s fie aduse de pe continentul agraro industrial,ceeacenueranicioproblempentrunaveledetransportcefoloseau energiacmpuluimagneticalplaneteidecigratis.Acestaeraproiectul. Maiinteresanterafaptulcnsiideeadegranierascoasdindiscuie. Acestlucrureprezentaodovaddecuraj,dacnegndimcatuncicndaintrat RomnianspaiulSchengen,auieitrepedecelelalteri. Dupcumspuneammaidevreme,dinmotivedeorgoliu,saconvenitca limbaoficialaplaneteisfieesperanto.Ceicarevoiausimigrezetrebuiaunti sonvee.Ceeacenafostdelocopiedic. Firete, numele limbii oficiale a devenit imediat n argoul mioritic sperantula,pentruarimacuonoiunefoartedragromnilor.inmodsiguri maidragromncelor,dacesrespectmadevrulistoric. Sapornitlaconstruciaplanetei.Saufcutcase,blocuri,strzi,spitale.S aufcutbnci.Saufcutposturidepoliie.Saufcutdetoate. Europeniiimigrauveseli,dinspiritdeaventur,dindorindeprofitsau din lips de speran. Cei mai muli au plecat din Romnia, aproape patru milioane,adic o cincimedin populaia rii. Probabildin Albaniaarfi plecattot patru milioane, adic toat ara, dar din fericire Albania nu era n Uniunea European. n Romnia, procesul a avut cteva particulariti. iganii au plecat majoritatea,pedeopartevrndsscapedeacompaniamentulironicsauostilipe
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


dealtabucurndusedeposibilitateadeaintrancontactdirectcucivilizaiimai avansateicuunniveldetraimairidicat. iunguriisaudus.ncartierulunguresc,undeaufostprimiifoartebine, darnucubraeledeschise,aacumseateptau.Nuacelailucrusantmplatcu doritorii de azil politic din Republica Moldova. De frica mafiei ruseti i de romnofilianativilor,acestoralisaurespinscererileiaufostnevoiinfinalsse stabileasc n cartierul moldovenesc al planetei 1. Se vede treaba c independenanuepreabunpentruhorticultur. Romnii ajuni pe Nova Eropo au neles nc o dat c dac cineva le spunecvafiexcelent,sarputeachiarsfiebine.Blocuriledincartierullorerau foartefrumoaseiarstrzilemultmaibunecaacas.Lanumaijumtatedeorde merscumaina,puteauvedeapeviuvileledanezilor. Cartierele romnilor i danezilor, de exemplu, erau cam la fel de mari ca suprafa,deiromniieraudezeceorimaimuli.Darlecerusecinevasvin? n plus, se iviser ceva probleme cu colonizarea jumtii sudice a continentului, aa c toi trebuiser s se mai restrng. Zvonurile privind construirea unor baze militare n zona respectiv au fost rapid infirmate de persoanedemnedencredere. i, ca s le pun capac la toate, imigranii i ddur seama c ntreg continentuleramarectFrana.Parteabunerafaptulcoameniitrebuiausfie maiapropiai.TocmaiceipropuneaComunitateaEuropean. Lacivaanidupaceea,cndoameniisaumaiobinuitisastabilitun echilibru ecologic, sau organizat alegeri. n cartierele romneti, politicienii au aplicat metoda clasic de pe Pmnt, care d rezultate tot timpul, pentru c romnii nu obinuiesc s judece cu creierul, ci cu glandele suprarenale: promite orice i apoi f ce poi i tu acolo. n consecin, parlamentarii au fost alei i probabilsaurefugiatncartierulcentral,pentrucnimeninamaiauzitdeei. Spuneam cartiere romneti pentru c ntre cele patru subcartiere sau stabilit zone invizibile de demarcaie,la fel de puternice can cazul celor strine. Ciudatcumnenelegerileadoumileniiauizbucnitnurlaanilumindeprtare desursainiial.Defapt,NovaEropo,nelareaateptrilor,afostpicturacarea umplut paharul. nfrni de o istorie mizerabil, incapabili si falsifice trecutul ntrunmodacceptabiliapoinefiindnstarestriascdemistificarea,romniiau pornitsiconstruiascunviitor.Oenigmiunmiracolpoporulromn.Pcat cnunsenspozitiv. n afar de cele patru, mai exista cartierul ignesc, pe teritoriul celui bucuretean. Nimeni nu tia exact ce se ntmpla acolo, n afar de activiti mafiote. Iar noaptea acest loc cpta proprieti asemntoare Triunghiului BermudelordepePmnt.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nsacumnevomndreptasprecartierulmoldovenesc,casvedemcum gndealumeaobinuit. La scara unui bloc stteau patru biei, aplecai asupra unei controverse lingvistice: i,cummsaszcinsperantulpul?Pulo?atuncialapizdcum szc?Pulino?Picnzcdutinpizdamtiiparclfupitatu. Ceilali trei izbucnir n rs, dar un rs intelectual, cci era ntradevr o problem. Iru en la pulino de cia patrino nu era n nici un caz un ideal de njurtur. Ar trebui s facun dicionar dracu, s tii cum si zci unui bulangiu strin.Nufuckyou,dumneziimsii.Ladiojdeciapatrino?Bgamiapulan limbalorfutut! ipentruamarcamomentul,scuipprelungcuscrb. Aceast tnr speran se numea Viorel, dar era poreclit docu. Etimologia cuvntului se pierduse, dar att doctor ct i document puteau fi propunericredibile.CciViorelerapedreptcuvntcelmaimaremaestruncopiat pecarelvzusecartierul(iprobabilplaneta,frnicioexagerare).nvasepn nclasaaXadestuldebine,nsfcusegreealasnveeipentruexamenulde admiteren liceu.Venise doar de unan i nc nui formase o idee despre noua locuin.Iarlaexamenlvzusecopiindpeunuliapoilundpunctajmaimare. Deatuncicopiasetot.Cumexaminrilesefceaunscris,puteaspunec ajunsese ntra XIIa fr s nvee un rnd. Ce era mai curios, nu fusese prins niciodat. Copia i cu profesorul alturi. Nimeni nui putea face nimic. De fapt, chiar avea un profesor carei punea A fr si mai corecteze teza (era oricum foarte bun), doar si spun ce metod mai folosise de data aia. i avea nite metodedeicdeauochiincerulgurii. Cititorulsnusesuperecnuprimeteaicictevaexempleconcrete.Dac learfitiut,autorularfifostprobabilpuinmaifericitipoatenuarmaifiscris aceastpovestire. Viorel mai avea doar un semestru de coal, dup care trebuia s copie baculiapoiarfipututmergelauniversitate.nselnudoreaaaceva.Voiadoar sigseascoslujbbnoasctmaidepartedecartierulmoldovenesc. Familia sa venea din Iai. Rmseser omeri i plecaser. Acum nu mai erauomeri,dartotsracirmseser. Eraliderulgrupului. Marius avea douzeci de ani. Nu era prea detept, dar era de gac. Vorbeanielciudat,ccinurmcuvreodoianiprimiseobtaiebunndecursul creiaifuseseruptnasul.AisieraudinSuceavaielavuseseproastainspiraie sspundectevaoricebucovinean,numoldovean.iseparecaceastchestie nuplcusedelocunora.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


n plus, nutrea o ur nempcat i mistuitoare pentru doctori i pentru actul medical n general. Acest lucru i se trgea din perioada ct fusese internat pentru trenia precedent. Prinii i cei doi frai mai mici triser o lun cu pineiappentrucataicsusaibcucemituidoctoriicasireparenasuli ochiuldreptiasistentelecasnufieazvrliteventuallamorg,dingreeal. Iarnspitalvzusectevalucruri.Depild,npatcuelsttuseunbtrn carefuseseoperatdemntuialdeapendicitfiindcnuvoisesdea.Spuneaelc iapltitasigurarea.nmodevident,asigurareasadoveditinsuficient,pentruc la zbieretele lui necontenite o asistent venise ntrun trziu i dup cei dduse una pestegur, i puseseo perfuzie. Cel puin,restulde treisptmni rmsese singurnpat,ceeaceajutaselarefacere. Al treilea se numea Gheorghi i era poreclit bete, fiindc era de prin prile Botoaniului. BT de la bietul ran. Gheorghi te ajuta oricnd la nevoie,darDoamneferetesitragivreoeap,cineaminteorictiiotrgea laloccndieralumeamaidrag. Era singurul care avusese probleme cu legea, dar scpase ca prin urechile acului de coala de reeducare, pentru c prinii mamei sale fuseser constenicupriniijudectorului.Aceasta,mpreuncuomicatenie,oleacmai mare, i judectorului i pruse clar c tnrul avea anse reale de reintegrare social. Ca brf colateral, se zicea c n vizita la judector, maicsa folosise i altemijloacedeconvingeredectcelegenealogiceipecuniare. ns ce se ntmplase? ntro sear, nite vecini l prinseser pe administratorfurnddinbaniidentreinere.Gheorghitocmaierantrecereise apropiasesvaddecesestriga.Cumadministratorulnunumaicnurecunotea, dar mai fcea i scandal, mpingndul pe unul, pe altul, i se administr o chelfneal,maimultamicalimoralizatoare. Dar a doua zi, el se duse la eful poliiei districtuale i reclam. Administratorul era profesorul fiului efului de post, care avea nevoie de o pil pentrubac,fiidcerantradoipea.Aacinfractoriifurprinirepedeideferii justiiei. Dup un an, ntro noapte, Gheorghi l vzu pe administrator (care demisionasentretimp),singurpestrad.Erapuinameitiiaduseamintecu iritaredentmplareanefericit.Aacseapropieiitraseunancapcusticlade berepecareoaveanmn.Sticlanusesparse,darcapulfostuluiadministrator da.imaidduunutillsszacacolo.Dupvreodoulunidespitalizarei trei operaii, profesorul se duse iar s reclame. Se zice c rspunsul poliiei ar fi fost:Distulieimncatzlililufiumiucuccatutudiculturromn.Acumavrei dreptati?Dutinpizdamtiiscaudreptati. Al patrulea era Virgil. Era cel mai btrn 24 de ani. Venise din Galai, avea centuralbastrla karate i principala lui preocupare eraugagicile.Avea la activ majoritatea colegelor de clas i una din profesoare, asta pn se lsase de
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


coal. Era singurul care avea o slujb era vnztor. Se mulumea acum cu femeleledepelablocieventualcuceledelafirm.elulsupetermenscurtera siopunpatroanei.Conflictecuveciniisaucualtegrupurinuavea,ccidupce lbtuseodatpeunboxerprofesionist,lumeancepusesitiedefric.Aanct ntreg grupul era n siguran datorit lui. n plus, tia o grmad de bancuri. Aproape n fiecare zi venea cu vreo poant nou, asta n afar de glumele de circumstan,carecteodateraumaibunedectbancurileoficiale. Cititorulsnusesuperecnuprimeteaicictevaexempleconcrete.Dac lear fi tiut, autorul ar fi fost puin mai fericit i poate nu ar mai fi scris aceast povestire. Camstaeragrupulfantastic.Maierauprinpreajmialiidevrstalor, dar, din diferite motive, relaiile cu ei erau cel mult amicale. Ca regul general ns, toi se salutau cu toi atunci cnd se vedeau. De fapt, chiar ntre cei patru exista o stare de nencredere preventiv, ns numai pentru chestiile cu adevrat serioase. DupcumobinuiasspuntatlluiViorel,prieteneacelacarenusarecu cuitulfrsistrigemainti. nceleceurmeaz,nuvoiprezentavreontmplareaaziscrucialdin viaa grupului nostru. Fiecare experien influeneaz viitorul, mai mult sau mai puin, n funcie de intensitatea cu care e perceput. E adevrat c urmtoarele 3 aventurioare au avut un cuvnt de spus n evoluia indivizilor implicai. Dumnezeutiectdeimportantafostacestcuvnt. Prima. Discriminarea moldovenilor nu mai era de mult o noutate pentru unromncaretiactdectcesentmplnjurulsu.Interesantestecaceast atitudine sa pstrat i n rndul colonitilor noueuropeni, dei, de exemplu, ntre cartierele moldovenesc i bucuretean nu existau legturi mai strnse dect ntre cel moldovenesc i cel danez. Bucuretenii aveau nc impresia c locuiesc ntrocapital,ideciipstrauatitudinilesuperioarefadeprovinciali. i printre moldoveni circulau zvonuri. Unii aveau slujbe n alte cartiere. Uniitrebuiaustreacnoapteaprinaltecartiere.Uniiaveauneplceripentrucnu erau ardeleni sau bucureteni. Erau i voci extremiste (Pe cmaa Noii Romnii sunt dou pete: cartierul ignesc i cel moldovenesc), dar acestea se trau n izolare.Atitudineamajoritarzmbeaironiclaadresanesplatelordesrme.(Tat, ceeaceeaoli?Piaeazicemoldoveniilacopii.Maitrziu:B,datiidcepopa secheamlamoldovenielectrician?Pentrucngroapdectsrme.) Bi, pi bun, s nu mai aud di munteni, ardeleni to ciilal bulangii, spuseGheorghi. Da,i,sri,sri,da!confirmMarius. M,ceszic,miapovestittaicmiucopartidinfamilianoastrieradin Bucureti sau plecasi la Bucureti. i cic ia ierau de treab. mi amintesc i ieu camfostodatpelaieiinumiauluatgtu.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


BiVirgil,interveniViorel,ionuzccnuiaa.Sntoaminditreab,ca oriundi. Da snt niti javri di scot ochii, nu alta. Uiti, auzam zliliestea c Ciprian...ltipiCiprian,dila415... iartcumnandireciarespectiv.ltiauiceilali. ...ei,cicinspitallobtutiadinBucureti. Cum,i,pibun!? Da,i.nutu,parcmipariru,cprbiatditreab. Danuspoatislfibtutdigeaba.Tresfifcutielceva!ziseMarius.Io finjurat,ofibgatpulanvrungna,vrunpuidimecher.Caa,cumsiei bta,dinsenin?! Nu,bi,amntrebatio!i,ciofcut?Cicnofcutnimic,i,danimic! Ielsntorcdilamunc,mprumutasmanacuivaciozsiasoieuncetior pi jos, s nu mai pierd vremea, satept o or la tren. o luato pio scurttur, printriblocuri.Ei,atunciapursimpluosritpielbulangiilocspit. Doamniferet!...sesperieGheorghi.Bgamiapula! Da,bi,sri,dinpatilimsii. Dei cunoteau i alte incidente interregionale nefericite, acest episod ia convinscntreceledoucartieresainstauratstareaderzboi,defaptcexista cel puin o zon n Ora n care fiecare dintre ei putea fi atacat fr motiv, doar fiindceramoldovean. Peste vreo sptmn, sau dus bieii s se distreze, la discotec. La nceput erau ei patru i nc ase de pe la bloc, apoi Virgil a plecat cu una s io pun. Au but bine, se pregteau i ei sufletete, cnd pe la dou sa iscat un scandal n colul opus al slii. Civa gealai sau ncierat, au intervenit i gardieniideparteaunora,inbulucealarespectiviaudrmatandramauaDJ ului,careamailuatnplusiunpumnngur.Aacacestasasuprat,ialuat jucriileiaplecatacas.Discotecaatrebuitsfieevacuat. Ceinourmaidingaciaumaicumpratcevadebut,ccidrogurile eraucamscumpepentruei,itotdrumulsprecasaucntatiiaunjuratpehoii care le furaser banii. La un moment dat, ceilali ase au ajuns la destinaie, iar Viorel,MariusiGheorghiicontinuarmarul.Buturaseterminase,aacnu lermneadectsmaicnteniel.icntau.MainticunoscutullagrSfinii Petru i Mihai / iau deschis crciumn rai, pentru ca apoi s treac la lucruri mai serioase: n grdina lui Ion / apte mii de curve dorm / Numai unai somnambul/izboardinpulnpul! Eventualii poliiti ntlnii n cale o coteau circumspeci pe strzi mai lturalnice,defricsnuaibprobleme.Samendeziziuacteunpensionarcarea trecut pe rou era una, iar confruntarea direct cu nite golani bei i probabil narmaieracutotulaltceva. La o sut de metri de scara blocului unde locuiau, Gheorghi ia adus amintecdefaptsedusesercumainaluiViorel.Nimeninutiaexactdecenuse
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ntorsesertotcumainaluiViorel.Acestaerapreamortcasideaseamacese ntmplase,dartiaceracevandefavoarealui.Aaczmbeainjura. Deodat,nfaalorrsriunom.Seuitareimaibineivzurcnuera uncunoscut.nacelmoment,bucurialiseevaporialarmancepuslesunen creiere. Viorelsepostnfaaluiiispuse: Camtrziupentruoplimbari,nucrez?Cioszcmmica? Ladreptvorbind,eradestuldedubioscalaoratreidimineaasiapar nainte un mechera ras n cap, cu musta i cioc, i beat pe deasupra. Din nefericirens,strinulhotrsdeschidgura,nlocsoialafug. Stai,frne,cetezburletiaea? Cndncapulcelortreiseaprinsebeculeulbucuretean,Gheorghise repezi,scrnind: Tuguramtii! nsViorellopri. O!spuseelreverenios.Dumneavoastrsnteidincartierulbucuretean! Cevntvaducepeplaiurilinoastri? Surprinztor,cellaltrspunsenormal,chiarzmbind: Piamfostplaogagicdaiceadlavoi.Bun,bun!irse. Bun, bun, l ngn Viorel, din ce n ce mai enervat. Da ci, voi nave pizd,acolonBucureti?Vinifutilanoi? Strinul realiz c multe nu erau n regul i avu inspiraia s tac. ns astanuiajutpreamult. Aamducieulatiniacasofutpimta...Cidracucautunoaptea nMoldova,i?Pidraculcau,moule! Cellalt voi s plece, dar Gheorghi i Viorel nul lsar. Se strnser n jurulsu. Sedkialvivolasforiri?Restumallongantempon,niparolu!1spuseViorel, careseparecfuseseacceptatnfunciadeinchizitoref. Tcere. Diru,kievilaboras?2 Sntstudent,rspunsebucureteanulcujumtatedegur. Iauz,i,estudent!Kajkieviestasstudento?3 Lamedicin. Mariussenglbenilafa. Ietistudentlamedicin,ai,futucristomtii!Sajunjidoctorsomori oamin!
Dardecevreispleci?Maistaipuin,smaivorbim!(esp.) Iazi,undelucrezi?(esp.) 3iundeetistudent?(esp.)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Bucureteanulncepustremureuor.Selsasefrigafar. Stai,stai,lpotoliViorel.Ia,dmiiogar! Nufumez,optivictima. Cum,i,nuvreismidaiogar?Hai,bi,cpltesc.Ctvrei?10iepuri? 20diiepuri? Iepureleeranumeleromnesccolocvialpentrunovaeuromonedan circulaie.Salariulmediuerade500denovajeurojpelun. Hai,csarcubanu!Dmimiiogar. Nufumez,repetmaitarevictima. Iauz,i,niciogarnuvresmid.Cizcidiasta? Zcsifutimuna!rspunseMarius,cuasentimentulluiGheorghi. Bi,stiicmamsupratpitini!Da...mamsuprat... Tcuctevaclipe. cumochiampiprietenata? Studentul,pclitdenormalitateatonului,socoticeontrebarepersonal lacarenuenevoitsrspund.Bachiariluinimandiniizise: Cetedoare? Viorelizbucni,apucnduldegt: Mdoarenpul,bnene,mdoarenpul,ditini,ditalentilivoastri di bulangii. Cum pizda mtii mi rspunz tu, mi pu? Ci ti doari? Io team ntrebat frumos cum o chiam pi prietena ta tu bagi pulan mini, nu? bagi pulan moldoveni, nu? Ciar fi acuma s rup gura, aa cum ia fcut voi lu Ciprian? Bucureteanulsesmuciincepusipe: Daiamaidtebdracu!Lasmnpace!NulcunoscpCiprian,nuv cunosc p voi, ce tot urli injuri aicea? Eti beat, dute i te culc, nu te lua d oameni! Viorelncercsideaopalm,darnunimeri.Cellaltitraseunutsub centur i o lu la fug. Viorel se prbui, mai mult din cauza buturii dect a loviturii, ns Gheorghi i Marius, dup o scurt urmrire, incredibil la alcoolemia lor, l prinser il puser jos. Viorel se ridic i se apropie i el de epicentru. Dup o repriz de cinci minute de uturi, studentul nu mai url. Totui Marius avu proasta inspiraie si mai trag un picior n cap. Imediat, bucureteanuluincepusicurgsngedintroureche.Cndvzurasta,ceitrei sesperiar. Bi,daclamomort?tresriGheorghi. Taci,i,dingur,cumslomorm?tresriiViorel.Iamdatnoictiva, acolo...Cumslomorm?Bi,daciicurgisngi!... Bi,pibuni,namvrut!Namcrezutciamdataatari!vorbiMarius,cu glastremurat.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ifaimacuma?Schemmsalvarea?ntrebGheorghi. Bi, da dac chemm salvarea vini poliia? zise Viorel. Mai binil lsmaicea.Lascreviniielpleac;nunitiipiniciunu.Doariamdatnuma ctiva.ielcufigurincap!...Poatiambutnoicammult...Haismergim! Plecar. Unii din ei constatar c aveau snge pe mini i trebuir s se spele. Studentul petrecu o lun n spital i rmase cu o ur nempcat i mistuitoare pentru srme i tot ceea ce inea de ele. Prinii fcur reclamaie la poliiadistrictual. Duposptmndelatrenie,pecndveneautoipatrudeundeva,se ntlnircuefulpoliieidistrictuale.Acestaeraunomlavreopatruzecideani,dar artadecincizeci,fiindcaveaofabuhitdebeivinplus,ctevazecidekile pestemediacelorosutaptezecidecentimetriaisi.Treipersoanesimircumle ngheasngelenvine.Apatrapersoansegndicedracusziccasnuintre iellaap.Acinceapersoanspuse: Bibie,iavinioleacncoai! Seaezarnsemicercnfaapoliistului. Bi,voitiisontmplataiiacuosptmn? Cisontmplat,domagent?ndrzniViorel. Bi, voi ti c o fost btut un student din Bucureti, uiteiia, la blocu ista? Poliistulmiroseaaalcool. Nutiem,domagent. Poliistul l lu prietenete pe dup umeri pe Viorel, ii privi cu nelepciunepeceilali. Bi,ieutiuinilobtut,mcredi? Da,domagent,zisertoi. Bi,voimcredi,ctiuinilobtut!?insistomullegii. Da,stri,domagent!Dumneavoastrtitotcisntmplpeicia.Crec toatzonaastasarducidirpdacnafidumneavoastr,sniaparadiborfa criminali. Agentulzmbideplcere. Bibie,voisntebieditreab,i,rseel.Tuniclasieti? ntradoipea,stridomagent!rspunsepromtViorel. Bi... lbtupeceaf,rznd. ...tuietimari,i! Apoisuspin: Uitiioamdoibie,cavoidimari! Svtriasc,domagent. ismitriasc,vaidicapumeu!Abamilidadimncar,cusalarusta diccatpicarimildaujdaniiitia...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


iridicsugestivundegetnsus. Ceipatruaprobar. acumanevastmiaibolnav,otrebuitsointerneznspital.tresi pltescpidoctori... Sedduunpasnapoi,isuflnasulpejosndegeteiapoisetersecu mnecauniformei. Ioamgreutmari,mibie.Uitiascultaaiilaminiivspun,cdict sajunjiunccatssuitilumealatini,maibini,vspunaa... ifcuungestdelehamiteiderenunaretotal. ViorelidduunghiontluiVirgil,caretresri: Da,aredreptatedomagent,nu,bi? Bi,tdumnealuicispuni! Domnuagent,vorbiViorel.ivrogsnuninlegigret,daamvrea, dacsarputea,svajutmaa,cuciputemnoi!Oaminsntem! Poliistuluiidduolacrim. i,dicnvamvzutioamtiutcsntenitibieinteligen.Dacpute smmprumutaacumalanevo,osvdauiocnosam. Vai,dalsa,domagent,daspoati?!Importantissfacdoamnabini!... Camdictaavnevo? Camdi1000diiepuri. Viorelfcuuncalculc300decciulnuerapuin,darmaibinedects intrinpucrie. Bini,domagent.cndvartrebui? Pi pisti dou zli, la birou meu! Cl trimit pi Sorin pi teren o s fiu sngur.Dasnuvinito!Numaunusngur,ladoipi.Salut,bie! Stri,domnuagent... Dupcincisecunde,Mariusizbucni: Bgalanpizdamsiidibevninorocit!Diunipulameassarcu300 diiepurindouzli? Cibulangiu,i!Zceamiocceri500,600,da1000?serevoltViorel. Las,acumanuconvini!Dactrebuispltetiavocajudectoriicum iera?Fiimulumitcaiscpatcuatta!serstiGheorghi. Virgiltcu.tiaceragreudefcutrostdebani.Maitiaceventualiar puteaajuta.Tocmaiselipisedeogagic,fiicdedeputat,plindebani.Poatedac iarficerutfrumos,iarfidat,nsdeundeputeastiecprieteniiluiiarmaifi datnapoi?Dacitrgeauoeapcttoatezilele?Gagicaerachiaropartidfoarte buniarfifostpcatspiardoanspentruviitordedragulunorgolnai.De cesselegelacapfrsldoar?Aactcuncontinuare. Sauchinuitpnauadunatbanii.CelmairapidafostViorel,careafurat carteadecreditaluitaicsu,ascosctaveadescosigata.Olunmaitrziuia datseamaipgubaulilasnopitnbtaie.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Gheorghi avea pus deoparte vreo sut. n seara respectiv pndi un ceretor,pecarelbtuiiluvreooptzecidenovajeuroj,iarrestulimprumut delamaicsa. Marius a avut probleme. Cheltuise cam o jumtate din ajutorul de omaj pelunarespectiv,adicmaiaveavreocincizecideeurormai.Nuputealuade acas,cnupreaaveacelua.ivndunitehainepentruncvreosutcincizeci, darlevndunpierdere.Cumprtoriinusegrbeau. Atuncisegndilaomecherie.Aveaunprieten,casierlaobanc.Seduse laeliipropuseochestiedegenulcsdepuncei200deeuroiapoisianapoi 333, diferena putnd so returneze cnd va primi ajutorul de omaj. Aa, ca un mprumut. Bi,tuietitmpit?Pidacmprindjdaniidilabanccuchestiidinastea, nu numai c m dau afar sau m bagn prna, da ar fin stari smi vnd din cassscoatbanii. Marius se rsuci dezndjnuit, sprijininduse de mas i uiernd printre dini: Mneziimsii!... Bi, uiti ci i! Ia deicia 50 di iepuri, da s nu ui c tias din buzunaru meu!cnieiomaju,vezsaduciaminti! Nuseateptaselaaaceva. Bi,rmndator!Mersi,i,aifostbiatbiatlafazaasta!Grupamar! npizdamtiidiccat!Nuputeisscoosut! Las,i,donmsa!Facitucinsti.Dacumteipriponitaadibini? Am avut o problem cu sectoristu, bgamia pulan doamna msa! auzcibulangiu,cicinevassanspital! Pidaoriginalcinspital,cdoarielobtutontrosaroaruncatopi scri. C be to banii n baru lu Goglea. nevassai curva blocului. Di tu tia250diiepurizicmaimultnaidiundi.Dacvresmaiatept,bini,dac nu,ssugpula! Marius socoti c era o idee bun. n drum spre cas, travers neregulamentar. Nu traversase n viaa lui pe trecerea de pietoni, dar se pare c aveaghinionsptmnaaia. Unpoliisttnrfluierilopri. Bi,datupiunicrezcmergi,i?Datucrezcstradaastaimprialu tatu,i?Iasvidemnitiact! Nam, domle, act... rspunse acuzatul privind n zare i gndinduse cum naiba s o ia ct mai repede din loc. Nu ddea doi bani pe poliist. n mod normallarfilsatsseproducuntimpiapoiarfiplecat,daracumsegrbea. Iauz,mi,nariacti.Iascoatitotciaiprinbuzunar...aa...iotiti,i,ci pungmararibiatu!Diuniieifurat,mipul?ttatudumneziimtii?!Ia dmii50diiepurivezdidrum!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Bi,staiaa!tianusbaniimii,salupuldisectorist,i.Dacnuidau, mfut!nucrecvresimpartcutini. Poliistul l privi n ochi i se convinse c disperatul din faa sa spunea adevrul. saludomnuGlavan?Pidicinaizsdilanceputaa?Uiteiciabanii... auz,snuispuicteamoprit...acuma... Nu,bi,stailinitit... Plec,zicndui: Numaigrijaastaoamio,stidaungtpitini,labagudracului! SehotrcaViorelsduccei920deeuroissetrguiascoripentruo amnare,orisfoloseascinformaiadespresoiasaunmicantaj,oanonim... Vioreleraunbiatinteligent.Nusetieceadiscutatelcuefulpoliieidistrictuale, pentru c na vorbit niciodat despre acest lucru. Tot ce a spus cnd sa ntors a fost: Gata,bi,amrezolvat. maitrebusdaurestudibani? Nu,bi,iebaniibagincur! Nimeninamaiadusvorbavreodat. Adouantmplare.Dupcefuconcediatdelafirmaundelucradincauza unornecazuricusoulpatroanei,Virgilsegndicmuncisedestulnviaaastai descoperiadevrulzicalei:Cineiharnicimunceteorieprostorinugndete. AaciamintideAlise,fiicadedeputatihotrcemomentulsseaezela casaluiilabaniiei. Uniicititorimaipuinperspicacesarputeantrebadecepedomnioaro chemaAliseinuAlicesau,ncelmairucaz,Maricica.Adevruleclastabilirea numelui su avusese un cuvnt greu de spus o carte citit de tatl su n adolescen,careiplcusenmoddeosebit,ianumeAlicenaraminunilor,ediia bogat ilustrat. Domnul director de firm (pe atunci) nu avea nici un dubiu cu privire la pronunarea numelui, ns ntrebarea funcionraului care completa certificatuldenatere,Cumsescrie?,iridicuneledificulti.Deoarecenumai aveatimpscautecartealabibliotec,mizpeintuiieiprezendespirit,innd seamacromnaifrancezasuntambelelimbiromaniceidecitrebuiesexisteo grmaddeasemnrintreele,inpluscuvintelefranuzetisetermincue. Virgil se bucur nespus cnd Alise veni ntro zi la el tremurnd ca si spun c taicsu va deveni bunic. El o lu n brae i o asigur de cele mai profundesentimente,cerndoncstorie.Cinciminutemaitrziu,fataichicotea fericit n palm, gndind Ct m iubet biatu sta. n acelai timp, Virgil i elimina ultimele ndoieli: Cam urt i proast, luaoar dracu, da are bani in pizdamsii. Singuraproblemmairmneaconsimmntulprinilorei,cciprinii lui erau, dup propria sa prere, cam frierui, n stare s se bucure sincer de
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


realizrilefiuluilor.Dupctevarundedearanjamente,sestabilicaVirgilsfac ovizitviitorilorsisocri. nziuacupricina,acestasegtilapatruace,ncostumulsuroupecare nulpurtadectlaocaziideosebite,bachiaripuseicravat,casparuntnr ctmaiserios. Rareoriavuseseemoiinvia.Acumiveniseiluirndul.PriniiAlisei locuiaunCartierulCentral,aacsepornicucincioremaidevremecumaina,de fricavreunuiambuteiajnefericit.nspedrumavulocunincidentcareiinsufl ncredere n forele proprii. Trebuie spus c el nu obinuia niciodat s acorde prioritate pietonilor pe trecerile de pietori. n trecere prin cartierul polonez, un brbat la vreo patruzeci de ani ndrzni si sar nainte pe zebr. Sistemul automatdefrnarealmainiisesizobstacoluliopribruscvehicolul,dndulpe Virgilcucapuldevolan.Acestaieiimediatafaricuonjurturscurtsriii ddu un ut puternic n cap omului. Cu nc trei pumni n rinichi, l trnti la pmnt,scuzndusecnuaveapreamulttimpladispoziiecaslnveeelminte reguliledecirculaie.Dupcelscuipnfaiseurciarlavolan,constatcse simeamultmaidegajatimaicapabildeafaceoimpresiebun.Scuturnduio urmdeprafdepemnec,gndi:Miamurdriticostumubnaibii. VilalacareseateptaVirgileradefaptunpalatntoatregula.Servitorul care l ntmpin l salut cu o plecciune i l pofti ntro camer unde stteau adunainjurulmeseiceicincimembriaifamiliei.Alisemaiaveaosoriunfrate maimic. CuvinteletartoruluiEnvenu,sidiu!1llovirparcncap.Cuadevrat, laastanuseateptase.Fupoftitsmnnce. Virgil era o persoan carismatic. Chiar dac la nceput i fu mai greu s facpoantentrolimbstrin,seobinuidestulderepede.ntreisferturideor, toatpopulaiafemininprezentiacordncrederedeplin.2 Spresfritulcinei,atmosferaeradestuldevesel,conversaianesperanto fiind pigmentat cu o seam de cugetri ale capului familiei, de genul Dict s ramnnhrdu,maighinismirusauCtmnni,attaai. Dupmas,viitorultatsocrulinvitnbiroulsu,cassteadevorbde labrbatlabrbat.AcestaeramomentuldecareVirgilsetemeacelmaimult.Cu femeilesepurtadegajat,caveaexperien,cenaiba,darcutartorultrebuiasfie atent,doarnuajunsesedegeabadeputat.Aveaeldestulemecheriinspate. l servi pe biat cu un pahar de whisky ce cea mai bun calitate, apoi se aezar amndoi deo parte i de alta a biroului. Domnul Bocinc vorbi n romnete,foarteseriosdedataaceasta:
Intr,ialoc!(esp.) Voceaautorului,nicimcaroriginal:ThemoreIdrink,themoreIsee/Thatsuicidecouldbethe key(TiamatTheSleepingBeauty)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


MiVirjil,tuietibietsimpatic,daacuma,cosfimrudi,trestiumai multidispritini.Alisezictiiubet,acumacosavecopilu,cumostri? amauztcnuietilafacultati. Virgil se foipe scaun. Navea nici unrost s mint, deputatul ar fi putut aflauortotcelarfiinteresat. Nu. Anu trecut am avut nite probleme la coal. Mam luat odat la ceartcuprofesoarademateideatuncimafrecatctaputut,malsatrepetent, ba a vorbit i cu vreo doi colegi dea iei s m lase, da pn la urm de iei am scpat.Numailamatemarupt.itotatuncisaivitoslujbbunlaunmagazin, cavnztor,imamangajat. acumaietitotacolo,vnztor? Mmm,nu,amziscimaibinisplec.Vreusmicautcevamaibun,sau smntorcsterminlice. Niciprincapnuiddusessentoarclacoal,darsesimisestrnscu uaispuseseielceiseprusemaiadecvatcassalvezesituaia. Piastaibini,macardactigndetistrminicoala.Iosspunochesti. PentruAlisesnstaridiorii,mnleji?Ieitotiamiomaiscumppilumiaasta, afai,nutu,moartidiomnumacasfiieferiitacumadacvcstori, ietiiubet,snucreztucosimnnituzestrea Danicinumgndeam Dacastateigndit,schiardincap! Nu,mparru,da Mi Virjil, tu crezcios prost? Crezc nam maivzut io mechera ca tini? Rsentrundinte.Virgilnglbeni. Dacumspunm,Alisehotrt.Aactresnepisfainitiplanuri,c osfiibrbatncas.Ioosvajutctpot,dantrobunzoinchidiioochii, atuniaiosfi? Fai,Doamniferet! ibtunlemn,pebirou. i Doamni feret? zmbi domnul Bocinc mai mbunat. Astai viaa. Az bei,mnmori.Deastaspun,tresfaiunviitor. Virgilncuviincuctmaimultconvingere. Ostinscriulacoal,sterminitucaomu,apoiosalejituofacultati, caripla,dasnutirschetipremult.aa,banudischidimultiu;omtri omvid. nsfrit,cevapegustulsu. Da,acumantritimppnncepcoala,osmigsescoslujb He,he,he,rsecapentrueldeputatul,digstoslujbomgsnoieva potrivit, s nu zc lumia c so mritat fiimia cun golan. Di pi partea asta, po s stailinitit,tudoarsfiiseriosstiiditreab.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Deitiacaceastdiscuieihotraviitorul,Virgilsemaicalmase.Tatl Alisei l luase tare, dar asta nul deranja prea mult, fiindc modul respectiv de abordareisepreadestuldecinstit.Poatearfifcutiellafel,poateaavafacei el odat. ntrun mod bizar, domnul Bocinc i devenise oarecum simpatic i ncetaseslmaipriveasccapeovacdemuls,cimaidegrabcapeunposibil partenerdelacareaveamultedenvat.Casajungdeputat,probabilcfurase inelasetoatviaa.inuattdiscuia,ctpersonalitateasaputerniclfcusepe Virgilsaiborevelaienumaidoreastriascnumaidinbaniinevestei,voia sfureielcupropriileputeri. Da,tatsocrule.Potsvspunaa? He,he,cumsnu,mibiet.Iocrecosninlejimbiniamndoi.Atta vreu s mai spun: ct vrem ai s fai i spun io, o s fi bini. Dacai mai calcat strmb pnacu, nu tu, nii nu m intereseaz, cam fost doar s io tnr, da acumadacvcstori,snuvinplngndficmialaminivrodat,cnucifac. Dacsntmplchestiaasta,posieiadio,dragule! Nossentmple! Puteasjure,sideacuvntul,dartiacaacevanarfivaloratnimic. Defapt,Bocincfuseseclar:puteasfaccevoia,attavremectAlisenuaveade suferit.iVirgilmaieracontientcintrndntrunaltmediu,trebuiasrenune la multe din vechiul su mod de a fi. Mai mult, era din ce n ce mai convins c meritasfacacestefort. Tatlsocrulmaiprivivreoctevasecunde,sseobinuiascprobabilcu figuraginerelui,apoilupaharuldewhisky,seridicizise: Haisfintruneasbun,miVirjil! Strieti,tatsocrule!SdeDumnezeu!seridiciVirgil. Ciocniriddurbuturapegt. Iavinostipup! Se mbriar i se srutar, apoi domnul Bocinc ncepu s rd, urmat deVirgil.Totulmersesebine.Ieirdinbirouinndusedegt.Aliseimamaei ateptaserterminareaconvorbiriicuinimastrns,ghemuitepeocanapea.Cnd ivzurpeceidoirzndmpreun,liseluopiatrdepesuflet.Aliseserepezi slmbriezepeVirgiliarmamasaseduselngsoulei,privinduipeceidoi cuochiinlcrimai,cantrotelenovelieftin. Stabilireadateinunii,ntlnireadintrecuscri,toateerauamnunte.Greul trecuse. Maiplvrgircutoiipnsentunec,Virgilfuinvitatsdoarmacolo, ca s nu conduc noaptea, iar diminea, cnd se trezi n patul curat din camera luminoasdelaetajulpalatului,zmbiigndicpentrubanimeritsfaciorice. Conduceadeoor,cndvzupeparteastngotutungerieiseoprisi iaigri.Intrnmagazin,cumprunpachet,ieiiiaprinseoigarcobornd nacelaitimpdepetrotuar,casajunglamain.NuobservMercedesulcare
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


trecu la doar jumtate demetru de eldect n ultima clip, suficient ns casi deaseamacgagicadelavolanerafoartebun.Sesimeanformndimineaa aia,aacsegndisitrageap. Selsuorpeasfalt,inndusedepiciorisimulndunaccident.Imediat auzi un scrnet de frne, gagica sri de la volan i fugi nspre el, verde la fa. Virgilncletdiniiiiartsuferina. uviestassana?1ngimea. umiaspektassana?Mesperaskeminerompislagambon!2 Sedminevolis!Minevidisvin!3 Vi ne vidis min? Vi nek vidis la signojn? Tiuj signoj estas tie por estu aganta la. Se vi volas rapidecon, veturu sur latostrado! Kiom da aoj okazas hodia! Oni ne povas plu aeti pakon de cigaredoj, ar oni transas la straton kaj estasmortata!4 Miurismin,nevidis5 Neniupluobeaslaleojn!Kiennialvenostiamaniere?6 Venu,mivinportosallahospitalo!7 Tnraserepezislajutesseridice,iarVirgilprofitpedeplindeajutor, spunnduiapoicnusngereazicredecnuarenimicrupt,darcoculafost foarteputernic. uvivolaskemiportuvinie?8 Vidiriskeviurasvin.9 Jes,mihavasintervjuonladekdunhoronporlaborposteno.10 Virgilsegndidacsarficuvenitsoconducpedomnioaracas,ca ungentlemanceera. Sedmineforlasosvintiei,kielhundon.Venukunmi,laintervjudaros irka duonon de horo, kaj se vi atendos min, ni povos trinki kafon poste. Mi aetos!11

Tesimibine?(esp.) Arteubine?Spercnumiamruptpiciorul!(esp.) 3Darnamvrut!Nuteamvzut!(esp.) 4 Numaivzut?Niciindicatoarelenuleaivzut?Semnelealeasuntacolocasfierespectate!Dac vrei vitez dute pe autostrad! Cte chestii se ntmpl n ziua de azi! Nu mai poate omul si cumpereunpachetdeigri,ctrecestradaieomort!(esp.) 5Mgrbeam,namvzut(esp.) 6Nimeninumairespectlegile!Undeosajungemaa?(esp.) 7Vino,teduclaspital!(esp.) 8Vreisteducundeva?(esp.) 9Aispusctegrbeti.(esp.) 10Da,amla12uninterviupentruoslujb.(esp.) 11 Dar nu te las aici, ca pe un cine. Vino cu mine, interviul dureaz cam jumtate de or i dac m atepi,dupaiaputeabeaocafea.Faceucinste!(esp.)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cumsrefuze?1 Dup, n timp ce fuma uitnduse n tavan, simi ceva ce nu mai simise niciodat.Simictrebuiessepotoleasc,sseaeze,cumsespune,lacasalui. Eradestuldedevreme,lanumai24deani,nsitrisedinplinviaa.Mottoul dup care se condusese fusese o cugetare, sau mai degrab un sfat, a unui vr ndeprtat,cuvreo5animaimaredectel,pecarevremeacndVirgilaveanc15 aniistteaulaobere,laoterasdinGalai.CugetareaeraCtetitnr,trebuie sbei,sfuiistedistrezi.icenseamnstedistrezi?Sbeiisfui.Virgili ddusedreptatedesutedeoripnatunci.Darncondiiilencareviitoruliera oarecum asigurat, se putea despri de vechiul su stil de via fr prea multe remucri.Alesese. Lactevalunidupcstorie,Virgileraaltfel.Aveanoiocupaii,noigriji inoiprieteni.Lanceputfusesestresatcucoala,dardupvreodousptmni se convinsese c la orice profesor merg banii, cadourile sau cunotinele care nu potfirefuzate.Acumsestrduiastragctmaimultefoloasedinnouasacalitate deconsilierpeproblemedetineretaldomnuluideputatBocinc. Deodat,ncepucampaniaelectoral.Trebuirssemutecutoiitemporar ncartierulmoldovenesc,casiadomnulBocinclegturacumasele.Sauinvers, nu mai tiu. Virgil descoperi c ies bani frumoi din ntlnirile cu alegtorii, organizareade spectacole n discotecii excursii pentru tinerii membri de partid. CcideputatulaparineaPartiduluiLiberalalNoiiEurope.nssarficomportat absolutlafeldacarfifostsocialist,socialdemocrat,ecologistsauoricealtceva. Cititorii interesai de viaa politic sar putea ntreba ce sa ntmplat cu doctrina cretindemocrat. Aceasta fusese interzis n mod democratic, deoarece sa considerat c de vreme ce 15% din europeni nu erau cretini, o asemenea denumirearputearnisensibilitateaminoritarilor. Alegerileseapropiau.ntrosear,tatlsocruichemginerelepentruo discuie important. Bocinc ncepu foarte calm: Ai vzut sondajli? Porcu di Lacea ari 40, dumnezii msii. ajungnd n scurt timp la concluzia c trebuia fcutceva,ctmairepede.Virgilaprob,ntrebnduselacesegndisesocrusu. Rspunsul era att de simplu, nct se njur c nui dduse i lui prin minte: s furevoturiledincircumscripialor.Eragreu,darnuimposibil.Banierausuficieni, problemaeractrebuiaussedescurcecuctmaipuinioameni,casnuseafle. Nu c ar fi avut cineva de suferit, dar n acest caz mai trebuiau bani ca s se muamalizezetotul.

Voceaautoruluicaresemirncprostetedeunelemoravuri,citnddinnou:Whilomwastthou vestal,yetnowflittothytryst(TheatreofTragedyFairandGuilingCopesmateDeath).Cititoriicarenu pricepacestcitatsuntinvitaisaprofundezelimbaluiexpir.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Bocincerareprezentantulacirca300000deceteni,distribuiila15secii de votare. Din cei 300000, cam jumtate mergeau la vot. Restul njurau din faa televizoarelorsauieeaulaobere,bgnduipicioarele. Bocinc avea n sondaje 35%, deci i mai erau necesare cam 10000 de voturi. Un calcul simplu arta c trebuia s fure voturi la dou secii de votare. efulpoliieidincartierulmoldovenesc(nuvgndiicumvalaGlavan,laeraun luzr),unbunprietendealsu,lsftuilacaresncerce. Trebuiau pltii cei doi preedini de comisie i oamenii lor, care s transmit alte rezultate la comisia central, poliitii care duceau urnele la sediul electoral central al cartierului romnesc (n cartierul bucuretean, cum altfel) i nitepersoanecaresseocupecufabricareaurneloribuletinelordevotfalseicu transportul lor. Pentru acest scop fusese aleas banda lui Prjan, poreclit Cap de mort. Cnd auzi de el, pe Virgil l trecu un fior. tia o grmad de legende desprebandaluiCapdemort.Sespuneacla16ani,nRomnia,Prjanucisese pentru prima dat, victima fiind un pui de igan care umbla pe la furat n zona controlat de el. n prezent, teritoriul gtii lui era mult mai mare, incluznd cartierul unde locuise Virgil. Se tia c Prjan se ocupa cu vnzarea de droguri, arme i maini furate. De asemenea, se mai tia c beneficia de protecia poliiei. AcumneleseVirgildece.nsnusemir,pentrucncdinRomniapoliiai mafiafuraumnnmn. Rolul biatului era s marcheze buletine de vot false, ntro proporie anumepentrufiecarecandidat. Odat ce Cap de mort le trimise buletinele albe, cei patru membri ai clanuluimuncirdingreuozintreag.Eraziuadinainteaalegerilor. Adouazidiminea,ntreagafamiliemerselavot,casdeaunexemplu alegtorilor,deipentruvalidareaalegerilornueranecesaroanumitprezenla urne. Se considerase c nu mai trebuiau cheltuii bani din cauza celor lipsii de spirit civic.Virgil vota pentru prima oar. i rndul trecut primise buletinul prin pot,darlaruncaselagunoi.Elfceapartedincategoriacareieealaobere Imediat dup, puse pachetul bucluca n portbagaj i porni spre cartierul generalalbandei.ideschisensuiCapdemort,mbrcatimpecabilivorbindui calmipoliticos.Eraunaceeaitabr.linvitlaocafea. Parcteammaivzut. Amlocuitaicincartier,lablocul402. A,da.Cunotiartelemariale,nu? Da, ieu snt la, ncerc s zmbeasc Virgil sub privirea de arpe a lui Prjan. miamintescclaibtutodatpeAlexandrescu.Cecenturai? Albastr. Da!aprobadmirativarpele.imaicontinuiantrenamentele?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nu,mamlsatdevreotreiani. Pcat. Dar ie de neles. Acum dac va ctiga domnul deputat Bocinc alegerile,poisipermiiunbadigardcucenturneagr,nu? Virgilrealizcarpeleibteajocdeel,nsstrnsedindiniitcu. Iasvedemvoturile. Deschisepachetulcugrij,apoizise: Tuaifostvreodatlavot? Hm,aziamfost. Dumnezeiipizdiicruciimtii,rupiaigtudecriminal! i ai vzut c atunci cnd omul i bag votul n urn, calculatorul nregistreaz lucrul sta. Deasupra urnei ieste afiat numrul celor care au votat. Aiobservat? Da,scrnidindiniVirgil. Laora6,numrulstaietransmisautomatlacentru.Deaceia,noitrebuie spregtimunnumrdevoturiegalcunumrulcelorcareauvotatcuadevrat. La ora 6 i 1 minut, preedinii de comisie ne vor comunica numrul de votani. Noitrebuiespregtimunnumregaldebuletinedevot,nproporiaasta. iintinseunbileelcuprocentajelepecaretrebuiausleobinceiapte candidai. idacvoturilesntamestecate,aacummiliaiadus,ctderepedecrezi c putem alege douzeci de mii de voturi? La ora 9, ne ntlnim cu poliitii s facemschimbdeurne. Numrareamergeaaaderepedepentrucbuletineledevoterauscanate i adunate pe calculator. Dup transmiterea rezultatelor, preedintele comisiei trebuia s le invalideze i s trimit datele false. La centru, voturile seciei respective urmau s fie renumrate. Desigur, urmau s fie numrate voturile trimisedeCapdemort. Virgil tcu. Se gndi de ce dracu Bocinc nui dduse pur i simplu lui Prjannumaiproporiiledorite,casseocupeacestademarcareabuletineloride distribuirealor. Trebuie s punem voturile n pachete de cte 100, separat pentru fiecare candidat,casnefieuordisear.iaiterminatcafeaua? Virgilotermin. Latreab.Lctuu,Voinea,ajutail! Ceidoizdrahonisririmediat.Virgilnjurngndiseapucsnumere buletinele de vot. Un alt mechera venea din cnd n cnd si impulsioneze: Hai,maicuvoin!,Cii,Voinea,nupreaivia,lascfutioopedalapoimai videmnoicinirdifrdin,lacareVoinearspundeainvariabilSugipula. Pelaora17terminar.La18:01primirnumereledevoturi.Pnla19,le mprir, le verificar de dou ori i le puser n urne. Prjan le sigil i apoi se ntoarsespreVirgil:
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Tupoispleci.SpuneidomnuluideputatBocinccnumrulcontului meuieacelai. Domnuldeputatctigcu43%idduopetreceremonstru,naintesse mute la loc n Cartierul Central. De asemenea, el promise alegtorilor s lupte pentrureprezentareaproporionalnParlament. Ccifiecreiadincelecampatruzecidefosteriireveneau10deputai, deiromniieraupatrumilioaneiarbelgieniiosutdemii.nsfotiloroccidentali nicinuletreceaprincapspermitromnilorsaib10%nParlament.Oricum, se prevedea o imigrare important din vestul Europei n urmtoarea legislatur, aacpeste5anicererearomniloraveatoateanselesfieaprobat.Probabilc atunciromniiarfifostnevoiisvotezempotriv,casipstrezemcarcele10 locuri. Dar5anieraoperioadattdelung!VirgiliAlisesesrutartandru. A treia ntmplare. n bloc cu Viorel i cu Marius se mut o familie de danezi.Gsircerentabilsideschidunmagazinncarierulmoldovenescile eramaiuorslocuiascaici.Familiaaveadoibiei,de18i20deani. Desigur, o lun ntreag fur subiectul preferat de brf al colocatarilor, dup care fur acceptai. Dac ar fi fcut probleme, li sar fi spus, cu siguran, Patilimamiivoastridiliftididanej,nseiivzurcutoiidetreabiunii colocatarincepurchiarssemndreasccstaunbloccunitedanezi. i lucrul sta nar trebui s mire pe nimeni, dac ne aducem aminte prerea lui Dimitrie Cantemir Moldavi duas virtutes habent: christiani sunt et hospitales.1 Revenindladanezi,eiveneaudinoraulEsbjerg,situatndistrictulRibe, care e la fel de important pentru un romn precum e oraul Piatra Neam din judeulNeampentruundanez.Lanceput,locuiserncartieruldanez,undei deschiseser un magazin de electronice. Dduser faliment n scurt timp, vnduser vila i cu banii rmai i cumpraser apartamentul de la bloc i se reprofilaser pe industria alimentar. i se pare c de data asta nimeriser bine, fiindc aveau produse suficient de ieftine ca s le mnnce locuitorii cartierului moldovenesc. VioreliMariussemprietenirdestulderepedecuThorvaldiJens,care autorului, inexplicabil, i sun ca Traian i Ion. Gheorghi nu prea i nghiea, pentrucipreafoarteciudatsfienevoitsvorbeascesperantontimpulliber, darnuaveacefaceisesacrificadedragulcelordoiprieteniailui.

Singurulscopalfrazeiacesteianlatinafostcaautorulsdeaceacititorilor.idaciarfipus mintea,arfispuschristianihospitalesque,cascrapedeciudiprofesoriidelatin.Defapt,omulazis aa:vroimsmrturisimcuratcnoi,nnravurilemoldovenilor,nafardecredinaceaadevrat iospeienugsimprealesnecevaceamputealuda.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cu prilejul acestui schimb cultural, la prima bere, Viorel nu ezit si satisfacocuriozitatemaiveche,aceeaanjurturilornesperanto. Cititorul sar putea ntreba, pe bun dreptate, cum de bieii notri, la 20 deani,nunvasernjurturile,mcardinfilme,dacnudincri.Aiciautorul trebuie fac o precizare: spre deosebire de sfritul secolului XX, cnd valoarea unui film se msura n fuckyous pe minut, n Nova Eropo se practica cenzura mpotriva scenelor excesiv de violente, inclusiv ca limbaj, precum i a celor pornografice. Unii mai ziceau c ar fi fost cenzurate i ideile incomode, antidemocratice,antisemiteirasiste,nspopulaianusepreasinchisea.Brbaii aveau sport i filme de aciune, femeile aveau telenovele iar tinerii aveau DarJens,carespreuimireamoldovenilor,seameisedupprimabere1,era dornicsiaratecunotinele: Fikuinmeansfuckyou,bugruinmeansfuckyouintheasswhatelse? forfikiufuckoff2 Patrinfikuloismotherfucker,interveniThorvald,putinfilaosonofabitch Midzuminissuckmydick. Fek!meansshit! Se vede treaba c Jens era cu verbele iar Thorvald cu substantivele. Probabilcudiverseimplicaiipsihologice.JenseraleuiThorvaldtaur. Well,Idontknowanymore.Hopeyouresatisfied!3ziseJens. Ofcourse,butIllhavetowritethemdownwhenwegethome.4 Sure,ifyouwantit5 WhataboutDanish?Whatcursesdoyouhave?6 Mariusinterveniexasperat: Mi,dicipulameanuvorbinsperantul,macarsnlegioceva?! Iamntrebatcumnjurindanez. Nosservmeansballsass,someonewhofuckseverythingupncepuJens, darnclipaaceeavenichelneriasvaddacmaivorceva,idupcemailuar un rnd, Viorel ezit si mai ntrebe, mai ales c danezii dintrodat nu se mai artaufoartedispuiscontinue. ns dup vreo zece secunde de tcere, cnd Thorvald ceru reciprocitate, ceitreiromniiuimircubogianjurturilormotenitedinmoistrmoi.
Cititorulfamiliarizatcustereotipurilescandinavesarputeaofusca:Cespuitu,fratelemeualb?! Recisuntsuedezii;daneziisuntbeivi!Autorulvreasdemonstrezedefaptcnutoiromniisunt hoi. 2Vateptaistraducchestiileastea? 3Eibine,altelenumaitiu.Spercetimulumit!(engl.) 4Normal,darostrebuiascslenotez,cndajungemacas.(engl.) 5Sigur,dacvrei(engl.) 6Darndanez?Cenjurturiavei?(engl.)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Apoifiecarepornisistoriseasc,nesperanto,totfeluldentmplriprin caretrecuse,uneleveseleiaralteleplinedenvminte. Cititorulsnusesuperecnuprimeteaicictevaexempleconcrete.Dac learfitiut,autorularfifostmaifericitipoatenuarmaifiscrisaceastpovestire. Restul conversaiei se meninu n zona cunoaterii reciproce, fr mare profunzimens,cci ceidoi fraiseartau incomodai de fiecare dat cndvreo ntrebareleatingeaviaapersonal.Cutoateastea,aflarcThorvaldestestudent lalitere,seciaesperanto,iarJenssepregteasnceapnseptembriestudiilede economielauncolegiu,pnatuncilucrndlamagazinulprinilor. i Viorel fusese admis la universitate. Dduse bacalaureatul i avusese o inspiraie genial s nvee mcar unele chestii generale. De data asta, examenul constasentruntestgril,lacarenuerapreauorscpii,fiindcacopereatoat materia.Cutoateastea,Vioreleraisteiluaseunpunctajbun.Dintoamntrebuia splecencartierulpolonez. Gheoghi era n vacan, Marius reuise s se angajeze tot la alimentara danezilor, aa c se putea spune c aveau toi motive s fie mulumii i pe deasupraaveauiogrmaddetimpliber. Alegerileparlamentaretrecurfrcaceitreislebagepreatarenseam. Daneziimerserlavot,darnicieinuseateptaulafoartemulte.Unevenimentmai interesant urma s fie alegerea primului ministru de ctre Parlament, dup 2 sptmni de la scrutin. Apropo, alegerile fuseser ctigate de socialdemocrai, pentruceraoperioaddecriz. Din partea socialdemocrailor candida o femeie iar din partea liberalilor unbrbat,opersonalitatebinecunoscutnNouaEurop,cciaveacreier,umori opregtiretemeinicneconomie.Prinurmare,rezultatulnuseputeatidinainte. Printre tinerii carterului moldovenesc, doamna Drte Eucken fu repede etichetatdrept Gaura,nu neaprat fiindc era femeie, ci pentru cavea ofa camurtiuntemperamentantipatic.Faptulcarfipututdeveniatreiadoamn defierdinistoriamodernaomenirii,dupMargaretHildaThatcheriMadeleine Albright nu nclzea pe nimeni n mod special.Gheorghi i Thorvald chiar se certarpetemaasta.Thorvaldspusese:icedacnuaratbine?Poatefacetreab bun!Gheorghinuselsasemaiprejos:Iamailasmcuargumentedeastea. Toate femeile nu sunt dect nite guri. S stea la crati i s fac copii, nu s candidezelaprimministru!Darnutegndeticunelemaiauicreier?ice mdoarepemine,doarnulefutncreier!Virgilputeafimndrudediscipolul su. Cu toate c ncepuse s se obinuiasc, Gheorghi tot mai punea cte o strmb,atuncicnderasingurcuVioreliMarius,laadresadanezilorcumcar fi ngmfai i reci sau c daneza e o limb imposibil, c mai mult cni dect vorbeti. i parc n adins, Viorel inu mori s nvee cteva cuvinte i expresii maifolosite.nschimb,ceidoifraiabandonaserdupbundimineaa.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cititorul sarputeantreba, mort de curiozitate(pe dracu!), dac nu va primiioporiedereplicinlimbadanez.Nuvaprimi.Forfatterensigterikkeat skrivenogetpdansk.Hanharsinebevggrunde.1 Cu o zi nainte de dezbaterea din Parlament, la un post central de televiziune avu loc o dezbatere ntre doamna Eucken i domnul Grvy. Dac n problemele legate de politica extern i environamental (he, he!) discuia se desfur civilizat, cnd veni vorba despre drepturile civile, candidatul liberal suferi o nfrngere zdrobitoare, opunnduse ntrun mod suficient i retrograd trecerii n grija statului a copiilor agresai verbal de prini, precum i liberei practiciazoofiliei.ntrunultimefortdisperat,elamintivalorilemoraleicatolice, fapt ce l descalific definitiv. A doua zi, chiar i colegii si liberali o votar pe doamnaEucken. Novusordoseclorum. Dei descurajate oficial, manifestrile religioase publice nu fuseser nc interzise,iarbisericile,moscheileisinagogilenufuseserncnchise.nchisenu prinvreodirectivdestat,cidinlipsdeadepi. Cuprilejulalegeriinouluiprimministru,bisericilecretineconsiderarc a venit momentul s treac n ofensiv, mpotriva degradrii morale a societii. Preoii primir dispoziie s mearg n misiune pe la casele enoriailor, si binecuvntezeislespunsmaitreacpelabisericinalteziledectdePati. CndGheorghideschiseuailvzupeprinteleGhermannsutani cucruceanmn,inimaisestrnsedemelancolieifurie. nRomnia,elmergealabisericnfiecareduminic,aafusesenvatde prini (Noi sntem pcto, macar s merji tu s ti roji saprinz o lumnari pentrusufletilinoastri).Ailuinupreaseomoraucumersullaslujb,iardecnd veniser n Noua Europ, nu mai mergeau deloc, cu excepia srbtorilor importante,cucruceroie.nsGheorghicontinuaseovremesvinlaliturghie, cciiplceacumslujeapreotulGherman. Acestaaveavreo55deani,nsprivireairmseselafeldeptrunztoare cantineree,nctcinesespovedeaaveaimpresiacprintelepoatesiciteasc nsufletoricepcat.Deasemenea,aveaofiredestuldepotrivitcelorsfinte.Eran stare s nu mnnce o zi ntreag ca s le dea ajutor sracilor, i avea untalent deosebit pentru predic. ns avea i el o boal: cerea s fie respectat. Pe ct de blnd era cnd credincioii dovedeau buncuviin, pe att se nfuria cnd i se preacetratatnecorespunztor. FurialuiGheorghiizvoradintrontmplarenefericit,nurmcuvreo patru ani, cnd, dup slujb i predic, printele i binecuvnta turma. Cnd i venirndulbiatului,preotullmiruiipeel,cuvorbeleAjutordelaDomnul,cel cea fcut Cerul i Pmntul, dup care i ntinse mna s io srute. Lucrul


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


diavolului, lui Gheorghi i veni n minte Di i si pup mna cu cari s terji la cur?i,fcnduicruce,trecumaideparte.Popeiattitrebui,lsbalttotul,se repeziiitraseunupercutcudreaptangurnecredinciosului,cuurareaSrut mna,oa!Dupcaresentoarselinititlabinecuvntare,povuinduienoriaii: Nufipgni,oaminibuni.Cinsticelisfinti.AjutordelaDomnul,Celceafcut CeruliPmntul. Gheorghil blestem o sptmn,ide atunci numai puse picioruln biseric.iacum,nfaaluifostuldumanzmbicubuntateizise: Cimaifaci,miGheorghi?Naimaitrecutpilamini!Aitisacas? naceaclip(Dupattavremi,maiaminteticummchiam!),furia dispruicusmereniebiatulrspunse: Srumna,printi!Intr,csacas. DiscuiacupreotulllmuripeGheorghicstareadelucruriexistentn NouaEuropnumaiputeasdureze. La o sptmn dup nvestirea primuluiministru, asociaiile homosexualilor i zoofililor plnuir un miting de susinere n Cartierul Central. Organizaiile cretine, sprijinite de inamicii socialdemocrailor, anunar pentru aceeaiziocontrademonstraie.Poliialumsurispeciale. Gheorghi depuse toate eforturile pentru ai convinge pe prietenii si s participelacontrademonstraie.VioreliMariusnupreavoiau,nupentrucarfi avutobieciimoralesauideologice,cipentruclisepreadestuldedeparteile eralene.LuiViorelchiariplceaumarurilehomosexualilor,fiindcaveaprilejul svadfemeigoale.nssentmplsviniceidoifraidanezicuaceeaiidee. Ei erau nverunai mpotriva poponarilor pentru c Jens avusese probleme cu ei. n cartierul danez, locuiser n apropierea unui bar pentru homosexuali. ntro noapte, cnd Jens se ntorcea acas, fu acostat de doi brbai solizi, mbrcai numai n piele neagr i bei pe deasupra. Dei Jens se zbtu, reuirsltrascpeostradmailturalnic.Darlaipetelesaleveniopatrulde poliie,carelespusecelordoisivaddetreab.Jensoterseimediat,nsmai avu timp s observe pe unul din poliiti fcndui cu ochiul unuia din homosexuali i apoi i auzi izbucnind n rs pe toi patru. De atunci, pentru el homosexualitateaeraechivalentcuviolul. Vzndcmajoritateavoiasmearg,VioreliMariusacceptariei,mai alescdaneziiseoferirsmeargcumainalor. Marius fcu imprudena si zic prietenei lui i ea ncepu si fac scandal.(Naivzutcgaborioadustiaacolo?Unditiduci?Vreistomoar perveriiia?)Singurulefectfucisefcuiluifric,darspusesecevaitrebuia sseindecuvnt. Plecar dimineaa la 5. mpreun cu ei mai voiau s mearg patru cunoscui,totcumaina.napropiereaCartieruluiCentral,autostradaerablocat de un baraj de poliie. Maina celor patru fu oprit din drum, pe motiv c nu
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


corespundea din punct de vedere tehnic. De fapt, se tia c motivul era numrul romnesc.Mainadanezilortrecufrprobleme.Totui,Viorelpropusesiasde pe autostrad cu prima ocazie, pentru c urmtorul filtru ar fi putut avea alt naionalitate. iaasertcireincartierulenglezesc.Surprizacaemaimarefucndse ntlnir din nou cu bieii de la bloc, care nu se descurajaser deloc de refuzul autoritilor. Se pare c romnul care se nscuse poet decedase cu mult timp n urmiacumputeafiadmiratfiulsu,romnulcaresedescurc.Cutoiincepur sfluierecndrealizarcoincidenaiapoiunuldinceipatruurl: Vinidupnoi,cavemhart! AacMariusiddurepedeunghiontluiThorvald: Postiruilin!1 Pesemne c bieii nvaser lecia, pentru c o luar pe nite strzi lturalnice,nctJensimprtiscepticismulfrateluisuprinctevapropoziii ndanez,iarGheorghinupierduprilejulsiscuipe: Maitai,ilab! Totui cu aceast ocazie putur s admire graffitiurile colegilor de generaie anglosaxoni. Pe lng desenele obscene, nostime sau suprarealiste, se gseaudiversetexte,destuldeinteresante.Erauoricummaibogatedectceledin cartierulmoldovenesc,careconstaunprincipaldinnumelepersoaneiiubitesaual organuluipreferat. Why hate them? Find their weekness!2 i sftuia cineva, fr si dea seama depropriaslbiciunenceeacepriveteortografia. Anarchyistruefreedom!3consideraaltul,careinsistadealtfeldoimetrimai ladreapta:Theywouldkillyoutoprotecttheirinterests.Doyouagree?4 Componenta religioas era i ea prezent. Deasupra unui nger verde stteascris:OnlyGodisalmighty.Onlyspiritiseternal.5 Unadinpuineleinscripiinesperantozicea:Larealaoestasportiujkiune povaskutimiikunlanarkotaoj.6 Maincolo,produciileintelectualeserreau,fiindnlocuitedenjurturii simbolurialegtilor.Totui,chestiaaiacudrogurileiaduceaaminteinexplicabil luidocudeniteversuripecarelevzuseacaspeunzid:Descrbameadevia eumamcamsturat/iastzidimineancapmammpucat. Darnscurttimpieirdinaceazondeprimantisetrezirdeodatn facuunindicatoranunndintrareanCartierulCentral.
Mergidupei!(esp.) Decesiurti?Gseteleslbiciunea!(engl.) 3Anarhiaeadevratalibertate!(engl.) 4Eitearucidecasiapereinteresele.Etideacord?(engl.) 5DoarDumnezeueatotputernic.Doarspiritulevenic.(engl.) 6Realitateaepentruceicarenusepotobinuicudrogurile.(esp.)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cu 500 de metri naintea pieei unde urmau s se desfoare cele dou mitinguri, fur obligai de poliie s coboare din maini i s mearg pe jos. Trebuir s declare la care din demonstraii voiau s participe i fur percheziionaiighidaictreuntuneldescutieri. Thorvald gsi de cuviin s le mulumeasc celor patru care i ndrumaser. O fcu ns n esperanto, iar Sorin, cel care le strigase si urmeze, zmbimaliiosizise: Cuplcer... intorcndusesprecamaraziisi,complet: ...altdatnumaicer!izbucnindnrs. Desigur,elcrezusecThorvalderavreunmecheracareivorbiseaaca s se bage n seam. Cnd afl c avea dea face cu un danez, i nc cu unul de treab,careidusesepeViorelipeceilalicumainasa,seplesnipestefrunteii zise: Sedvinekoleriis,ne?1 Rse,lmbriilsrutpeobraz,dintoatinima.Thorvaldsechinui szmbeasc,deimbriareanuifcusenicioplcere,iarJenssentrebdac naugreitcumvatabra. Ajunser. Agitaie. Vociferri. Erau vreo mie de oameni, nconjurai de poliiti. Deoarece se situau puin mai la deal, puteau foarte bine si vad pe ceilalidemonstrani,precumibalconulundeurmasaparprimulministru. Avur timp cam jumtate de or s priveasc n jur i s discute nfierbntai starea de lucruri. Romnii vorbeau romnete iar cei doi danezi stteaumailaoparteidiscutauntreei. Viorel se njur c nu luase un binoclu, pentru c putea zri destule lesbiene care i exprimau liber feminitatea (?!). Pe lng pancartele cu numele asociaiilor i gruprilor participante, se gseau i cteva mai deosebite. Un grup dezoofili,nparteadreapt,ineauolozincpecarescria:Miamasmiafio2.Nul de acuzativse necase probabilnacvariul petiorului. Oalta:Drte,nia amikino, bonancon!3 i aa mai departe. Chiar n centru, pe un podium, trei cupluri de homosexualiioficiaucstoria,srutnduselaurmnaplauzelecelordinjuri nhuiduielilecontrademonstranilor. Acetia aveau i ei propriile sloganuri: Dio estas kun ni!4, La perversoj iru 5, Ni volas doni moralan edukadon al la nia infanoj6, precum i o pancart ce o Teron! nchipuiapedoamnaEuckenntroscensadomasochistcuuncinebiped.
Darnuteaisuprat,nu?(esp.) miiubescpetele.(esp.) 3Drte,prietenanoastr,succes!(esp.) 4Dumnezeuestecunoi!(esp.) 5PerveriisplecepePmnt!(esp.) 6Vremsdmoeducaiemoralcopiilornotri.(esp.)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Annuitcptis? La ora stabilit, noul primministru i fcu apariia n faa oamenilor. Toat piaa url, jumtate cu bucurie, jumtate cu ur. Doamna privi prima jumtatectevasecundeculacriminochi,apoiziseemoionat: Dankegontialkevivenistiei!Miamasvin!1 Dupaplauzeleifluierturilederigoare,urmdiscursulateptat,ncare se promitea o politic social permisiv, continuarea luptei pentru drepturile minoritilordeoricefelincurajareademersurilorpentrulegalizareacstoriilor cuanimale. Jumtatea entuziasmat izbucni frenetic i atunci, impresionat, doamna DrteEuckenspuse: O,dio,mivolusestintagejo!2 Atunci ncepu nebunia. Homosexualii i manifestar simpatia n fel i chip. Inamicii lor reuir s sparg cordonul de scutieri i se repezir si ia la btaie. Litrul de vodc pe care l buser cei nou de cnd sosiser i fcu i de dataaceastadatoria.Luaideval,fugirieilalupt. Viorelobservunpoliistcucapulspartpejosinfcbastonulelectric de lng el. Jumtate de minut mai trziu se trezi fa n fa cu un homosexual furioscaresrilaelcupumnii.Viorelidduunbastonpestemn.Adversarulse strmbdedurereiselslapmnt.Viorelncepusideanspatecubastonul, pentruccellaltvoiseslomoareierahomosexual,pentrucmoldoveniierau dispreuii,pentrucelnsuierasrac,pentrucsedesprisedeMihaela,pentru cnucopiaselabacipentrucviitoruleraunrahat.naintesideaseama,doi poliitilpuserjosilzdrobircubocanciiibastoanele. Gheorghi simi c rzboiul sfnt a nceput. Dobor cu pumnii i picioarele vreo zece dumani i dumance i un scutier. Apoi observ retragerea celordinjur,pentrucveneaupesteeiefectiveproaspetedepoliiti.Fugiiella ntmplare, n direcia balconului. Primulministru o tersese imediat ce ncepuse scandalul.Acumprobabilzburactrereedinaoficial,undeurmascondamne intolerana ntrun interviu televizat. Aici prea o zon mai calm. ns deodat pesteelsenpustirpatrupersoane,treihomosexualinsliplovindcusetentrun brbatdevreo40deani.Seprbuircutoiiifurarestai. Marius fu dus de val n primul moment, dar i ddu repede seama c situaia era destul de grav ii fcu loc cu coatele i pumnii spre ieire. Muli asemeni lui venir dup el, dornici s se deprteze ct mai mult de zona de conflict. La un moment dat, i iei n fa un brbat ras n cap i cu o svastic n urecheadreapt,careipuseomnngtiurl: Kiencekkuras,timemulapio?1
1 2

Vmulumescmultcaivenitaici!Viubesc!(esp.) O,doamne,avreasfifostgay!(esp.)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Marius i trase un pumn n ochi cu toat puterea, dup care l clc n picioare,lafelcaiceicareveneaudinurm.nsmaiapucsauddinspate: Ciestasmorta!2 Intrnpanic.Dinfericire,ajunselapoliitiicarelescortarlavreosut de metri de pia i apoi se ntoarser, lsndul singur. Avea totui impresia c nazistul vine dup el i fugi spre locul unde i lsaser mainile. Vzu numai maina danezilor. Sparse geamul, intr, se chinui puin cu o srm s porneasc motorul, dup cum nvase n cartier, i reui. Avea acum obsesia c poliitii l urmreaucumainilelorelectromagneticezburtoarepentrucfurase. Jens senfierbnt repede. Voia s leo plteasc poponarilor. Gsi pe jos unpardelaopancartruptiserepezinainte.Ddupestecivaoamenilovind cupicioarelentropersoanczutpejos.Eracufaalapmntinuiputeada seamadacerabrbatsaufemeie.Aveaprulrocattunsscurt.Jensseapropieio lovi brusc cu parul n ceaf. Nu afl niciodat c lovitura aceea fusese fatal. n acelai moment se simi apucat de umr. nainte s dea, se uit i l vzu pe Thorvald,plindesngepefa.Acestavoisespleceimediatcencepusebtaia, nslvzusepefratelesufugindcuparulilnjurasectpentrutoatviaa,dar degeaba.Aacvenisedupel,strduindusesnulpiarddinochi.Ofemeiei srise nainte il zgriase pe fa. Thorvald i dduse o palm i o trntise la pmnt.lajunsepeJensiltrasedupel.Cuchiucuvai,ajutaidepoliiti,ieir dinpia.Fugirspremain,darajunsertocmailatimpcaslvadpeMarius ndeprtnduse.Urlardeciud,apoiseaezarpetrotuar,icurarrnilei apoisendreptarspreceamaiapropiatstaiedetren.Pedeasuprasemaivedeau trecndechipajedepoliie. Primii ajunser acas danezii. Se duser la u la Marius, dar mama sa, alblafa,lespusecnusosisenc. Veni abia a doua zi spre sear, mbrcat doar maieu i chiloi, plin de vntiisnge,cucapulspart,cumnadreaptiocoastrupte. Nu se orienta prea bine n locuri strine. i fusese fric s intre pe autostrad, aa c urmri indicatoarele prin diverse cartiere, pn cnd vzu cu uurare unul pe care scria Cartierul romnesc. Se consider norocos c nul prinsesepoliia.Sennoptaseielconduceadejarelaxat,gndindusecascpati dedataasta.Cndidduseamacseafladefaptncartierulignesc,eraprea trziu. La 50 de metri n fa se ivir cinci persoane cu bte. n loc s ntoarc imediat,Mariusipusecapulpevolaniacceler,cugndstreacpesteei.Din pcate,mainasesizobstacolul,opribrusc,airbagulseumflilimobiliz. iganii oricum voiau sl jefuiasc. Acum mai tiau i c pramatia de danezvoisesiomoare.Unbiatdevreo16aniseapropieillovicubtancap.
1 2

Undefugi,pizdla?(esp.) Etimort!(esp.)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Marius i pierdu cunotina. Se trezi dimineaa urmtoare. iganii l btuser cruntiifurasertotmaina,banii,hainele,pnioseteledinpicioare.njurul su,petrotuar,erauurmedesngeitotcorpulldurea.Segndicugroazciar vaajungenspital,lamnamcelarilor.nminteasa,ntredoctoriiiganiicarel btusernueraniciodiferen.Voiasivadmoripetoi.Slescoatochiicu mnalui,sletaieminileisideahranlacini. Nuseputearidicasingurnpicioare.Noroculluifuoigancnsrcinat, caresegndiprobabilsfacofaptbun,casaibnorocnviacopilul.Eal pusepepicioareildusepnlaprimastaiedetren,undesecertcucontrolorii casllasesurcepeMarius.Acestaimulumi,iurbaft,darprivindtotuin ochiieioarecumnepstori,ticourtedemoarte,peeaipeceicaea,petoi. Cci toi erau mpotriv. i n acelai timp mai tia c fusese ct se poate de norocos. Muli fuseser ucii n asemenea mprejurri. El fusese lsat n via, s ducuramaideparte. Daneziiipltirspitalizarea,dupcareMariusmunciunanfrplat,cu normdubllamagazinullor,casiachitedatoriile.Dupaceeafuconcediat. Gheorghi scp. Cu trecutul su putea fi condamnat uor la 10 ani de nchisoare,maialescloviseiunpoliist.nsanchetatoriiseconvinserimediat cbiatulfuseseprinslamijlocfrvoialui.Niciceitreiagresori,nicivictimanul vzusernviaalor;nueraunicimcarromni.iapoieraclarcGheorghinu lovisepenimenidinceipatru.Biatulfueliberat,victimaprimingrijirimedicale pltitedestatiarceitreihomosexualifuramendai. Viorel fu acuzat de vtmare corporal i de uciderea unui poliist. Se presupunea c lar fi omort sprgndui capul cu un pietroi, apoi i furase bastonul i iar fi continuat activitile violente pn cnd doi poliiti lar fi imobilizat.Pedeasupra,maiopuseseirezistenlaarestare. Dnduiseamacsituaiaeradeosebitdegrav,elisftuipriniisse ducsvorbeasccuVirgil.Acesta,spredeosebirededatatrecut,sestrduisl scape.Vorbicusocrusu,acestaseinteresiaflcautoritilevoiausdeaun exemplu n cazul acesta, precum i n alte vreo douzeci. Confruntrile se soldasercu9morii37dernii. Procesele se desfurau n Cartierul Central i fur intens mediatizate. Virgil ncerc sl mituiasc pe judector, dar acesta refuz, nu pentru c nar fi avutcefacecubanii,cipentrucprimiseordindelasuperiorisfienecrutorcu violenaoarbizvortdinintoleranaprimitiv. AacViorelfucondamnatla20deaninchisoare.Fudusnnchisoarea din cartierul olandez, unde gardienii avur grij s se spun deinuilor homosexualidececrimesefceavinovatromnul,casfiepedepsitncontinuare, violat,btutiumilit. Att.Cititorulsnusesuperedacnuprimeteinformaiidespredestinele viitoarealeeroilor.Autorulnulecunoatesaunuconsideracestlucruimportant
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


pentruatingereascopuluiacesteipovestiri.Fiecareestelibersiimaginezeorice, attatimpctaremuchi,baniicreier,sauctepuindinfiecare. SneridicmpuinprivireaspredestinulNoiiEurope.inuvommerge n sala parlamentului, nici n cabinetele minitrilor i nici mcar n dormitorul primuluiministru,cintrocasdecent,situatspreperiferiaCartieruluiCentral, carenusedeosebeaprinnimicdevecinelesale. Cele12persoaneprezenteconvenirrepedeslasedeopartepoliteurilei introducerile,istreacdirectlasubiect,ntructlucrurileerauextremdegrave. Trebuiausdezbatraportulasuprarelaiiloroamenilorcukndraaliiisdecid cursulviitoralpoliticiiomeniriiiNoiiEurope. Cercetrile kndraalilor asupra celor rpii de pe Pmnt duseser la o descoperire epocal: substanele chimice coninute de creierul uman puteau fi folosite ca vaccin mpotriva unei boli necrutoare ce afecta aproape trei sferturi din populaia lor, dup o anumit vrst. Dac aceast boal era eradicat, sperana de via putea crete de la 200 la 270 de ani. Cei 400 de milioane de oameni trimii extrateretrilor fuseser folosii n acest scop. Cel mai important avantajeracobinereavaccinuluinunecesitaoperaiicomplexe.Fiecruiomise tiacapul,acestaeraintrodusntrunfeldemixer,iarzeamarezultatiseddea kndraalului suspect de boal (adic mai btrn de 180 de ani). Informaiile mai spuneauczeamaeraconsideratifoartebunlagust.Restulcorpurilorfuseser trimisepentruconsumulalimentar,iarcarneadeomdeveniseodelicatesdestul deapreciat. Kndraalii pretinseser un tribut periodic de fiine umane, n schimbul tehnologiilor oferite omenirii, iar acest tratat fusese respectat pn n prezent. Problemaerac,nciudaniveluluidedezvoltarealsocietiilor,extrateretriinu acceptau sub nici o form vreun medicament sau aliment fabricat sintetic. Totul trebuiasfte(sausfifostvreodat)viu.ncdelanceput,oameniiseoferisers cerceteze obinerea artificial a substanei respective, dar kndraalii refuzaser. Pentru ei era mai simplu aa. Atunci oamenii le trimiseser maimue, dar tratamentul, dei ddea pn la urm rezultate, era mai de lung durat i kndraaliirefuzaser.Pentrueieramaisimpluaa.Posibilitateaunuirzboifusese ieaexaminat,nsanselenoastredeactigaeraunule.i,nplus,dezvoltarea civilizaieiterestrefcuseunpasattdemare,nctceicareseocupaudeafacerile pmntenilorrefuzaser.Pentrueieramaisimpluaa. i totui tributul n oameni era inacceptabil din punct de vedere al ideologiei politice contemporane. Deocamdat se rezolvase problema suprapopulrii,darnviitorerainadmisibilideeacapmnteniisfietrataicao grmaddecobai.Savaniisaugnditatuncicosoluiearputeafiinterveniala nivelgenetic.Eventualscreezeunviruscareslereparesauslemodificegenele vinovate de mbolnvire. Desigur, de data aceasta kndraalii nu mai trebuiau
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


anunai. ntrun viitor mai ndeprtat, se impunea desigur exterminarea rasei kndraa. Era imperativ deci strngerea fondurilor necesare unei cercetri de o asemenea anvergur. Cei 12 ajunser la concluzia c banii nu puteau fi adunai dect prin declanarea unui rzboi i vnzarea de armament. Totodat, se va urmri ca pierderile umane s fie reduse la strictul necesar, ns tensiunea psihologicsfiesuficientdemarepentrucatoatestateleputernicesipunn joc tehnologiile secrete, astfel nct s se poat alege cei mai capabili cercettori. Cumaltreilearzboimondialnumaiavuseseloc,dupcumfuseseplnuit,acest nourzboierasinguraansdeprogres. Rmnea de stabilit zona de desfurare i combatanii. Cei 12 convenir ca Terra s nu fie afectat, deoarece n cazul distrugerii accidentale a planetei, celelaltecoloniieraumultpreaslabepentruafacefaunuieventualatackndraa. NovaEuropopreaunparticipantideal.Pnacum,aceastcoloniefusese scena a nenumrate acte de violen i ur intergrupuri, datorit diferenelor etnice i politicii de discriminare a majoritii n favoarea minoritilor sexuale i religioase. Pn n prezent, aceast politic fusese potrivit pentru meninerea controluluiasupramajoritii,nsacumseimpuneaumsurinoi,pentruacoaliza ntreagapopulaiempotrivaunuidumanexterncomun. Pentrualegereaacestuiduman,seridicarmaimultepropuneri.Varianta C fu abandonat, deoarece resentimentele fa de rui erau nc prezente, iar reconciliereapostbelicarfifostmaidificil.nplus,sursadevenituridelamafia ruseasc era una destul de important. Acolo lucrurile trebuiau s continue ca n prezent. Planetelechinezilor,Rch1iPnghng2,erauosursdepopulaiepentru extrateretri,deocamdat.Natalitatealortrebuiancurajat.Maimult,chineziinu ar fi acceptat o mpcare rapid dup terminarea conflictului i ar fi cutat rzbunare ntrun viitor nedeterminat, tocmai atunci cnd ar fi fost nevoie mai maredeunitate. Rmneavariantaamerican.SUAaveaumaimultebazemilitarespaiale. Atacarea uneia nu ar fi nsemnat rzboi cu americanii, ci cu o faciune rebel. Rzboiul ar ft rezolvat i ostilitatea crescut a europenilor fa de controlul americanilor, n cazul unei victorii europene. Reconcilierea de dup rzboi ar fi suficientdesimpl,ntructcombataniiarfiavutaceleairdciniculturale. Pretextul putea fi gsit repede. Ca de obicei drepturile omului. Dorte Eucken, care reprezenta interesele SUA i ale Israelului, urma s fie nlturat datorit unui scandal de corupie. Apoi guvernarea socialdemocrat va fi nlturat prin for i puterea va fi preluat de dreapta cretin. Aceasta va
1 2

Rsritul(chin.) Echilibrul(chin.)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


rezolva i problema din ce n ce mai stresant a corupiei instituiilor de stat. Americanii de pe Hope1 vor ataca primii, i apoi va ncepe propaganda pro tradiional i antiamerican. Bazele militare din sudul continentului vor fi echipatepnlasfritulanuluicul00denavecapabiledeluptnspaiulcosmic. Vor putea fi obinute fonduri destul de mari i din televizarea primului rzboi spaialdinistoriaomenirii.Celelaltemariputerivorfiobligatessusinmilitaro parte sau alta, dei se vor declara neutre. Cercetrile vor demara imediat, iar conflictulvafimeninutattatimpctvafinecesarpentrualefinana. Acest plan fu aprobat de cei 12, care se simir fericii pentru cteva minute. i autorul, terminnd aceast povestire, pentru cteva clipe, va fi fericit. Merit? (februarie1998decembrie1999;20.9222.75)


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Astrologia natal

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Munus aut tentatio astrologia est. Cuiusque primum officium est experiri se cognoscat, suas potentias maciesque detegat et suum mandatum super terram patret. Alterius cognitio intellegere aut dominatio, congregare aut solitudo significat. Scientia ad astra aut ad paludes te ferre potest. Sapienter eam utere. Etiamsi hic initium, gradus aut superatum stadium est, angulus stellelucetoinclumversus! Astrologia este dar sau ispit. Datoria dinti a fiecruia este s ncerce s se cunoasc, si descopere puterile i slbiciunile i si mplineasc menirea pe pmnt. Cunoaterea celuilalt nseamn nelegere sau stpnire, unire sau singurtate. tiina te poate purta spre stele sau spre mlatini. Foloseteo cu nelepciune. Indiferentdacacestaesteunnceput,unpassauoetap depit,fiecavrfulsteleisstrluceascctrecer!

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nmomentuldefa,autorulconsiderastrologiaocoleciedeaberaiipericuloase. 1. n capitolul II, Luminariile, au fost incluse de asemenea Lilith i Nodul Nord, deoarece acestea sunt elemente ale orbitei Lunii (cellalt focar, diferit de Pmnt,respectivinterseciaplanuluiorbiteilunarecuplanuleclipticii).Luminarii (lumintori)suntdoarSoareleiLuna. 2.ncapitolulIII,Planeteleinterpersonale,afostinclusiChiron,deiacesta nuesteoplanet,ciunasteroiddintreSaturniUranus.Elseafllagraniadintre sistemulsolartradiionaliplanetelenoudescoperite,iaruniiastrologimodernii atribuie rolul de guvernator al constelaiei Ophiucus (erparul, Omortorul de erpi),consideratcasituataproximativntre25C5V 1. 3. Calculul caselor cerului i al axelor auxiliare. Valorile din tabele sunt date pentruIai(4710Ni2735E),oradeiarn(GMT+2).Fietabelul: 1 2 3 4 5 6 7 8 9 10 11 12 0 31 59 90 120 151 181 212 243 273 304 334 0 31 60 91 121 152 182 213 244 274 305 335 Primaliniereprezintnumrulluniidenatere,adouavalorilepentruun annormaliaratreiapentruunanbisect. Se adun ziua naterii cu valoarea corespunztoare numrului lunii de natere, iar rezultatul se nmulete cu 3,9425. Apoi se adun 386 i ora naterii, transformatnminute.Acestrezultatsempartecurestla60,obinnduseorade cutatntabele(dacoraemaimareca24,sescadedinea24). Dinpunctdevedereastronomic,aceastpoziionareestegreit.ConstelaiaOphiucussentinde ntre2172944S,suprapunnduseaproapeperfect,nceeaceprivetelongitudinile,cuconstelaia Scorpionului, care se gsete ntre 233 2844S. Faptul c o constelaie se afl practic pe teritoriul zodiei urmtoare se datoreaz fenomenului de precesie, adic deplasarea punctului vernal n sens retrograd cu aproximativ 50/an. De acum 2000 de ani, cnd sau stabilit corespondenele ntre constelaiiizodiileconvenionale,ipnnprezent,punctulvernalsadeplasatcuaproximativ30. Avnd n vedere c Vrstorul ncepe la 1142V (steaua Albali), iar Capricornul se termin la 2332V (Deneb Algedi), o constelaie mai potrivit pentru Chiron ar fi fost Equuleus, cu o ntindere foartemicnjurulsteleiKitalpha(2306V).

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Exemplu:10martie1997,ora6:42. (10+59)3,9425+386+(660+42)1060 1060/60=17:40 Cuspidelecaselorvorfi: II III











21P 9T

Vertexulvafi:27;FiarPunctulEst:28;P. 4. Calculul longitudinilor planetare geocentrice. Dup cum vei constata probabil din grafice, drumul planetelor poate fi aproximat cu o succesiune de sinusoideidrepte,totulfcnduse,desigur,modulo360. Soarele, Luna i Lilith evolueaz aproape liniar (sau, dac vrei, au sinusoide de perioad nul). Graficul Nodului Nord, tot liniar, arat valoarea sa medie,ntimpceefemeridelesuntdatepentruvaloareaadevrat. Considerm 2 retrogradri succesive. Notm d1, d2 zilele corespunztoare intrrii i ieirii din retrogradare (conform tabelului de la punctul 3) i p1,p2poziiileplaneteinacestedouzile.Analogpentruretrogradareaurmtoare: d1,d2,p1,p2.Fie: d d 3 d1 d2 d0 = d1 2 1 = 2 2 d d 3 d2 d1 d3 = d2 + 2 1 = 2 2 p + p2 p0 = p 3 = 1 2 ianalog:d0,d3,p0,p3. Pentruaflareauneipoziiidepesinusoid(odatdntred0d3),seaplic formula: p p d d0 ps (d) = p0 + 1 2 sin . 2 d2 d1 Pentruopoziiedepedreapt(odatdntred3d0),seaplicformula:

pl ( d ) = p 3 +

p0 p3 (d d3 ) . d0 d3

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Exemple: a) Ceres,10martie1977. R:7.02,1037B D:10.05,2729F d1=38;p1=190,62;d2=130;p2=177,48

d0 = 3 38 130 = 8 (23.12.1976) 2 3 130 38 = 176 (25.06.1977) 2 190 ,62 + 177 ,48 = 184 ,05 (403B) 2

d3 =

p0 = p 3 =

d = 10 + 59 = 69

ps (69) = 184 ,05 + 190 ,62 177 ,48 69 + 8 sin = 187 ,27 = 716B. 2 130 38

Valoarearealeste:715B. Cafaptdivers,iatvalorileaproximativepentructevafunciisinusoidale planetare: ps(e)=p0+6,48 sin d 24

ps(v)=p0+8,15 sin
ps(j)=p0+5 sin

42 ,1


d d

ps(t)=p0+3,5 sin ps(u)=p0+2 sin



d d ,

ps(n)=p0+1,5 sin


unde d = d d0 .

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


b) Iuno,17aprilie1979

R1:3.06.1978,843V D1:15.09.1978,2326C R2:2.12.1979,2904R D2:22.02.1980,1611R d1=154365=211;p1=308,72 d2=258365=107;p2=293,43 d0=263(12.04.1978);d3=55(6.11.1978) p0=p3=301,08(105V) d1=336;p1=119,07;d2=418;p2=106,18 d0=295;d3=459;p0=p3=112,63 d=107 pl(107)=301,08+

(112 ,63 + 360) 301,0 (107 + 55) =380,48=20,48=2029E. 295 + 55

Oaltmetodestefolosireavalorilorintermediare: 19.03.19790E 13.05.19790T z1=78p1=0 z2=133p2=30 z=107p=?

p2 p1 ( z z1 ) z2 z1 30 0 (107 78) =15,82=1549E. p= 0 + 133 78


Valoarearealeste:1534E. Pentru zilele aflate n apropierea perioadelor de retrogradare este mai precis metoda sinusoide+drepte, iar pentru zilele de tranzit direct rapid este preferabilmetodavalorilorintermediare.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


5. Doar ca s fiu cu inima mpcat, iat simbolurile folosite: Berbec (Aries,E), Taur (Taurus,T), Gemeni (Gemini,G), Rac (Cancer,R), Leu (Leo,L), Fecioar(Virgo,F),Balan(Libra,B),Scorpion(Scorpio,N),Sgettor(Sagittarius,S), Capricorn (Capricornus,C), Vrstor (Aquarius,V), Peti (Pisces,P), Soarele (s), Luna (l), Mercur (e), Venus (v), Marte (m), Jupiter (j), Saturn (t), Uranus (u), Neptun (n), Pluto (p), Lilith (h), Nodul Nord (y), Vesta (f), Palas (q), Iuno (i), Ceres(c),Higeia(g),Astreea(a),Chiron(k). 6. n interpretrile planetelor sunt marcate zodiile de domiciliu, exaltare, cdereiexil.AcestsistemderelaiinuafostdefinitncazulluiLilithiaNodului Nord, deoarece sa considerat c acestea, fiind prin excelen indicatori karmici, afecteaznegalmsursectoarelepecareletranziteaz.



Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Ascendentul(Ascendant)estecheiadescopeririidesine.Nespunecumne exprimmcaindivizi.Nueattidentitatea,ctmodulcumalegemsneexprimm aceast identitate. Cu ctnaintm n vrst, cuatt tindem s ne exprimmprin calitile Ascendentului. Descrie personalitatea i caracterul, precum i legturile culumea. Interpretri: Berbec: Viaa e vzut ca o provocare. Modul dumneavoastr de auto exprimare este activ, spontan i hotrt i cutai autonomie i libertate de expresie. Taur:Organizarea,stabilitateaincredereavordevenipietreleunghiulare alevieiidumneavoastr.Moduldeautoexprimareestesenzualipractic. Gemeni: Viaa e ntmpinat cu curiozitate. Comunicarea va deveni vital n viaa dumneavoastr i vei dezvolta o puternic dorin de cunoatere i exprimare. Rac: Grija pentru alii v furnizeaz cheia modului de autoexprimare. Viaapoatefintmpinatdeasemeneacuputernicesentimenteinteriorizateicu oatenietenacepentrufamilieitradiie. Leu: Viaa e vzut ca un mare proiect creativ. Imaginea pe care o proiectaieputernic,cald,optimistientuziast.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Fecioar: Ordinea i precizia sunt modurile dumneavoastr preferate de autoexprimare.Veidezvoltaoputernicnaturcriticiodorindeperfeciune. Balan:Moduldumneavoastrdeabordareavieiiestedreptiechilibrat, lundnconsideraiegndurileisentimentelecelorlali.Armoniaesteimportant pentrudumneavoastr. Scorpion: Viaa e vzut ca o lupt n care apar adesea triumful i nfrngerea.Intensitateaestemodulcheiedeautoexprimare. Sgettor: Viaa e ntmpinat cu entuziasm i idealism. E vzut ca o aventurcontinucumulteleciicaptivante. Capricorn:Responsabilitateairezervaaparadeseacamodurinaturalede autoexprimare.Viaaentmpinatcuprecauieiplanuriprudente.Ceilalivar puteavedeacaexcesivdeserios. Vrstor: Modul dumneavoastr de abordare a vieii este sociabil i neconvenional,originaliobiectiv.Vedeiviaadintroposturintelectual. Peti: Avei capacitatea de a v comporta ca o oglind pentru ceilali i puteimprumutapersonalitateaceluipecarelidolatrizai.Ceilalivvorvedea dezinteresat,dispuslasacrificiiiinspirndcompasiune. 1.1.2.CuspidacaseiII


Berbec: Apreciai libertatea i independena. Aceasta este reflectat de asemeneanmanieraspontanncarecheltuiiicptaibaniibunuripersonale.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Taur: Abordai banii n mod practic, apreciind att sigurana, ct i confortulpecarelofer.Preuiincredereaisenzualitatea. Gemeni:Sunteiplindeideidesprecumsefacbanii.Trebuiesfiiatentla tendina de a lsa banii s vi se scurg printre degete. V apreciai inteligena i capacitateadeagndiivorbirepede. Rac: V place sadunaii s pstrai banii bunuri pentru a vsimi n siguran.Vapreciaipentrugrijapecareopurtaialtora. Leu: Suntei mndru de banii pe care i ctigai i de bunurile dumneavoastr.Vapreciaitalentelecreative. Fecioar: Suntei pretenios cu privire la banii i bunurile dumneavoastr. Vplacesvsporiiposesiunilematerialentromaniersistematic.Vapreciai capacitateadeafiatentladetalii. Balan: V place s v rmn bani albi pentru zile negre. De asemenea apreciaibunurilefrumoase.Vpreuiicapacitateadeacooperainegocia. Scorpion: Avei sentimente puternice cu privire la bani i bunuri. Putei invidianoroculaltora.Vapreciaiardoarea. Sgettor: Avei simul abundenei cnd se ajunge la probleme financiare. Puteifideasemeneauncheltuitor.Vapreciaicapacitateadeavedeaimaginea deansamblu. Capricorn:Aveioabordareconstantipracticasupractigriibanilor. Vmndriicuautodisciplinainelepciunea. Vrstor: Banii i bunurile sunt lucruri imprevizibile n viaa dumneavoastr.Vapreciaiindividualitateaioriginalitatea. Peti:Sarputeasvsimiincurcatdeproblemelefinanciareisavei dificultinaducelucrurilelabunsfrit.Vapreciaisimuldecompasiune. 1.1.3.CuspidacaseiIII Interpretri: Berbec:Sunteiunvorbitorager.Sunteimaibunnalansaideiiainiia discuiidectnaurmantocmaireeteprestabilite. Taur: Avei o abordare practic asupra comunicrii. Totui, putei deveni ncpnatdacaliincearcsvimpunideinoi. Gemeni:Sunteiunvorbitorpriceput.Aveidaruldeavimpunepunctul devederendiscuii.Vplacestudiul. Rac: V place s v mprtii sentimentele i gndurile n discuiile cu ceilali.Sunteiintuitiv. 155
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Leu: V place o poveste frumoas i deseori luai rolul de povestitor. Aceasta deoarece suntei un vorbitor entuziast. De asemenea este posibil s fii mndrudefraiisurori. Fecioar: Suntei precis i econom n comunicare. Avei tendina de ai corectapeceicarevorbesc. Balan:Aveicalitateannscutdealucrancolectiv.Puteivedeamulte laturialeuneiproblemeiputeiaduceunrezultatunrezultatechilibratcudarul dumneavoastrdeadiscutaneprtinitor. Scorpion: Suntei un vorbitor receptiv i incisiv. Avei capacitatea de a v concentrabineatenia. Sgettor: Suntei un vorbitor entuziast i v place s nvai. Avei capacitateasiinspiraipealiiprindiscursurisauscrieri. Capricorn:Sunteipragmatic.Aveinelepciuneadeaticndsvorbiii cndnu.Sarputeasvcredeiunvorbitorsuperior. Vrstor: Avei multe idei pasionante i imprevizibile. Suntei interesat s studiaisubiecteneobinuite.Sarputeasncercailicrirideintuiie. Peti: Sar putea s fii imprecis n comunicare. Avei o fantezie vie i ai puteafiunscriitortalentat.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Fundul Cerului (Immum Cli) semnific ncheierea unui ciclu evolutiv i nceperea, ntrun alt cadru, al altui ciclu evolutiv imediat superior. Reprezint relaiilefamilialeiviaacasnic.


Berbec:Tindeisfiiindependentdefamilieimediusocial,prefernds vdescurcaisingur. Taur: Suntei un membru de familie responsabil i de ncredere. Preuii casa i familia, mai ales tradiiile de familie. Casa dumneavoastr var putea reflectanaturapracticisenzual. Gemeni: V place s vorbii i s schimbai idei cu membrii familiei, dar deseorivsimiiagitatcndsunteiacassaucufamilia.Sarputeasvtreziicu doucmine. Rac: Familia dumneavoastr este important. Avei nevoie s simii c aparinei familiei. Tradiia e de asemenea important pentru dumneavoastr. n copilriesarputeasvfisimitocrotitnmediulfamilial. Leu: Suntei mndru de casa i familia dumneavoastr. V place s fii centrulatenieinmediuldumneavoastrfamilial. Fecioar: Vrei ca familia i casa dumneavoastr s fie curate i ordonate. Membrii familiei var putea descrie drept prea grijuliu. Sar putea s fii de
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


asemeneacriticcufamilia. Balan: Preferai un mediu familial calm i armonios. De asemenea v place o cas decorat artistic. Sar putea s fii mpciuitorul din familia dumneavoastr. Scorpion:Aveisentimenteputernicefadecasifamilie.Sarputeasfi ncercatemoiiintensencopilrie.Dreptrezultat,sarputeasfiidiscretcaadult cuprivirelapropriaviafamilial. Sgettor:Vplacesvdiscutaifilosofiadeviacufamilia.Sarputeas fi cltorit cu familia n copilrie. Casa familiei dumneavoastr ar putea fi spaioas. Capricorn: Avei o mare atenie pentru tradiiile familiei. Suntei un membru de familie practic i de ncredere. n copilrie sar putea s v fi simit frnat de familia dumneavoastr. Ca adult, sar putea s devenii un sprijin de ndejdepentruceilalimembriaifamiliei. Vrstor: Viaa dumneavoastr familial e activ i imprevizibil. Sar puteasfiexistatschimbrimajorenviaadumneavoastrfamilialncopilrie. Peti: Avei o viziune idilic asupra familiei. Sar putea s nu vedei membrii familiei aa cum sunt ntradevr. Unul din prini sar putea s fi fost absentsaubolnavncopilriadumneavoastr.Totui,caadult,vamintiinumai momentelefrumoase.Sarputeasncercaisrecreaioviafamilialidilic. 1.1.5.CuspidacaseiV

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Berbec:Iubiispontaneitateaijocurilenoi.Deasemeneavplacproiectele noiicreative,deseorilansndulechiardumneavoastr. Taur: Apreciai plcerile senzuale n via orice distracie care implic satisfaciefizic.Sarputeasvplacscntai. Gemeni:Sunteiunmecher.Vplacesvjucai,nspecialjocuricarev amuzminteadumneavoastrrapid. Rac:Iubiicopiiiiiprotejai.Vplacesjucaimaidegrabjocuridelicate dectdure.Activitiprecumgtitulsarputeadeasemeneasvdistreze. Leu:ndrgiidistraciileiidilele.Vplacesvjucaiiaveimulteidei inventive.Vbucurcompaniacopiilor. Fecioar: Vi se pare greu s v jucai pn nu e casa n ordine. ndrgii jocurileidistraciilemetodice.Sarputeasvplacsrezolvaiprobleme. Balan: V place s jucai corect. Sar putea s avei talente creatoare n muzicsauobiectedeart. Scorpion: Suntei pasionat de preocuprile creatoare. V simii bine n cadrulproiectelorcreatoareintense. Sgettor:Vplacspaiilelargdeschisepentrurecreareisport.Sunteiun nvtorinventiv,nspecialpentrucopii. Capricorn: Avei o abordare responsabil asupra recrerii. V plac activitile organizate i s coordonai activiti pentru alii. Sar putea s avei talentuldeambinaplanurideafaceriinventive. Vrstor: V place s v exprimai natura individual prin joc. ndrgii jocurilenoiicaptivante. Peti: Suntei talentat artistic. V plac muzica, dansul, arta, teatrul, orice distracienltoareicarevajutsevadai. 1.1.6.CuspidacaseiVI Interpretri: Berbec:Viaadumneavoastrcotidianedepartedestatornicie.Vplaces ncepeifiecarezidevreme,libersvstabiliipropriulprogram,dectsfiilegat deorutinstabil. Taur:Viaadumneavoastrcotidianvreflectnevoiaderutinpractic. Sunteiunpartenerdemuncstabilidencredere. Gemeni:Vplictisiirepedederutinazilnic.Vvinegreusrespectaiun orarideseoriaveimaimulteproiectesimultane.Viaadumneavoastrcotidian arputeafimprtiat. 159
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Rac: V place s v ngrijii n mod regulat de cei dragi. Gsii rutina linititoareisigur. Leu:Tindeispreluaicontrolulasuprarutineizilnice,pentrucvplace s acionai aa cum dorii dumneavoastr. Cnd noutatea muncii cotidiene slbete,entuziasmulviserisipete. Fecioar:Sunteifoartescrupulosnrutinazilnic.Unmotobunarfi:eun loc pentru toate i toate i au locul lor. V preocup sntatea, dar trebuie s v feriidetendineledesuprasolicitare. Balan: V place o rutin zilnic echilibrat i armonioas. V place s cooperaicuparteneriidemunc. Scorpion: Viaa cotidian e abordat cu intensitate. Ai putea fi fanatic n domeniulmunciiisntii. Sgettor: Rutina dumneavoastr e dezorganizat. Pendulai ntre rezolvarea treburilor gospodreti cu entuziasm i fuga de rutin, cutnd aventura. Capricorn: Suntei bine organizat n rutina zilnic. V plac programele i orarele.Sarputeasfiiautoritaracassaulabirou. Vrstor: Traversai n mod constant rupturi n viaa cotidian. Aceasta o faceimprevizibiliincitant. Peti: Rutina dumneavoastr cotidian ar putea fi confuz i dezorganizat. Sar putea s v concentrai asupra muncilor gospodreti zilnice. Aiputeaaveaosntateprecar.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Descendentul(Descendant)nespunecaresuntcalitilepecareleatragem nrelaii.CalitileDescendentuluiaparadeseanceimaiintimiparteneriainotri, ca indicatoare ale leciilor despre noi. El arat i prima impresie pe care io fac oameniidesprenoi.Reprezintcstoria,relaiiledeparteneriatiinteraciunilecu ceilali. Interpretri: Berbec: Preferai s v meninei independena ntro relaie apropiat. V simii mai bine cu un partener activ i iubitor de libertate. Putei deveni agresiv dacvsimiinctuatdepartener. Taur:Preferaicaparteneriidumneavoastrsfiestatorniciipractici.V simiinsigurancucinevacareapreciazloialitateaiangajamentul. Gemeni: V place comunicarea cu partenerul. Vei dori un partener intim stimulantintelectual.Altfelvveisiminervosnrelaie. Rac: V place s fii ntro relaie cald i plin de grij. V place s v ngrijiideparteneriviceversa.Tindeisvsufocaipartenerul. Leu:Sunteiunpartenerentuziastigeneros.Vplacedistraciancadrul relaiei i v plictisii dac lipsete viaa i romantismul. Avei nevoie de atenia celuiiubit. Fecioar: Suntei un perfecionist n relaii. V place ca partenerul s fac bine lucrurile i putei fi critic dac nu se ridic la ateptrile dumneavoastr. Sunteicapabilsvngrijiidenevoilecotidienealeceluiiubit. Balan: Relaiile sunt importante pentru dumneavoastr. Preferai ca relaiile dumneavoastr personale s fie linitite i armonioase. Drept rezultat, puteifacepreamultecompromisurisauputeieuanavasumaoobligaie. Scorpion: Relaiile dumneavoastr sunt intense. Trebuie s tindei spre progresischimbarencadrulrelaiilor,altfelacesteapotdeveniscenededrami sentimentenegative. Sgettor:Sunteiunpartenerentuziastiiubitordedistracie.Preferaica relaiiledumneavoastrpersonalesfievzutecaoaventur.Vtrebuielibertate nrelaiilepersonalepentruacercetalumea. Capricorn:Preferaisaveirelaiipersonaleangajate.Vplacesimpunei respectul celor dragi i v trebuie un partener pe care sl putei respecta. Sar puteasalegeiunpartenermainvrst. Vrstor: V place libertatea de a fi o individualitate n cadrul relaiilor dumneavoastr. Partenerii apropiai vor trebui s v acorde mult libertate. Sar puteasvfiegreusvdedicaiuneipersoane. 161
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Peti: Suntei un partener milos i iubitor, cu unele posibile tendine martirice. Putei fi idealist n privina relaiilor personale. Avei nevoie s v mprtiieforturilespiritualesauartisticecupartenerul. 1.1.8.CuspidacaseiVIII Interpretri: Berbec: Suntei dispus s iniiai proiecte de cooperare, atta timp ct autonomianuvesteameninat.Probabilveiluainiiativanrelaiilesexuale. Taur: V place s mprtii plceri senzuale cu alii. Avei o abordare tradiionalasuprabunurilormprite. Gemeni:Sunteicuriosdinpunctdevederesexual.Esteposibilsvvin greusvlegainproiectedecooperare. Rac: Protejai orice bunuri comune i putei avea tendina s le adunai. Gsiiintimitateasexualntritoareimngietoare. Leu:Sunteientuziastcuprivirelaproiecteledecooperare,daraveiunele dificulticumprireabunurilor. Fecioar:Vplacesvfietotulclarnprivinabunurilormprite,stii detaliile exacte ale oricror contracte. Suntei de asemenea foarte scrupulos n legturcunevoiadecurenienrelaiilesexuale. Balan: Suntei corect cnd mprii bunuri cu alii. V plac proiectele comune carev reflect nevoia deimparialitate.Putei fi manipulator nrelaiile sexuale. Scorpion:Sunteicaracterizatdenflcrareisexualitate.Sarputeasfii ascunscuprivirelaactivitiledumneavoastrsexuale.Sarputeasfiireceptivla orientrileeconomice. Sgettor: Avei multe principii etice n legtur cu proiectele comune i relaiilesexuale.Vplacesvaplicaiprincipiilencazulbunurilormprite. Capricorn: Suntei responsabil cu bunurile altora. V place s fii ntro poziiedeautoritatecuprivirelaproiecteledecooperare.Sarputeasvsimii cumvainhibatsexual. Vrstor:Aveiideiinovatoaredespreproiecteibunuricomune.Vplace sexperimentainviaadumneavoastrsexual. Peti: Nu v este limpede chestiunea bunurilor mprite i suferii din cauza confuziei n legtur cu ce e al dumneavoastr i ce aparine celeilalte persoane.Unproiectartisticcomunarputeafiodesctuarebenefic.Sarputea de asemenea s ncercai o stare de confuzie cu privire la dispoziiile dumneavoastrsexuale. 162
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




Berbec:Preferaisnvaidespreviaprinexperiennatural,dectn slile academice. Totui, v va interesa orice cale provocatoare de cunoatere superioar. Taur: Avei o filosofie nepstoare i practic asupra afacerilor materiale. Dac vei cltori peste hotare. probabil va fi cu un scop i n cea mai practic manier.Sarputeasmunciistruitorcasobineisuccesacademic. Gemeni: Suntei curios n legtur cu lumea i sar putea s v plac cltoriile peste hotare i studiile academice ca mijloace de a v astmpra curiozitatea. Rac: V place idea unei cltorii sentimentale, dar avei unele ndoieli cu privire la realitile cltoriei departe de cas i de cei dragi. Var putea ajuta s cltorii cu fotografii de acas n geamantan. Preferai s v facei studiile acas dacesteposibil. Leu: Iubii explorarea lumii. Cltoriile sunt distractive, dar la fel sunt studiulidiscutareaconvingerilorfilosofice. Fecioar: V place s cltorii cu un geamantan n ordine i un itinerar precis. Tindei ctre perfeciune n orice educaie superioar pe care o urmai i puteifiautocritic. Balan:Vplacescltoriicupartenerul.Vplacfilosofiileegalitariste. Scorpion:Vplacescltoriinlocuridramaticeiexotice.Odatajuns, v place s investigai toate posibilitile. De asemenea cutai o educaie superioarcareimpliccercetarentroanumitform. Sgettor: Suntei n cutarea cunoaterii care se va aduga modului de nelegere a lumii. V plac cltoriile, studiul, religia, filosofia orice sclipire n cutareadumneavoastr. Capricorn: Avei ambiia de a urma studii superioare. Avei o privire responsabilasupraafacerilormateriale.Sunteibineorganizatcndcltoriiis arputeascltoriinscopurideafaceri. Vrstor: V place s explorai aspectele mai neobinuite ale lumii. Cltoriile dumneavoastr ar putea fi presrate cu surprize neateptate. Studiile dumneavoastr superioare ar putea fi ntrun domeniu neobinuit, tehnic sau tiinific. Peti:Cltoriiprinlumenviseledumneavoastr,daraveidificultina face fa aspectelor practice pe care le implic studiul i cltoriile. Sar putea s alegeisstudiaisauscltoriinscopuriartistice. 163
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Mijlocul Cerului (Medium Cli) ne spune despre viaa noastr public. Aceasta include statutul social i/sau profesia aleas. Arat de asemenea cum rvnimrecunoaterea,ambiiileirelaiilecusuperiorii. Interpretri: Berbec:Sunteiambiios,cumulteideisclipitoaredesprecumspromovai n carier. Vei cere autonomie i libertate n profesia aleas. Sar putea s fii propriuldumneavoastrpatron. Taur:Aveinevoiederutinistabilitatencarieradumneavoastrivei alegeocalehotrtidencredere. Gemeni: Avei nevoie de stimulare i activitate n viaa dumneavoastr profesional. Comunicarea e de asemenea important. Ai dori s fii recunoscut pentruinteligen. Rac: Avei nevoie de o profesie sigur i linitit, iar grija pentru alii e deseori o cheie. Vei ncerca sentimente puternice n legtur cu statutul dumneavoastrpublic. Leu: Identitatea dumneavoastr are legturi puternice cu statutul public. V place s strlucii n domeniul profesional. Avei putere, trie i capaciti de conducerenprofesiadumneavoastr. Fecioar: Suntei muncitor, critic i sever n profesia dumneavoastr. Preferai ordinea la lucru i v place s fii recunoscut pentru standardele dumneavoastrridicateimuncaexigent. Balan: Vei alege o profesie pentru frumusee, armonie i echilibru. Capacitilesocialesuntdeasemeneaconsiderateimportantendrumulales. Scorpion:Aveiointensnevoiederecunoaterenmuncadumneavoastr. Capacitatea dumneavoastr de a spa adnc e adus n viaa profesional i sar putea s atragei crize la lucru. Cercetarea i resursele apar deseori cu putere n carieradumneavoastr. Sgettor: Abordai cariera cu entuziasm. V place s fii remarcat public iarcarieradumneavoastrarputeaavealegturicustrintatea. Capricorn: Vei alege o cale profesional responsabil i respectabil. Preferaisfiivzutdreptautoritaridencredere. Vrstor:Veifiingeniosioriginalnprofesiaaleas.Sarputeasalegei ocarierneconvenional.Doriisvaduceicontribuialadezvoltareaomenirii. Peti:Veiserviomenireaprincarieradumneavoastr.Sarputeassuferii schimbri de profesie i s urmrii idei fanteziste asupra direciei n via. Sar puteasvsimiicopleitdedeciziileprofesionale. 164
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




Berbec:Sunteiunconductor,maidegrabdectopersoansupus,cnd e vorba de prieteni i grupuri de oameni. Avei propriile concepii i scopuri n via,idoarceicarevacordlibertatevvorrmneprieteniadevrai. Taur: Suntei un prieten loial i de ndejde. Suntei un membru stabil al grupuriloriasociaiilor.Scopurileiconcepiiledumneavoastrsuntpractice. Gemeni: Avei muli prieteni din toate categoriile sociale. V place s discutaicuprietenii,attindivizictigrupuri. Rac:Vplacprieteniileapropiateiplinedegrij.Vplacesaveigrijde prieteni. Acetia devin familia dumneavoastr. Scopurile i dorinele dumneavoastrsarputeasimplicestabilireaunuicmin. Leu:Vdistraimultcuprietenii.Vplacactivitilecreativedegrup,mai alesdacdumneavoastrleconducei. Fecioar: Suntei exigent n legtur cu anturajul dumneavoastr. Suntei unprietenpracticiplindegrij,deseoripreocupnduvdedetaliilecotidieneale vieiiprietenilor.Sunteiunbundeprepentruoricegrupsauasociaie.Sarputea sfiicriticcuprieteniicarenuseridiclaateptriledumneavoastr. Balan: Suntei un prieten obiectiv i cooperant. V asumai rolul de mpciuitorngrupuri. Scorpion:Acionaicauncatalizatorpentruprieteni,ajutnduisfacfa aspectelorascunsealepropriilorlorpersonalitiisitransformevieile.Suntei unmembruputernicngrupuri. Sgettor: Suntei un prieten entuziast i iubitor de distracii. V place s cltoriiiscercetailumeampreuncuprieteniisaucugrupurideoameni.V placesvstabiliipropriilescopuripersonalepentruviitor. Capricorn: Viaa dumneavoastr social e bine organizat cu prieteni din grupuriiasociaii,sau,posibil,prinafaceriledumneavoastr. Vrstor:Vplaceoviasocialvastivariat.Prieteniidumneavoastr ar putea fi excentrici sau diferii. Sar putea s v bucurai de o via social asociatgrupurilorcuocauz. Peti: V plac distraciile spirituale i artistice mpreun cu prietenii. Artai compasiune pentru prietenii dumneavoastr i sar putea s v alturai unuigrupsauasociaiecuunscopumanitar. 165
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




Berbec: V temei s nu fii copleit de sentimentele celorlali i s nu v pierdei simul identitii. Sar putea s v trezii c luptai btliile altora i v trebuietimplibersrefaceiisvnnoiidireciaspiritual. Taur: Ridicarea dumneavoastr ctre nlimi spirituale se va face prin mijloaceritmiceisenzuale.Sarputeasaveidificultinarmnecupicioarele pepmnt. Gemeni: V place s cercetai trmurile subcontientului, dei trebuie s nvaisdistingeicarepriestemaibinesleevitai.Aiputeaaveacapaciti mediumnice. Rac:Probabilcsunteiputernicinfluenatdesentimentelecelordinjuri aveinclinaiiintuitive. Leu:Sarputeasaveidificultingsireaproprieiidentitiivplace sjucairolulunorpersoanebinecunoscute. Fecioar:Sarputeasaveitendinaunorgnduriobsesiveivicioaseiv temeisvdaidrumulcanucumvasvisedezvluieimperfeciunile. Balan: Sar putea s fii prea sensibil la nevoile celorlali, ducnd la o teamdeconflict. Scorpion: Sar putea s v temei de intensitatea sentimentelor dumneavoastr subcontiente i s ncercai s le controlai ndeaproape. Sar puteastrebuiascsvexprimaiuneledinacestesentimentepentrualeputea risipi. Sgettor: Sar putea s simii c suntei ntro cutare spiritual i sar puteasntlniimulinvtorisaumaetrindrumuldumneavoastr.Inevitabil, veidescopericceamaimarenelepciunevinedininterior. Capricorn:Probabilcvveiinhibaiignoranevoileinterioareiaiputea chiarfiparanoic.Trebuiesvmpcaicuaceleprialedumneavoastrpecare vileaiizolat. Vrstor: Sar putea s v plac s cercetai trmurile spirituale prin mijloacemetafizice,cumarfimeditaia,astrologiaiocultismul. Peti: Avei capacitatea de a simi semnificaiile ascunse ale ntmplrilor dinjur.Sarputeasgsiimeditaiabeneficpentrurennoireaspiritual.Ceamai marefricadumneavoastrestedefricansi. 166
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Zenitul reprezint cel mai nalt, cel mai nordic grad al zodiacului, ntro hart a cerului (pe cnd Mijlocul Cerului e gradul cel mai sudic). Pentru al determina, se scad 90 din poziia Ascendentului. Zenitul este la o cuadratur distanfadeAscendent,deasupraorizontului(axaAscendentDescendent). ElareoinfluendetipcasaX,ceeacenseamncoplanetnconjuncie cuZenitulctignputereidindicaiiasupracomportamentuluinsocietatei asupratipuluidecarierncarepoatessedezvolteindividul. Nadirulestepunctuldiametralopuszenitului.Elareoinfluendetipcasa IV,ceeacenseamncaoplanetnconjunciecuNadirulctignforSipoate oferi indicii asupra comportamentului n viaa privat, n cmin, de asemenea asupraaceeaceestemaiascunsnpersonalitateasa. SeadmiteconjunciacuZenitulsauNadirulcndoplanetsesitueazsub 4toleran. 1.2.2.PuncteleEstiVest

Punctul Est are o influen de tip casa I i orice planet n conjuncie cu acest punct informeaz asupra personalitii exterioare. Punctul Vest este punctul diametralopusPunctuluiEst.ElareoinfluendetipcasaVIIioriceplanetn conjunciecuacestpunctindictipuldeexperienpecareindividuldoreteso
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mpart cu altul, mai ales ntro relaie n doi. Graficul reprezint Punctul Est. Se admiteconjunciacuacestepunctesub4toleran. 1.2.3.VertextuliAntivertexul

VertexulareoinfluendetipcasaVII.Elaratuntipdeexperiencarenu se poate ntreprinde dect n colaborare cu altcineva (cstorie sau asociaie). El indic, de asemenea, ntlnirile predestinate, regsirile karmice, adic dou persoanecareautritdejaexperienerelaionalenaltevieiicareserentlnesc acum pentru ai continua relaia, n bine sau n ru. Acest lucru devine evident cnd o planet sau un punct cardinal al unei teme se suprapune Vertexului sau Antivertexuluiceleilalteteme.OplanetnconjunciecuVertexulsub5toleran mpinge individul s mpart cu altcineva mesajul ei, sau s caute o persoan corespunztoare semnificaiei acestei planete pentru a experimenta potenialul Vertexuluipropriu.AntivertexulareoinfluendetipcasaI,darelacioneazmai ales n complementaritate cu Vertexul. Graficul reprezint Vertexul. Acestea sunt dou puncte sensibile care trebuie considerate foarte motivante. Uneori, ele motiveazocarier,nspecialpeaceeacaresefacenasociaie.Adesea,Vertexul rmneunpotenialincontient. 1.2.4.PuncteleNordiSud PunctulNordestepunctulncuadraturcuVertexulisuborizont.Elareo influendetipcasaIV.PunctulSudestepunctuldiametralopusPunctuluiNord.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ElareoinfluendetipcasaX.Acestedoupuncteseaseamn,naciunealor,cu Zenitul i Nadirul. Au aceeai interpretare ca ele, n plus, primesc o indicaie de ntlnirekarmicncomparaiadintreteme,ncazdesuperpoziiecuplaneteledin alttem.Toleranaadmispentruconjuncieestede4. Oriceplanetnconjunciecuunuldinaceste8punctesensibiledevineo planetdominant.


Semnificaie: Soarelereprezintidentitateanoastr.Nespunecumnedefinim,cumavem nevoie s ne exprimm i s ne remarcm n via, cum simim c trim. Este centrulautoexprimriinoastre.Nepoatespunedeasemeneadespretat. Interpretri: Berbec (exaltare): Suntei o persoan categoric i iubitoare de libertate. Avei mare nevoie de independen i sar putea s tindei s v artai n mod hotrtpreocupareapentrusine. Taur: Suntei o persoan solid i de ncredere. Avei mare nevoie de o rutinstabilidesiguran.Puteifincpnat. Gemeni: Suntei curios, comunicativ, nestatornic i vorbre. Sar putea s fiineseriosievaziv. Rac: Suntei o persoan plin de grij i nelegere, cu o mare nevoie de familieiconfort. Leu(domiciliu):Sunteibunlasuflet,cuopersonalitateoptimistiomare nevoiedeatenie.Aveionaturgeneroas,darputeifiarogant. Fecioar:Sunteiopersoananaliticicritic.Deasemenea,sunteipractic icuputeredediscernmnt,darsarputeasfiiagitat,nervos. Balan(cdere):Sunteidiplomatiaveimarenevoiedepaceiarmonie. Frumosuleimportantpentrudumneavoastr.Sarputeasfiincrezut. Scorpion:Suntei o persoan ptimai viguroas.Sar putea s ctigai atenia celorlali crend situaii dramatice. Sar putea, de asemenea, s fii o fire ascuns. Sgettor:Sunteiopersoanveselidornicdeaventur.Sunteioptimist ifilosof,darputeitindespreobtuzitate.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Capricorn: Suntei respectuos i responsabil, cu o mare nevoie de a fi o figurcuautoritate.Cereirespectiputeitindespresuperioritateidespotism. Vrstor (exil): Suntei neconvenional, prietenos, imprevizibil i inventiv. Vplaceoriginalitateaiputeidevenirefractar,insubordonat. Peti:Sunteiopersoanlinititifantezist.Aveinevoiesvexprimai nchipuirileiimaginaiaiputeifivistorsaudistrat. Casa 1: Sinele este extrem de important. Este fundamental s nvai despredumneavoastricumsvexprimai,icereicaceilalisvdeaaceast libertate.Autonomiaestefoarteimportantpentrudumneavoastr. Casa 2: Respectul de sine este un element cheie n viaa dumneavoastr. Averea poate deveni un mijloc de a v exprima. Valorile sunt importante pentru dumneavoastritrebuiesnvaideasemeneasvpreuiipropriapersoan. Casa3:Comunicareajoacunrolcheienviaadumneavoastr.ncercaio permanent sete de cunoatere i o nevoie egal de a le spune celorlali ce ai nvat.Fraiiisurorilepotfiimportanipentrudumneavoastr. Casa4:Casaifamiliasunttotul.Cumvncadraiiroluljucatnfamilie sunt de mare importan pentru dumneavoastr. nvai cele mai multe lucruri despresinenmediulfamilial. Casa5:Vexprimaiprindistracieicreativitate.Vplacejocul.Nevoiade a nva despre sine prin proiecte creatoare este puternic. Copiii ar putea de asemeneasaibmareimportannviaadumneavoastr. Casa6:Rutinazilnic,sntateaimuncasuntdomeniilencarestrlucii. Veinvaleciiledeviaprincapacitateadeaservi. Casa7:Relaiilesuntarenacunoateriidesine.Partenerulintimvadeveni oglinda dumneavoastr pentru reflectarea cunoaterii de sine. Parteneriatele de afaceripotfideasemenearemarcabile. Casa8:Transformareaestecheiacunoateriidesine.Moartea,sexualitatea iresurseleexternesuntimportantenviaadumneavoastr. Casa 9: Viaa dumneavoastr este o cltorie n cutarea cunoaterii superioare. Cltoriile, culturile strine, religia i studiile academice v pot oferi cheileacesteicunoateri.Filosofiilevorficercetatepentrucunoatereadesine. Casa10:Strluciinarenapublic.Profesia,statutulsocialimaritaldevin mijloaceleprincarevveiexprimapesine. Casa 11: Cunoaterea de sine e ctigat prin grupuri, asociai i prieteni. Veiaveadeasemeneaomarenevoiedeavstabiliscopuriiconcepiipersonale. Casa 12: Simul dumneavoastr de identitate se pierde n ntreg. Simii lipsauneigranientredumneavoastriceilali,maialesnmulimiledeoameni. Deasemeneancercaiolegturprofundcumasele.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Exist unele mici diferene n funcie de poziia anului respectiv n ciclul de4ani(3normali+1bisect).

Semnificaie: Lunanespunedesprenaturanoastremoionalidesprenevoiledebaz. Este de asemenea cheia modului n care ncercm intimitatea n relaii. Luna ne spune despre mam, ea fiind prima noastr relaie intim. Cum iam simit sprijinul?icetipdesprijinateptmacum? Interpretri: Berbec: Avei nevoie, din punct de vedere afectiv, de aciune i independen.Subtensiune,veicutaoprovocareitimppecontpropriu.Poate mamadumneavoastrsadoveditindependentiintolerant. Taur (exaltare): Avei nevoie, din punct de vedere afectiv, de stabilitate i rutinesigure.Vtemeideschimbarei,subtensiune,esteposibilsmncaimult. Aivzutopemamadumneavoastrdrepttradiionalistidencredere. Gemeni:Aveionevoiefundamentaldestimularemental.Sunteicurios icutairspunsurilamultentrebri.Sunteigurspart.ntineree,aidoritca mamadumneavoastrsvasigurestimulareiactivitate.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Rac(domiciliu):Aveinevoiedesprijin.Subtensiune,veivreapoatesv retrageintihnacaseidumneavoastr.Veiformaolegturputerniccumama. Sarputeasaveidificultilaprsireacaseinatale,maitrziunvia. Leu: Avei nevoie, din punct de vedere afectiv, de laude i atenie. Sub tensiune, sar putea s facei pe grozavul pentru a atrage atenia, sau s devenii arogant. Suntei mndru de mama dumneavoastr, sau ea este foarte mndr de dumneavoastr. Fecioar: Vei ncerca o legtur puternic ntre sentimente i trup. Avei nevoiedeperfeciune.Subtensiunevputeimbolnvi.Mamadumneavoastrs arputeasfiecriticsauperfecionist.Vvaasiguraordineiorganizare. Balan: Avei nevoie de armonie i de un mediu ambiant linitit. Sub tensiune,veicutapaceaicalmul.Mamadumneavoastrarputeafisociabili nelegtoare. Scorpion(cdere):Aveiintensitateafectiviomarenevoiededramatism. Subtensiune,veicreantmplridramaticeiintensitatedetriri.Sarputeasfii nscut atunci cnd mama dumneavoastr trecea printro criz, sau naterea dumneavoastr s fi fost traumatizant. Probabil c mama dumneavoastr a fost posesiviputernic. Sgettor: Avei nevoie, din punct de vedere afectiv, de aventur i independen i o dorin instinctiv de a cltori i explora. Sub tensiune, vei doristriioaventur.Mamadumneavoastrafostprobabilvzutcaiubitoare dedistracieiindependent. Capricorn(exil):Vsimiinsigurancndviaaveorganizat,saucnd muncii mult. Sar putea s fii distant sau rece din punct de vedere sentimental. Dragosteamameidumneavoastrprobabilafostlimitatnvreunfel.Poatemama dumneavoastrafostinflexibilsaurece. Vrstor: V simii n siguran mai degrab cu raiunea dect cu sentimentele. Sar putea s v distanai de sentimente, sau s le considerai iraionalesauimprevizibile.Sarputeasvfivzutmamadreptschimbtoaredin punctdevedereemoional. Peti:Simiiadncemoiile.Subtensiune,veicutapoateizolarea.Suntei puterniclegatempaticcumamaitrebuiesvaflaipropriilegranieemoionale. Casa 1: Avei nevoie, din punct de vedere afectiv, de independen i autonomie.Pentrudumneavoastrexprimareadesineesteunmoddeaveduca. n timp de criz, vei vrea poate s v retragei i s petrecei un timp pe cont propriu. Casa2:Cutaisiguranadinpunctdevedereafectivprinsporireaaverii. Acestaeunmoddeavconstruirespectuldesine.Trebuiesvformaiunsistem devaloripersonale.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa3:Aveiomarenevoiedeacomunica,nvaiacumulacunotine. Intuiia v este puternic i vei descoperi poate c, intuitiv, cunoatei sentimentelecelorlali. Casa 4: Cutai sigurana din punct de vedere afectiv prin familie. Viaa casnicifamilialvasigursprijinulemoional.Acasvsimiisigur. Casa 5: Distracia i creaia sunt cele mai bune moduri de a v ngriji de dumneavoastr. Avei nevoie de recreare. Copiii pot fi de asemenea o surs de mngiere. Casa6:Rutinazilnicelinititoarepentrudumneavoastr.Concentrareape rutina zilnic i sntate v va satisface nevoile din punct de vedere afectiv. Animalelearputeafideasemeneaosursdecldursufleteasc. Casa7:Aveioprofundnevoiederelaiipersonale.Legturileintimev vor oferi sprijin emoional. Feriiv de tendina de al pune pe partener s v ngrijeasccaomam. Casa 8: Avei nevoie s nelegei ciclurile vieii. Suntei sensibil la tendinele ascunse n multe situaii i vei dori s explorai aceste lucruri n profunzime. Vei gsi de asemenea sprijin n resursele altora financiare sau emoionale. Casa9:Aveinevoiesnelegeiimagineadeansambluncelemaimulte situaii. V gsii linitea prin aventur, explorarea lumii cu ajutorul cunoaterii superioare,cltoriilor,religiei,filosofieiiculturilorstrine. Casa 10: Avei nevoie s fii recunoscut public pentru realizrile dumneavoastr.Cutaisiguranaprinstatutulsocialicarier. Casa 11: V vei simi sigur i sprijinit n compania prietenilor i a grupurilordeoameni.Puteideveniataatemoionaldeprieteni.Puteiconstatac grupurileumanitarevsatisfaconevoieinterioar. Casa12:Sarputeasvsimiipierdutntrunoceandeemoii.Graniele dintrepropriilesentimenteilumeaexterioarsuntestompate.Aceastavarputea face s v simii copleit de simmintele celorlali. Meditaia poate fi un sprijin pentrudumneavoastr. ntro lun, satelitul parcurge aproximativ 385;, deci face turul ntregului zodiac. 173
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Lilith semnific inacceptarea propriei condiii. n horoscopul unui brbat reprezint partea sa feminin i viceversa. Ea arat locul unde se concentreaz o lecie de via care nu a fost neleas i care, prin consecinele ei, a marcat o involuiepeplanspiritual. Interpretri: Berbec: Trebuie s v gndii nainte de a aciona, deoarece dovedii impulsivitate i violen. Avei instincte puternice, dar o personalitate instabil. Probabilcnviaaanterioarnuvaiacceptatpersonalitateaiailuptatpentru supremaialumeasc,uneoriprinmijloacenecinstite. Taur: Raporturile financiare v sunt afectate, prin dorin sau refuz de bani.Aveidificultinexprimareasenzualitii.Puteifihipersensibilsaugelos, posesiv. Probabil c n viaa anterioar nu vai acceptat condiia material i pstraiooarecareculpabilitatenacceptareabanilor. Gemeni:Aveiogndirelogicirece,rezultndpoatedintroncercaredin timpul adolescenei. Suntei predispus spre erori intelectuale, dificulti n comunicare, depresiuni nervoase. Probabil n viaa anterioar ai dovedit o mare curiozitate,darpuindiscernmnt. Rac: V refuzai sensibilitatea i feminitatea. Este posibil s v respingei propria copilrie datorit unor ncercri dificile sau unei mame autoritare. Sunt posibiledeasemeneaavorturisausterilitate.Probabilcnviaaanterioarnuv aiacceptatmediulsocialdeprovenieniaiavutdecepiisentimentale. Leu: Avei tendina de a respinge posibilitile creative sau afective. Dovedii o voin rece, orgoliu, megalomanie, mare vitalitate, nclinaie spre arivism. Probabil c n viaa anterioar nu vai acceptat calitatea i obligaiile de printe,fiinddeasemeneanemulumitdeprestigiulpropriu. Fecioar: Suportai cu dificultate limitrile n activitate. Dovedii instabilitate psihic, manifestnd o obsesie a ordinii i datoriei. Tindei spre ipocrizie,egoismiinsubordonare.Probabilcnviaaanterioarnuvaiacceptat obligaiileprofesionalesauairefuzatslucraicasubordonat. Balan:Aveimarenevoiedeaseduce,daraveidificultincstoriesau asociaii, refuznd conveniile sociale. Avei tendina de a v nconjura de un anturajpgubitor.Probabilcnviaaanterioarnuvaiacceptatsingurtateaori relaiiledelicatedinasocierilesentimentalesaudeafaceri. Scorpion:Vinteresaidemistere,enigme, avndun spirit analitic aplicat nspecialaltora.Dovediioputernicsexualitatecepoatefisublimatprinstudiul

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


esoterismului. V va marca foarte mult un doliu i vei ncepe autocunoaterea cutnd,iprintiineleoculte,misterelevieiiimorii.Nuvacceptaicondiia materialisentimentalitrebuiespuneinbalansentimenteleisexul. Sgettor: Avei dificultin a v dezvolta,n a ghida pe altul.Vsimii diferitdeceilali,cutaiabsolutulprintroreligie,filosofiesauspiritualitate.Putei avea probleme n cltorie sau cu strinii. Rutina i limitele posibilului v deranjeaz.Nuacceptaimodalitilepropriideevoluiespiritual. Capricorn: Avei o tendin spre orgoliu, rceal, sterilitate, snobism. Sfritulvieiisedovedetedificilpentruindiviziimaipuinevoluai.Detaareade agitaiacotidianiautoanalizasevervpotdezvluilipsurileprivindinstruirea iexcesivdepragmaticafilosofiedevia.Nuvacceptairoluljucatnsocietate, avnd senzaia c nu avei funcia, banii i onorurile cuvenite. Avei piedici n ascensiuneasocial. Vrstor: Aceast poziie aduce, n general, ncercri legate de prieteni i asociai (trdri, doliu, divor). Avei un caracter revoluionar, cutai libertatea absolut,dartrebuiesnvaisvdeschideisprealii,pentruavputeaspune prerea. Probabil c n viaa anterioar nu vai acceptat propria expansiune de contiin, rtcindntro lume materialist n care nu v mai regseai i o lume spiritualdecarenueraiconvins. Peti: Cutai o lume ideal, dar exist riscul de prizonierat simbolic sau real,problemedesntate,fugderealitate.Tindeisevadainuniversulviselor iiluziilor.Suntposibilelegturisecrete,daruriprofetice,erorispirituale.Probabil cnviaaanterioarnuvaiacceptattransformareaspiritualimarginalizarea. Casa 1: Avei o personalitate misterioas, instabil, autoritar, crud i angoasat.Visecereoviziunedeansambluasuprasituaiilorcreate,precumio estimareexactapropriilorposibiliti.Crizadeidentitatepoatepersistadacv cheltuiienergianexcesesenzuale,pasionale. Casa 2: Avei nevoie sartaialtuia propria valoare. Cutai sigurana i ncredereansinepentruaobinerecunoatereadinparteacelorlali.Indiferentde situaia material, v simii srac. Trebuie s v schimbai sistemul de valori, reducndbanuldelascopnsinelamijloc. Casa 3: Avei probleme cu rudele apropiate (frai, surori), precum i n domeniulstudiilorialmodalitilordecomunicare.Sunteiautodidact,unspirit revoluionar,chiaranarhic.Secereoreformularealegilorintelectuale,amanierei decomunicareiaraporturilorcuceiapropiai. Casa 4: Putei fi marcat de problemele familiale. Poate fi vorba de o mbolnvire grav a dumneavoastr sau a prinilor. Trebuie s scpai de complexul de a v fixa de cineva sau de ceva i s avei mai mult ncredere n propriile posibiliti. Se cere o reformulare a credinelor familiale, a originilor, sensibilitiiiraporturilorcumembriiproprieifamilii. 176
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa5:Idealismulnrelaiilesentimentaleprovinedinincapacitateadeal vedea i accepta pe cellalt aa cum este. De aici apar deziluziile. Sunt posibile legturi secrete, refuzul maternitii, probleme cu copiii, imagine proast despre sine. Trebuie s v reformulai alegerile sentimentale, raporturile cu copiii i expresiatalentelorcreatoare. Casa 6: Avei o sntate fragil, sunt posibile operaii chirurgicale, accidente, tendine depresive, instabilitate psihic. Meninerea sntii necesit adesea un regim strict. Putei avea probleme n munc datorit inacceptrii disciplinei.Trebuiesvdiminuaispiritulcritic,svschimbaimoduldelucru isvreformulainoiuniledeserviciu,datorie,responsabilitateilimitare. Casa7:Aveitotfeluldeconflictenrelaii.Existrisculdedivor,vduvie, ruptur de contracte, trdri diverse. Pstrai greu echilibrul ntro asociere i tindei s v complicai inutil. Se cere reformularea raporturilor prea posesive cu ceilali,anoiunilordesacrificiuitoleran. Casa 8: Aceast poziie aduce un proces de contientizare determinat de fenomenul morii. Sunt posibile datorii, comaruri, doliu, sexualitate puternic, sadism,tendindesinucidere.nurmaunuiocexistenial(probabilundeces),v vei schimba majoritatea principiilor de via. Se cere reformularea sexualitii proprii,anoiunilordeputereimoarte,aconcepieipropriiavalorilor. Casa9:Aceastpoziieaduceunblocajnstudiullimbilorstrine,necazuri n cltorii, n strintate sau cu strinii, cu legea sau cu religia. Sunt posibile refuzulfrontierelor,xenofobie,aventuri,accidente,respingereaideilorprimite.Se cer depirea de sine n domeniul mental i spiritual, precum i reformularea credineloriidealurilorproprii. Casa 10: Avei o personalitate dur, rece i misterioas. Suntei un bun profesionist,rezultatpoatedintrunautodidactfrustratnadolescen.Trebuies cultivai spiritul de echip. Sunt posibile dificulti profesionale, respingerea responsabilitilor,spiritcontestatar,refuzulsocietii,angoas.Secerstpnirei reformularea noiunilor de reputaie, carier, imagine public, direcie i responsabilitate. Casa11:Aveidificultinavfaceprietenisauavintegrantrungrup sau ntro asociaie. Sunt posibile proiecte utopice, megalomanie, gelozii, trdri, rupturideprietenii,susintorimisterioi.Secerereformulareaproiectelorproprii, ascopurilor,araporturiloramicaleiaviselor. Casa12:Vndreptaispreoizolaredeliberatdetumultulvieiicotidiene, nemulumit de faptul c afeciunea dumneavoastr este blocat de insensibilitate sauneneleascumsecuvine.Sunteimarcatderecunoatereapropriilorgreelii dereabilitareanpropriiochi.Suntposibilencercrimisterioase,dificildeneles, tulburri psihice, prieteni puternici secrei, sacrificiu. Se cere reformularea profundafragilitiiinterioareprinncercri(boli,accidente),aevoluieiproprii iacredinelor. 177
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: NodulNordindicoleciecheienvia.Reprezintnoileexperienectre caretrebuiesnendreptmnaceastvia.Amdeprinsdejacalitilepunctului su opus, Nodul Sud, n vieile trecute. Acum trebuie s ne dezvoltm i s ne extindem prin Nodul Nord. Chemarea Axei Nodurilor este s folosim talentele trecutealeNoduluiSudisnvmnoiletalentealeNoduluiNordncutarea totalitii. Interpretri: Berbec: Menirea dumneavoastr este s devenii hotrt i ncreztor n sine.Aveitendinasfiinehotrt,punndmereupeprimulplannevoilealtora. Acumtrebuiesdescoperiisimulproprieiidentitiislansaiproiecteproprii. Taur: Menirea dumneavoastr este s v nvingei nencrederea n schimbare, s dezvoltai descturi creative pentru emoiile dumneavoastr intenseisevitairnireacelordragi.Acesteatributevchinuienaceastvia datorit sfriturilor dureroase i traumatizante din vieile trecute care vau lsat cuadncirnisufletetiicuunsentimentcsunteinelat.nvndleciaacestei viei,deaaveancrederenprocesulschimbrii,veidezvoltaosenzaienoude liniteistabilitate.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Gemeni: Menirea dumneavoastr e s nvai s vedei viaa din punctul de vedere alaltora i sdevenii expert n arta comunicrii.Avei tendinas fii agitatimprtiat.Trebuiesvdezvoltaiputereadeconcentrareicapacitatea de comunicare a propriilor idei ntrun mod care i poate ajuta pe numeroii oamenidinviaadumneavoastr. Rac:Menireadumneavoastresvnvingeimndriainterioarisv toleraipropriileeecuri.Aveitendinasfaceiviaamaigreadectestenevoie. Aceasta se bazeaz pe vieile trecute n care a trebuit s muncii din greu pentru respectuloamenilor.Trebuiesnvaiumilinaisvexprimaisentimentelen mod cinstit pentru ca si putei susine pe ceilali cu nelepciunea dumneavoastr. Leu: Menirea dumneavoastr e s v dezvoltai puterea interioar. Sar putea s v dai seama c ncercai perioade de singurtate. Acestea sunt parte a lecieideavmodelapropriaviacreatoarepentruaservicugenerozitatelumea. Fecioar: Menirea dumneavoastr e s v dedicai servirii celorlali. Va trebuisvnvingeipornireadeavisacuochiideschii,deavsimicopleiti svpuneicompasiuneainelepciuneanslujbaomenirii. Balan: Menirea dumneavoastr e s nvai cooperarea. Avei tendina de a dori s v impunei punctul de vedere n faa celorlali. Trebuie s v dezvoltaialtruismul,capacitateadeampribunurilecualtulisensibilitateala nevoilecelorlali. Scorpion: Menirea dumneavoastr e s integrai schimbarea n propria via. Avei tendina s dorii linitea i pacea cu orice pre. Trebuie s evitai slbireaputeriispiritualeprinrezistenalaschimbare.Provocareadumneavoastr e s rmnei deschis la noile posibiliti. Sar putea s descoperii c viaa dumneavoastr sa schimbat la un anume moment, nlturnd vechiul pentru a facelocnoului. Sgettor: Menirea dumneavoastr e loialitatea i perspectiva singular. Aveitendinasfiiinstabil,umplnduvviaacumulioameniiactiviti.Sar puteadeasemeneasncercaiconflictendeciziiledumneavoastr.Trebuiesv dezvoltaiunsimaldirecieiioperspectivmainalt. Capricorn: Menirea dumneavoastr e maturitatea. Avei tendina s deveniidependentdealiiisvagaideeideparcaificopil.impovrai cu problemele dumneavoastr afective reale sau imaginate, dorind ca ei si asumeunrolparental.Veipetrecemarepartedinviacutndofigurpatern dac nu v putei accepta provocarea de a deveni responsabil pentru propria dumneavoastr via. Trebuie s renunai la problemele personale i s ncercai svconstruiiunlocrespectabilnlume. Vrstor:Menireadumneavoastreservireaomenirii.Veincercaolupt ntre nevoile dumneavoastr personale i druirea ctre alii. Trebuie s v lsai
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


deopartenevoiapersonaldeglorieiprestigiuisvfolosiiaptitudinilepentru aservilumea. Peti:Menireadumneavoastrestecompasiuneaicredina.Aveitendina s v construii cu rigiditate organizarea, ordinea i curenia n lumea dumneavoastrpersonalisijudecaipeceilali.Aceasttrsturvblocheaz nelegerea unitii cu universul. Trebuie s v dezvoltai nelegerea spiritual i snvaisvbizuiipeintuiie. Casa 1: Menirea dumneavoastr e gsirea propriei identiti. Trebuie s lsai n urm obiceiurile vieii anterioare de a v ascunde n alii i s gsii un echilibruntreautoafirmareirespectareacelorlali. Casa 2: Menirea dumneavoastr e gsirea unui set de valori personale. Trebuieslsainurmmijloacelenecinstitealevieiianterioareisvctigai drumulnaceastvia. Casa3:Menireadumneavoastresnelegeiinteraciuniledintreoameni. Trebuie s lsai n urm sistemul variat de credine din vieile anterioare i s gsiioformviabildecomunicare. Casa4:Menireadumneavoastregsireavaloriieuluiinterior.Trebuies v nvingei nevoia actual de afiare public, bazat pe experiena recunoaterii publicedinviaaanterioar. Casa 5: Menirea dumneavoastr e s v creai singur destinul. Trebuie s renunailaviselepersonaleisdezvoltaiautodisciplinapentruoviacreativ. Casa6:Menireadumneavoastresnvairesponsabilitatea.Trebuies renunailadorinadeaevadanfantezieisdezvoltaionouviaproductiv. Casa 7: Menirea dumneavoastr e gsirea relaiilor potrivite. Trebuie s renunailaaciunileegocentristeisvdedicaiviaaaltora. Casa 8: Menirea dumneavoastr e gsirea autocontrolului. Trebuie s renunai la atitudinile nrdcinate n vieile trecute i s punei accentul pe valorilespirituale. Casa 9: Menirea dumneavoastr e dezvoltarea capacitilor mentale superioare.Trebuiesrenunailatendineledinvieileanterioaredeafimrginit isnvaisvlrgiiperspectivele. Casa 10: Menirea dumneavoastr e gsirea demnitii n ochii celorlali. Trebuiesvpltiidinnoukarmavieiloranterioarecunelegereicompasiune, dupcarevaurmamaturizarea. Casa11:Menireadumneavoastresnvaisserviiomenirea.Trebuie s renunai la relaiile personale posesive i pasionale pentru a putea mplini serviciiledezinteresatenslujbaumanitii. Casa 12: Menirea dumneavoastr e s vedei sinele ca o parte dintrun ntreg mai mare. Trebuie s nvai controlul minii asupra materiei, pentru a transformapreocupareadesinenunitatespiritual. 180
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Mercur reprezint intelectul, bunul sim, raiunea rece, comerul i afacerile. Calitile sale sunt mobilitatea, adaptabilitatea i elasticitatea. Poziia i aspectele sale ne spun despre obiceiurile de comunicare i nvare, precum i despremodalitilenoastredegndire. Interpretri: Berbec: Suntei un gnditor independent. Vorbii repede i v place s imaginainoiidei.Sarputeasncercaisclipirideintuiie. Taur:Acordaiimportancunoateriitradiionale.nvaintromanier lent,metodiciconcret.Vagaideideilevechiisarputeasvtemeis nvaicevanou. Gemeni (domiciliu): Iubii conversaia i informaia. Suntei un vorbitor rapid, cruia i place s adune i s transmit cunotine i date. V plac crile, scrisorile, revistele, massmedia, calculatoarele i orice altceva care v ajut s nvaiiscomunicai. Rac: Acordai importan comunicrii din cadrul familiei. Informaiile despre familie i atmosfera familial sunt de asemenea importante pentru 181
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


dumneavoastr. De exemplu sar putea s v plac s strngei fotografii ale familiei sau s studiai istoria familiei. Avei grij de dumneavoastr i de alii comunicndproblemeafective. Leu (cdere): Suntei entuziast n cutarea cunoaterii. Suntei mndru de capacitile dumneavoastr de nvare i credei c nvatul e distractiv. Sar puteasaveitendinadeafiuntietot. Fecioar(domiciliu):Aveiominteplindediscernmntiputeificritici analitic.Puteidevenideasemeneaobsedatdecunoatereadetaliat.Acestlucruv ar putea fi defavorabil n viaa cotidian, dei este foarte folositor n orice fel de cercetare.Vplacesfiiprecisncomunicareacuceilali. Balan: Suntei diplomat i mpciuitor, acionnd deseori ca un intermediar n relaii. Suntei un bun vorbitor, linitindui pe alii. Certurile sar puteasvsupere,pentrucpreferaiarmoniancomunicare. Scorpion: V folosii bine resursele. Avei tendina s cercetai miezul lucrurilor,preferndacestlucruuneicunoaterisuperficiale.Sarputeasvfacei preamultegriji.Comunicareacudumneavoastreintens. Sgettor(exil):Cutaicunoatereapentruavextindeperspectivaasupra lumii.Sunteiunfilosofnnscut,bucurnduvdeoriceinformaiecarevajuts vedei tabloul general. De exemplu sar putea s v plac o dezbatere religioas. Acordaiimportanlibertiidegndireiexpresie. Capricorn: Suntei un gnditor nelept i grijuliu. Acordai importan credibilitiiiautoritii.Deaceeaveicutacunoatereacareincludeooarecare autoritate.Sarputeasabordainoileideicuprecauie. Vrstor (exaltare): Suntei plin de idei originale i ciudate. V place schimbuldeideicualii,nspecialcuprieteniiigrupuriledeoameni.Sunteiun gnditorinventivisarputeasvrevoltaimpotrivaideilorvechiitradiionale. Peti(exil):Sunteifoarteintuitiv,cuobogatimaginaie.Aveicapacitatea de a recepta gndurile celorlali. Sar putea s avei dificulti n a distinge realitateadenchipuire. Casa 1: Suntei un gnditor independent, cu capacitatea de a face schimb de informaii i idei. Suntei de asemenea curios, cutnd n mod constant informaiiidatedesprelumeadinjur. Casa2:Aveimulteideiingenioasedesprecumsfaceibani.Sarputeas ctigaibanidistribuindinformaii.Veiapreciagndirearapidiinteligena. Casa3:Excelaintoateformeledecomunicare.Sunteiinteligent,vorbre invairepede. Casa4:Cminulestepentrudumneavoastrunlocundeseschimbideii informaii. V adaptai aranjamentelor privind domiciliul. Acest lucru i poate avea originea n eventualele schimbri de locuin din copilrie. nvai mult n mediulfamilial. 182
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 5: Avei nevoie s v exprimai prin ceva creativ sau artistic. Vei apreciaproiectelecreativencrcateipreocuprilestimulatoaremental. Casa 6: Viaa cotidian e nvtorul dumneavoastr. Rutina dumneavoastr zilnic e ncrcat i stimulant. Sar putea s fii interesat s nvaidespresntate,nspecialrelaiadintreminteitrup. Casa 7: Vei considera important s vorbii i s v mprtii ideile cu partenerul.Veinvamultdinrelaiilepersonale. Casa8:Sunteidornicssondaiiscercetainelesulvieii.Sarputeas v fascineze s nvai despre sex i moarte, sau orice subiect care ptrunde dincolodesuperficial. Casa 9: Suntei dornic s cercetai trmurile cunoaterii orice v nva desprefilosofiavieii.Sarputeasfiifascinatdeculturiireligiistrine. Casa 10: Sar putea s cutai o carier n domeniul comunicrii sau educaiei.Veifidornicsvmprtiigndurileiideilenprofesiaaleas. Casa11:Comunicareacuprieteniivafiimportantpentrudumneavoastr. Veidorisvmprtiigndurileiideilecuprietenii.Deasemenea,sarputea s v plac s studiai n grupuri sau s v alturai unui grup cu convingeri comune. Casa 12: Sar putea s avei dificulti n cunoaterea propriilor gnduri, mai ales cnd suntei n grupuri mari de oameni. Avei o puternic imaginaie i capacitateadeafipurttordecuvntalmaselor.Sarputeadeasemeneasavei calitimediumnice.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




Semnificaie: Venusdezvluiecumneplacesneraportmlamediuilaaltepersoane. Suntematraiderelaiileputernice,senzualeiintense,sauprefermlibertateai independena? De asemenea, indic ce preuim, fiind astfel legat de bani i bunuri. Interpretri: Berbec (exil): Vei urmri partenerul cu nflcrare i fr chibzuial, i totuivveiluptapentrulibertateiindependen,odatceajungeintrorelaie intim. V place s fii iniiatorul n relaii i putei fi agresiv. Sar putea s fii mnspart. Taur(domiciliu):Pentrudumneavoastrdragosteaincredereamergmn n mn. Abordai relaiile ncet i constant, cutnd pe cineva care se va dovedi seriosidendejde.Vplacesenzualitateaisunteidemndencrederenprivina banilor.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Gemeni: Suntei curios i v place flirtul. Apreciai relaiile intelectuale cu schimburi de idei. Comunicarea n cadrul relaiei e important pentru dumneavoastr. Putei fi agitat i uneori v plictisii. Sar putea s avei multe planuridefcutbani. Rac: Punei accentul pe relaiile familiale. Vei forma legturi afective puternice n cadrul familiei dumneavoastr. Sar putea s avei nevoie din punct devedereafectivdesiguranfinanciar. Leu: V place distracia i creativitatea n cadrul relaiilor. Vei fi foarte mndrudeparteneruldumneavoastr.Veiapreciadeasemeneaapareneleivei fimndrudeposesiuni. Fecioar(cdere):Veicutarelaiisemnificativecuobazpractic.Veidori capartenerulsfieprecis,ngrijitipunctual.Probabilateptaiperfeciunea.Vei apreciaconversaiiledetaliateianalitice. Balan (domiciliu): Avei o mare nevoie de relaii. Vei pretinde de asemenea ca relaiile dumneavoastr s fie armonioase, linitite i creative. V placesaveibunurifrumoase. Scorpion (exil): Avei o puternic nevoie de relaii. Vei da dovad de ardoare ntro relaie. Vei dori s cunoatei gndurile cele mai ascunse ale parteneruluiinacelaitimpsarputeasaveitendinadeafiascuns. Sgettor: Vrei s mprii aventura cu partenerul, de la mprtirea ideilor ndrznee pn la cltorii n muni. Sar putea s v plac de asemenea legturile cu strinii sau vizitarea unor locuri din strintate mpreun cu partenerul. Capricorn:Sunteitimidnrelaii.Veiformaorelaiencet,darsarputea sfiededurat.Sarputeadeasemeneasnuntemeiaiorelaiedevremenvia, dar mai trziu vei avea relaii trainice i angajate. Suntei responsabil cu banii i bunuriledumneavoastr. Vrstor:Vplacrelaiileneconvenionaleiciudate,carevdaulibertatea de a v exprima propria individualitate. Preferai s vorbii dect s atingei. V placesfiintrungrupdeprieteni. Peti(exaltare):Tnjiisvcontopiicupartenerul.Defapt,vreisfiiuna cu universul. V place, de asemenea, s v bucurai mpreun cu partenerul de activitiartistice,delaascultatulmuziciipnlavizitareauneigaleriideart. Casa 1: Avei o mare capacitate de a exprima frumosul i iubirea, i de aceeasunteiatrgtorpentruceilali.Aveioconduitcalmiarmonioas. Casa 2: Apreciai bunurile frumoase iar banii v linitesc. Suntei mrinimosiaveicapacitateadeavedeafrumuseealucrurilor. Casa 3: Dorii ca n vecintatea dumneavoastr imediat lucrurile s fie frumoase. V plac excursiile scurte i vacanele. Probabil vei avea relaii armonioasecufraiiisurorile. 185
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 4: Dorii ca relaiile din cas s fie armonioase. Vrei s creai un mediufamilialfrumos. Casa5:Sunteicapabilsvexprimaicuumoricreativitateivbucur compania copiilor. Sar putea s v descoperii un impuls de a v exprima prin mijloaceartistice. Casa 6: V place ca ambiana muncii zilnice s fie linitit. Dorii relaii armonioasecuparteneriiprofesionali.Vplacunmoddeviasntosiviaade zicuzi. Casa 7: Avei capacitatea de a vedea frumosul n partenerul intim i, n consecin,vbucuraiderelaiiapropiate.Sarputeasdeveniimpciuitoruln relaie. Casa 8: Vei atrage cu uurin resurse externe. V place s ncercai transformrileciclicealevieiiisdescoperiicrelaiilepersonalepotfiintense. Casa 9: Dorii s nelegei lumea. Avei o atitudine pozitiv fa de educaiasuperioarprinstudiu,cltoriisaureligie. Casa10:Vplacrelaiileprofesionalearmonioaseiputeicreafrumosuln carier.Sarputeastindeispreperfecionismncarieradumneavoastr. Casa 11: Atragei muli prieteni i v place s v vedei cu grupuri de persoane.Sarputeasvasumaiunroldempciuitorncadrulgrupurilor. Casa12:Vplacesvabandonainnecunoscut.Sarputeasvirosiin cutarea unui viitor frumos, fr s vedei frumuseea prezentului. nvai s apreciaifrumuseealumiicareflectareaproprieipersoane.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Marteesteplanetahotrriiienergiei.Ceneimpulsioneaz?Neurmrim dorinelecuagresivitatesaustmdeoparte,lipsinduneenergia?Eanespunecene motiveazicedorineneconduccelmaiputernic. Interpretri: Berbec (domiciliu): Avei un puternic imbold de a iniia activiti. Suntei spontanivplacesvasumairiscuri.Deasemenea,sarputeasfiiimprudent ipredispuslaaccidente.Puteideveniagresivdacvisepunbeenroate. Taur (exil): Avei dorine personale puternice, dei vei urma de obicei o seriedeaciunisigurepentruavilerealiza.Sunteincpnatdaccinevavise opune. Gemeni:Vplacesiniiaiideiisrspndiiinformaii.Sunteihotrt, deiputeirecurgelauncomportamentevaziv. Rac(cdere):Aveicapacitateadealuptapentruoamenisaucauzepentru care avei sentimente puternice. V protejai n mod special familia. Cnd v e rnitpersonalitatea,vretrageincochilie. Leu:Aveiomarenevoiesvexprimaicreativitateapersonal.Sarputea s afiai un comportament dramatic i sigur de sine i s v plac s facei impresieasupracelordinjur.Sarputeasfiiarogant. Fecioar:Vveiurmridorinelepersonalentrunmodpracticimetodic. Sarputeasdeveniicriticdaccinevaviseopune. Balan (exil): Avei o mare nevoie de diplomaie i dreptate, i impulsuri creativeputernice.Sarputeasdeveniinehotrtcndcinevaviseopune. Scorpion(domiciliu):Sunteiunrzboinicpasional.Sunteidramaticisar putea s avei impulsuri sexuale puternice. Sar putea s fii un adversar rzbuntor. Sgettor: Suntei un conductor inspirat i avei o dorin puternic de cercetareiaventur.Sarputeasfiindreptatspreunsingurlucrundorinele dumneavoastr. Capricorn (exaltare): V vei urmri dorinele personale ntro manier responsabilimetodic.Aveiambiiiputerniceisarputeasdeveniidespotic dacsunteiameninat. Vrstor: Vei lupta pentru cauze drepte. Suntei imprevizibil, dar vei fi probabilunconductordegrup.Sarputeasdeveniirebelcndsunteisuprat. Peti: Avei un puternic imbold pentru o cale spiritual. Avei emoii subcontiente puternice i suntei foarte intuitiv. Sar putea s recurgei la un

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


comportament de victim cnd v confruntai cu o persoan sau situaie amenintoare. Casa 1: Avei un puternic impuls pentru autoexprimare iindependen. ntmpinaiviaadirect,frocoliuri,iputeideveniagresivdacdrumulveste blocat.Puteifiimprudent. Casa 2: Avei o abordare agresiv asupra chestiunii banilor. Punei pe picior de egalitate fora i puterea cu banii i bunurile. Vei dezvolta un set de valoridurabil. Casa3:Aveicapacitateadeavafirmagndurileiideilecuputere.Facei impresieasupracelordinjuriputeincercaciocniricufraiiisurorile. Casa4:Cutaiaciuneiindependennmediulfamilial.Cndceilalidin casardorisseodihneasc,dumneavoastrvreispuneilucrurilenmicare. Dumneavoastr,sauunmembrudefamilie,sarputeasfifostagresivncasn timpulcopilriei. Casa 5: Avei un puternic impuls de a v exprima creativ. Sar putea de asemenea s gsii competiia distractiv. Copiii dumneavoastr sar putea s fie independeni. Casa6:Veiabordaviaacotidiancuvigoareisarputeasluptaipentru sau cu partenerii de munc. Sar putea s v extenuai fizic. Vei beneficia de pe urmapracticiizilnice. Casa 7: Avei un puternic impuls pentru relaii personale. V place s rmneintrorelaieapropiat. Casa 8: Cutai cu seriozitate aventurile comune. Cercetai de asemenea nelesulciclurilorvieii.Sarputeasaveiimpulsurisexualeputernice. Casa 9: Cutai aventura prin cltorii, studiu sau religie. Suntei n cutareanelesuluisuperioralvieii. Casa10:Sunteiambiios,cutndputereprinintermediulcarierei.Aceasta ar putea implica o lupt pentru prima poziie. vei nevoie de autonomie i independennprofesiadumneavoastr. Casa 11: Avei un impuls de a v face muli prieteni, i sar putea s v asumairoluldeliderngrupuri.Sarputeasvreisvimpuneivoinaasupra asociailor. Casa12:Contiinaputeriipersonalevestecumvaerodat.Sarputeas ncercaiizbucniriemoionale,aparentdinsenin.Sarputeadeasemeneasavei uneoriovagsenzaiedepierdereadireciei.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Vesta reprezint problema angajamentului. Aceasta include angajamentul ctremuncirelaii.Undeneesteangajamentul?Undeneconcentrmenergiile? Interpretri: Berbec(exaltare):Vbazaipepropriileforeivurmriipropriilescopuri n munc, uneori excluznd celelalte persoane. V dedicai propriilor idei i v placeslucraisingur.Luptaipentruindependenisunteinmsursobinei succesepersonale.Sarputeasvnstrinaideceiapropiai. Taur: Avei capacitatea de a munci n mod stabil i tenace. V dedicai muncii ntro manier confortabil i previzibil. Trebuie s evitai s devenii inflexibil. Gemeni: Planificarea i coordonarea sunt doi factori cheie n munca dumneavoastr. V place s comunicai i s schimbai informaii, mai ales la

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


serviciu. Avei tendina s evitai emoiile, n favoarea conversaiilor intelectuale. Puteifiunscriitorprofesionist. Rac (exil): V dedicai familiei i celor dragi, mai ales cnd au nevoie de dumneavoastr.Totui,vputeiretragenpropriacarapacecndvsimiirnit deceiapropiai.Vfaceplcereslucraicuceiapropiai. Leu: Munca v este plin de creativitate cnd suntei lsat s lucrai aa cum tii dumneavoastr. Suntei mndru de munca dumneavoastr i suntei inspiratmaialesdedragosteidistracii.Joculimuncasuntstrnslegatepentru dumneavoastr. Fecioar:Aveiolinieperfecionist.Depuneimultefortiateptaiacelai lucrudinparteacelorlali.Trebuiesevitaisfiipreacritic.Catrsturpozitiv, sunteicapabilsstabiliiprogrameeficienteiproductivenplanprofesional. Balan (cdere): Preferai s lucrai cu alte persoane, mai degrab dect singur. V place s mprii resursele de lucru i n acelai timp avei nevoie s urmriisnudeveniipreacompetitiv.Vreisfiirecunoscutcaegal. Scorpion:Vdedicaiintensmunciidumneavoastr.Druireaiputereade concentrare sunt puncte cheie n munca dumneavoastr. Probleme legate de morala sexual pot aprea cu precdere deoarece cutai s nclcai obiceiurile sexualeexistentesau,dimpotriv,vreprimaidorinelesexualeprintruncodetic strict. Sgettor: Avei capacitatea de a lucra neobosit pentru o cauz n care credei.Doriisvasiguraicnuexcludeipuncteledevederealealtora.Avei ideiivplaceaventuradescopeririinmuncadumneavoastr. Capricorn(domiciliu):Acordaiimportanorganizriiiordiniilaloculde munc. Suntei foarte disciplinat i ambiios i putei avea succes n poziii administrative i manageriale. Subordonaii vor descoperi n dumneavoastr simulstabilitiiiautoritii. Vrstor:Celmaibinelucraintroatmosferdelibertateiaveitendina deaevadadinrutin.Vveiangajancauzeumanitaresaupoliticecarenuvinn contradiciecupropriuldumneavoastrsimalindividualitii. Peti:Celmaibinemunciicnddepuneieforturipentruaserviomenirea. Vaiangajatsfaceilumeaunlocmaibunpentrufiecare.Vsimiicopleitde muncdacnuvconcentraiserviciilenslujbaaltora. Casa 1: V concentrai asupra propriei persoane. Sar putea s fii egoist sauincapabildeameninerelaiidelungduratcualii.Aveicapacitateadeav concentra asupra scopurilor dumneavoastr autoimpuse. Perseverena v poate conducectremarirealizripersonale. Casa2:Sunteidedicatpropriilorvalori.Sunteicapabildeasemeneasv concentrai pentru a asigura confortul financiar i fizic pentru dumneavoastr i ceilali.Puteifitenacencutareaobineriidebunuri. 190
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 3: V dedicai comunicrii clare i adevrului. Putei si ajutai pe ceilali s vad lucrurile clar. Sar putea s avei o profesie legat de domeniul mental. Casa 4: V dedicai familiei i cminului. Avei capacitatea de a veghea asupra altor membri ai familiei. Sar putea s fi ncercat responsabiliti suplimentarencopilrie,caresvfipregtitpentruacestroldemaitrziu. Casa 5: V vei concentra asupra proiectelor creatoare. Avei druirea i perseverena care pot produce lucrri de valoare. De asemenea v putei dedica copiilor. Casa 6: Suntei angajat si servii pe alii. De asemenea v putei oferi serviciileprinvindecare. Casa7:Vconcentraiasuprarelaiilorintime.Vaidedicatmunciiasupra proprieipersoaneiroluluidumneavoastrnrelaiileapropiate,ivputeifixa asuprauneipersoaneimportante. Casa 8: V dedicai descoperii misterelor vieii. Suntei capabil s descoperii adevruri metafizice pe care vrei s le mprtii altora. Putei avea uneledificultidacunelepersoanenuvorsptrunddincolodesuperficial. Casa 9: V concentrai asupra descoperirii marilor adevruri n via. Pe parcursputeifiacaparatdeunulsaudoucrezurifanatice.Totui,nfinalvvei angajasvmprtiiadevrurilefilosoficeculumea. Casa 10: Suntei dedicat propriei cariere. Asociai cariera cu disciplina, atitudinea critic i nevoia de perfeciune. Putei ntmpina greuti n urmrirea uneisingureprofesiidacdeveniipreazelosndorinadeperfeciune. Casa11:Vdedicaiproceselordegrupiidealurilor.Simiidorinadea v defini propriile crezuri i idei, dar aceasta numai n msura n care putei perseveranangajamentulprivindroluldumneavoastrncadrulcolectivitii. Casa12:Vdedicaiuneicidevalorispirituale.Sunteiadeptulunuimod spiritual de a tri. Sar putea s plonjai n necunoscut i s mprtii descoperirile celorlali. Putei fi angajat n munca din cadrul unei organizaii spirituale.

Semnificaie: Palas ne spune cum percepem lucrurile, despre inteligena noastr creatoare. Este o chestiune mai mult mental dect emoional. Arat capacitatea noastr de gndire original. Avem capaciti artistice? Cum ne exprimm creativitateamental?

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Berbec: Avei un intelect ascuit i capacitatea de a veni cu idei noi i pasionante. Suntei de asemenea fericit s riscai punerea ideilor dumneavoastr originalenaplicare. Taur:Aveicapacitateadeavedeafrumuseeannaturiarte.Aveimult bunsiminelepciune.Sarputeasvimplicainaciunidevindecarepropriu zisesaudevindecareapmntuluiprinmicriecologiste. Gemeni (domiciliu): Avei o minte ascuit, capabil s neleag multe concepte.Aadarsunteidotatattpentrucomunicareaoralctiscris. Rac:Sunteifoarteintuitiv.Vbazaipepropriileemoiipentruavghida opiniile i gndurile. Suntei un asculttor empatic i dorii foarte mult s comunicaicufamiliaicuceidragi. Leu (exaltare): Avei o minte creatoare, pe care o folosii cu satisfacie. V place s v jucai cu cuvintele. Sar putea s scriei sau s fii implicat ntrun procesdecreaienlumeaartelor. Fecioar: Avei o minte analitic pe care o folosii n proiecte detaliate i exhaustive.Putereadumneavoastrdediscriminareestemare.Aveideasemenea capacitiexecutive.Sarputeasfiiimplicatndomeniuladevrului. Balan:Sunteicapabilsvedeiambelefeealeproblemeiiajutaiprile adversesajunglaonelegere.Sunteiundiplomatiunaprtoraldreptii. Scorpion: Avei o minte iscoditoare prefernd ntotdeauna s ajungei n miezul lucrurilor. Putei fi nemilos n cutarea variantei adevrate. Suntei un detectiviunpsiholog. Sgettor (exil): Avei capacitatea de a vedea imaginea general. V plac discuiilepsihologiceiputeiincludetoateculturilensistemuldumneavoastrde valori.Sunteiunaprtoraladevrului. Capricorn: Avei nelepciune i capacitatea de a v organiza gndurile. Mintea dumneavoastr face fa cu brio planurilor i v place s punei lucrurile acoloundeleelocul. Vrstor(cdere):Minteadumneavoastrpoatefistrlucitoare,originali ptrunztoare.Sunteicapabilsprindeirepedenoiideiisleaplicainviitor. Luptaipentrupropriileidealuriipentrucauzeumanitaresaupolitice. Peti: Avei o minte meditativ, capacitatea de a v contopi mental cu universul. Dorii s vindecai lumea prin cuvinte i sar putea s fii implicat n uneleformedeexprimareartistic. Casa 1: V exprimai ca un individ creativ i original. Aprei concentrat asupra unor preocupri mentale i detaat de simminte. Sar putea s sfidai stereotipurileconvenionalemasculin/feminin.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 2: Suntei talentat i creativ. Obinei bani i bunuri prin strategii creatoare.Vpreuiioriginalitatea. Casa 3: Suntei foarte inteligent i dornic de cunoatere. Capacitatea de comunicareesteremarcabil.Aveimulteideicreatoareioriginale. Casa 4: Casa i familia v reflect creativitatea. Avei nelepciune, care izvortedincunoatereadesine. Casa5:Aveimulteideicreatoareioriginale.Puteiaveatalenteartistice. Aveicapacitateadeavconcentraasupralucrrilordumneavoastrcreatoare.S arputeasvbucuraidecompaniaunorcopiiinteligeni. Casa6:Aveiunmodinteligentdentocmireaprogramuluizilnic,attla lucructiacas.Puteifideasemeneaunvindectornnscutsauunaprtoral drepturilorcelorcemuncesc. Casa7:Aveimultnelepciunecuprivirelalegturiledintreoameni.Sar puteasfiiunbunsftuitor.Puteiaveadificultinmprtireasentimentelor cuparteneriiintimi. Casa8:Aveiobunintuiieiputeiaveacapacitimediumnice.Suntei capabilscercetaimisterelevieiicunelegereiinteligen.Deasemenea,avei talentecreatoarenproiectelecomune. Casa9:Aveiominteascuit,cucapacitateadeavedeaimagineageneral. Suntei dornic s v mprtii cunotinele dumneavoastr avansate i propria filosofie. Casa 10: Suntei priceput n carier. Avei capacitatea de a v planifica i modelapropriadirecienvia.Aveicapacitiexecutive.Carieradumneavoastr poateincludeutilizareatalentelorcreatoare. Casa11:Aveicapacitateadealucracuideicarefolosescomenirii.Suntei priceputlaorganizareilalucrulcugrupuri.Sarputeasaveiprietenicufuncii executivecaresvajutesinfluenaisocietatea. Casa 12: Avei capacitatea de a nelege i comunica nvturi spirituale. Ideile dumneavoastr creatoare pot folosi omenirii. Sar putea s vi se cear sacrificii personale pentru ca nelepciunea dumneavoastr s fie folosit pentru binelentregului.

Semnificaie: Iuno este asteroidul relaiilor potrivite n cadrul cstoriei. Ne spune despre problemele de cinste sau necinste n csnicie. Arat de asemenea capacitateadeangajarenrelaii.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Berbec(exil):Aveinevoiedelibertatencadrulrelaiilordumneavoastri puteideveninervosdacaceastavesterefuzat.Dacnuvexprimainevoiade independen,puteiatrageunpartenerdominant. Taur(exaltare):Aveinevoiesvsimiilinititinsigurannrelaiile dumneavoastr. Vrei un partener de ncredere i stabil i probabil dorii o cstorietradiional. Gemeni: Dorii varietate i stimulare n cadrul relaiei dumneavoastr. Conversaia,schimbuldeidei,scrisul,planificareaistudiulsunttoatemodaliti princarevputeimanifestanevoiadecomunicarecuparteneruldumneavoastr. Rac (domiciliu): Dorii o legtur emoional strns i plin de grij cu parteneruldumneavoastr.Vreismpriicasaimasacuceliubit. Leu: Vrei s fii mndru de partener, i el de dumneavoastr. Dorii distracie,romantismicreativitatencadrulrelaiei. Fecioar: Cutai partenerul perfect i sar putea s trebuiasc s v adaptai pentru a putea accepta mai puin dect perfeciunea. avei nevoie de un partenercaresseocupededetaliiiscontribuielamuncilegospodretizilnice. Balan (domiciliu): Vrei ca partenerul dumneavoastr s v considere un egal. Pacea i armonia sunt de asemenea componente vitale n relaiile dumneavoastr.ncazdeinsucces,puteideveninecooperant. Scorpion (cdere): Dorii o relaie intens i sexual. Vrei atenia total a parteneruluiicereiungradnaltdesenzualitate. Sgettor: Ai dori un partener cu un sistem de valori sau concepii comune. Vrei s fii liber s explorai lumea, efectiv i din punct de vedere filosofic,cuparteneruldumneavoastr. Capricorn(exil):Doriiunpartenerpecareslputeirespectaicaresv respecte.Cutaiunangajamentpetermenlungisarputeasvcstoriimai trziunvia. Vrstor:Doriilibertateadeafidumneavoastrnivntrorelaie.Dac nuoputeigsi,deveniirebelineserios.Esteimprobabilsvsimiibinentro relaietradiional. Peti: Vrei s fii una cu lumea prin relaia dumneavoastr. Tnjii dup cele mai nalte idealuri romantice n cadrul relaiei i suntei deziluzionat de realitate. Casa1:Sunteifoarteatentlamodulcuminteracionaicualioameni.Sar puteasvsimiimaicapabildeafidumneavoastrnivcndaveiorelaien carevgsiisprijin.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 2: Preuii sigurana material n cadrul relaiilor. Banii i bunurile mprite vor fi importante pentru dumneavoastr. Pot aprea probleme n jurul resurselorcomune. Casa 3: Dorii s comunicai cu partenerul intim. Conversaia i schimbul de idei cu ceilali vor fi de asemenea importante. Relaiile var putea ajuta s v nelegeipedumneavoastrniv. Casa 4: Relaiile v vor furniza o temelie stabil n via. Vei aprecia relaiile familiale. Orice persoan iubit mprind casa dumneavoastr v va atragedruireailoialitatea. Casa 5: Dorii s v distrai i s mprii preocuprile creative cu partenerul. Cutai de asemenea pe cineva care se va dovedi un bun printe, pentrucsunteidestinatsaveiorelaiebuncucopiiidumneavoastr. Casa 6: Vrei s muncii armonios, zi de zi, cu partenerul. mprirea greutilor i deciziilor cotidiene va fi important pentru dumneavoastr. Colegii deserviciuarputeajucadeasemeneaunrolimportantnviaadumneavoastr. Casa7:Doriiocstoriesauorelaieangajat.Formareauneirelaiiintime petermenlungvafiunuldinscopuriledumneavoastr. Casa 8: Dorii intensitate emoional n relaiile dumneavoastr. Suntei interesat de schimbarea i devenirea mpreun cu partenerul, posibil explornd intimitateasexual.Veivreasvmpriiresurselecupartenerul. Casa 9: Vrei s schimbai adevruri filosofice cu partenerul. Relaiile dumneavoastr vor trebui s includ explorarea mpreun a lumii prin cltorii, studii,interesprivindstrintateasaufilosofia. Casa10:Sunteidedicatcarierei.Sarputeasalegeiunpartenercaresv ntreasc poziia n societate. Partenerul va trebui s fie implicat n cariera dumneavoastr. Casa 11: Prietenia va fi un element important n relaiile dumneavoastr personale. Vei dori s aprei n public mpreun cu partenerul i sar putea s doriisintraimpreunngrupurisauasociaii. Casa12:Sarputeassimiicrelaiiledumneavoastrpersonalesuntde naturkarmicsaupredestinate.Veidorisvcontopiicupartenerul.

Semnificaie: Ceresreprezintsprijinulihrnirea.Deaceeadezvluieinformaiidespre relaia mamcopil. Arat cum i sprijinim pe alii i cum avem nevoie s fim sprijinii. Ne spune de asemenea despre capacitatea de a ne iubi i ai iubi pe ceilalinecondiionat.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Berbec: V simii susinut cnd vi se permite s fii independent. Credei deasemeneaccelmaibunmoddeaartacuivacineilaelestesllsaisfie elnsui.Veisuferidacvveisimidominatsaunctuat. Taur:Vsimiisusinutcndceidragivoferstabilitateisiguran.V place s fii atins, mngiat i sprijinit n mod practic. De asemenea, v place s artaialtoracineilaeiprinmijloacepractice. Gemeni: V place ca cei apropiai s v mprteasc sentimentele i gndurile i s v asculte. Schimbai informaii cu cei dragi pentru a le arta c ineilaei.Suferiicndceilalirefuzsvorbeasc. Rac (domiciliu): Capacitatea de ai sprijini pe ceilali este strns legat de propriadumneavoastrrelaiecumama.Dacaiavutorelaieapropiatiplin de dragoste cu mama dumneavoastr, atunci v vei bucura de acelai lucru cu ceilalinviaadeadult.Dacnu,sarputeasformairelaiidependente. Leu:Vsimiiocrotitcndceilaliseocupdedumneavoastrivlaud. Vplacesleartaialtoracineilaeincurajnduletalentelecreatoareigustul pentrudistracii. Fecioar(cdere):Vsimiiocrotitcndoameniivajutsvperfecionai talentele.Vreisiajutaipealii. Balan: V simii ocrotit cnd cei dragi creeaz o atmosfer de pace i frumusee.Vplacescooperaicuceiapropiai. Scorpion: V simii ocrotit cnd cei dragi i concentreaz intens atenia asupradumneavoastr.Vdedicaisufletetecelorapropiai. Sgettor:Preferaicaceidragisvsatisfacsimulaventuriiilibertii. Vsimiisusinutcndvisepermitescercetaiisvatingeiscopurile. Capricorn (exil): Avei tendina s ngrijii de dumneavoastr i de alii dectscutaialinare.Vsimiisusinutcndvmpliniiambiiile.invaipe ceilaliautodisciplinaicumsiatingscopurile. Vrstor: V simii susinut cnd ceilali v accept i ncurajeaz simul individualitii.Vsimiibinecndsunteinconjuratdegrupuridepersoane.i nvaipeceilalisiaccepteexcentricitile. Peti(exaltare):Vsimiiocrotitmaialescndncercaisenzaiadeunitate cu lumea. V ngrijii de alii alinndule durerea. Simii compasiune pentru cei dragi. Casa1:Apreicaopersoansensibilimiloas.Vplacesaveigrijde alii i ei sunt atrai de natura dumneavoastr cald. Trebuie s nvai s v ngrijiiidedumneavoastr. Casa2:Druiicugenerozitatedinbaniiibunuriledumneavoastr.Acesta estemoduldumneavoastrdeaaveagrijdeceiapropiai.Deasemenea,vplace 196
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


s v rsfai cumprnd articole de lux. Trebuie s v ferii s nu v ataai de bunurilemateriale. Casa 3: Suntei generos n laude. V place de asemenea s avei grij de alii,asigurnduvcsuntlacurentcuultimeleinformaii.Sunteiunbunlucrtor n echip. Trebuie s avei grij s primii i dumneavoastr un beneficiu din aceastmuncnechip. Casa 4: Este vital pentru dumneavoastr s avei grij de familie sau de oricineseaflncasadumneavoastr.Roluldeprintevafiopiatrdetemelien viaa dumneavoastr. Sar putea s avei o legtur puternic i idealizat cu mama. Casa5:Modulncareaveigrijdedumneavoastridealiiestecreativ, artistic i distractiv. Suntei prietenos i ocrotitor cu copiii. Ceilali sunt atrai de voioiadumneavoastr. Casa6:Aveigrijdeceidragiasigurnduleunprogramzilnicechilibrat. V simii susinut cnd v preocupai de detaliile cotidiene. Acestea pot include muncilegospodreti,serviciulisntatea.Sunteiprietenoscndiserviipealii. Casa7:Sunteiiubitoriocrotitorcupartenerul.Deasemeneaaveinevoie sfiiiubit.Sarputeasdeveniidependentdeparteneruldumneavoastr. Casa 8: V simii ocrotit cnd trii emoii profunde i intense. V putei ngriji de dumneavoastr implicnduv n probleme metafizice. Sar putea s gsiisausdruiiconfortnexperienelesexuale;sausaveigrijdeceicesunt pemoarte. Casa 9: Sprijinul pentru dumneavoastr nseamn acumularea de cunotine despre lume. Aceasta se poate realiza prin cltorii, studiu, culturi strinesaufilosofie.Aveigrijdealiiprinmprtireadecunotine. Casa10:Aveigrijdealiiprinprofesie.Puteialegeoprofesiecuscopde ngrijiresaupurisimpluaduceibuntate,cldurinelegerenprofesiaaleas. Casa 11: inei la prieteni i suntei un sprijinitor plcut n cadrul grupurilor. V place de asemenea s fii iubit i protejat de prietenii dumneavoastrivsimiinsiguranngrupuriledeoameni. Casa 12: V sprijinii pe dumneavoastr i pe alii cnd simii c druii universului.Sarputeassuferiipierderisauboli.Leciadumneavoastrestesi ajutaipeceilalicaresufer.

Semnificaie: Higeianespunedespreproblemeledesntate,caresentinddelasimpla staredesntatepnlaleciilepecarelenvmsaunudinaceaststare.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Berbec:Doriimultsaveiunmoddeviasntosiiniiaiprogramede pstrare a condiiei fizice. Suntei nerbdtor s v depii momentele de boal. Acesteapotfisemnecartrebuisncetiniiritmul. Taur: Confortul i buna sntate sunt importante. Suntei predispus la mbolnvirecndnunaintainaltesferealevieiidumneavoastr. Gemeni: Suntei dornic s adunai cunotine despre sntate. Sntatea mental i legturile dintre minte i trup pot fi reprezentative n viaa dumneavoastr. Rac (cdere): Sntatea dumneavoastr poate fi strns leget de mediul familial.Oricediscordanncasseregsetenapariiaunorneregulinsntate. Sarputeasfiingrijoratcuprivirelasntateaproprieifamilii. Leu: Suntei mndru de sntatea dumneavoastr. Putei avea preocupri legatedesntate. Fecioar (domiciliu): Sntatea are o importan deosebit n viaa dumneavoastr. Cnd viaa devine dezorganizat, sntatea are de suferit. Lecia este s recunoatei legturile dintre minte i trup i s meninei un regim zilnic sntos. Balan:Dezechilibrulnviavaconducelambolnvire.Vedeilegturile dintresntateifrumusee.Doriismprtiiceeacenelegei. Scorpion: Vei ncerca cicluri de boal i sntate. Lecia este s realizai legturile dintre psihic i sntate. Aspecte legate de sntatea sexual pot fi de asemeneaprezentenviaadumneavoastr. Sgettor:Vplacesvedeicumsntateasencadreaznansamblu.Sar puteasstudiaisauspredaidespreproblemeledesntateglobal. Capricorn (exaltare): Avei mult nelepciune privind problemele de sntate. Sar putea ca mai trziu s devenii o autoritate n chestiunile legate de sntate. Vrstor:Vplacesvmenineinformcuprietenii,practicndexerciii de meninere a condiiei fizice sau fcnd parte din grupuri sportive. Suntei preocupatdesntateaplanetei. Peti (exil): Sntatea spiritual a lumii este important pentru dumneavoastr. Putei vedea legturile dintre sntatea fizic i cea spiritual i dorii s mprtii tuturor ceea ce nelegei. Sar putea s suferii perioade de boalnspital. Casa 1: Sntatea este important pentru dumneavoastr. Aceasta poate rezultadincauzaproblemedesntatedincopilriesaudindorinadeafivzut ca sntos. nvai mult despre dumneavoastr prin nelegerea propriei stri de sntate. 198
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa2:Vpreuiisntatea.Respectuldesinevestelegatdesntate.S ar putea s nvai legturile dintre armonia emoional i sntatea fizic. Sar puteasctigaibanicavindector. Casa 3: Aspecte legate de sntatea mental ar putea fi prezente n viaa dumneavoastr. Fraii i surorile sar putea s fi suferit boli. Suntei dornic s nvaidespreproblemeledesntate.Sunteiinteresatdelegturiledintreminte itrup. Casa4:Sntateadumneavoastrpoatefistrnslegatdemediulfamilial. Orice discordan n cas se regsete n apariia unor nereguli n sntate. Sar puteasfiingrijoratcuprivirelasntateaproprieifamilii. Casa5:Aveimulteplanuricreatoaredesprecumsfiisntos.Vplace svpetreceitimpulplanificnddietacopiilor.Sarputeasaveipasiunilegate desntate. Casa6:Sntateapoatefioproblempentrudumneavoastr.Leciaarfis recunoateilegturiledintreminteitrupismenineiunregimzilnicsntos. Casa 7: Relaiile v vor furniza arena unde vei nva despre problemele desntate.Parteneruldumneavoastrarputeafibolnaviarputeaaveanevoie de sprijin sau dumneavoastr suntei n suferin i avei nevoie de ngrijire. ntrunanumitmod,stareadesntateaparteneruluivarputeaservidreptlecie. Respectarea mpreun a regimurilor de meninere a condiiei fizice ar putea fi o practicbinevenit. Casa 8: V place s v adncii n subiectele legate de sntate pentru a nelegetendineleascunse.Moarteaarputeafiofascinaie.Sarputeasintrain proiecte comune legate de sntate. Aspecte legatede sntateasexual pot fi de asemeneaprezentenviaadumneavoastr. Casa 9: V place s vedei cum sntatea se ncadreaz n ansamblu. Sar puteasstudiaiieventualspredaisubiectelegatedesntateaplanetei. Casa 10: Direcia vieii dumneavoastr ar putea fi legat de sntate. Sar puteasalegeiocarierndomeniulsntiisausntateavvaafectacariera. Casa11:Sarputeasvalturaiunuigrupdemeninereacondiieifizice sau unei organizaii angajat n probleme de sntate, unde v vei face prieteni. Vplacesfiinformalturideprieteni. Casa 12: Sntatea spiritual a lumii este important pentru dumneavoastr. Putei vedea legturile dintre sntatea fizic i cea spiritual i doriismprtiituturorceeacenelegei.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Astreea reprezint incapacitatea de a renuna. Indic blocajele care ne mpiedicsvedemcndunlucrusaterminat,gatasnceapcevanou. Interpretri: Berbec: Suntei incapabil s renunai la independen. Vrei s continuai sfaceilucruriledupcumdoriicndarfitimpulsncepeiscooperai. Taur (exil): Este posibil s rmnei blocat n propriile modaliti de a aborda lucrurile i s v opunei schimbrii. Preferai confortul i sigurana lucrurilorcunoscutenesiguraneinoului. Gemeni: Avei dificulti n a v hotr. Preferai s v pstrai toate opiuniledeschiseisarputeaspierdeiocaziiledeaaflanoiidei. Rac(cdere):Sunteiincapabilsveliberaidefamilie.Preferaiconfortul propriuluicminsenzaiilorunuimediudeschis. Leu: V lipsete spontaneitatea i este posibil s rmnei blocat ntrun proiectcreator.Mndriavpoatempiedicasvdistrai. Fecioar: Atenia ctre detaliu i nevoia de perfeciune v pot bloca productivitatea. Suntei ovitor n privina schimbrii rutinei zilnice chiar mult timpdupceaceastaiadepitperioadadeutilitate. Balan: Spiritul de corectitudine v oprete din lupta pentru propria independen. Suntei att de preocupat si satisfacei pe cei dimprejurul dumneavoastrnctnumaiaveitimppentrupropriileproiecte. Scorpion(domiciliu):Sunteiincapabilsveliberaideproiectelecomunei cutairesurseexteriore. Sgettor: Suntei incapabil s renunai la sistemul dumneavoastr personaldecredinepentruafacelocunuiamaicuprinztor. Capricorn (exaltare): Nevoia dumneavoastr de respect v st n drumul realizriiambiiilor.Sunteiprudentiputeipierdeoportunitidatoritfriciidea apreanechibzuit. Vrstor: Incapacitatea dumneavoastr de a v conforma ateptrilor celorlalivopretedinrealizareapropriiloridealuri. Peti:Sunteiincapabildeavedeaunitateanlume.Vagaidepropriul dumneavoastradevrspiritualconsiderndcesteunuluniversal.Vestefrics nufiicopleitdealii.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa1:Sunteiincapabildeavvedeanmodulncarevvdalii.Putei avea greuti n schimbarea modului cum v prezentai. V agai de modurile cumaiacionatntrecut. Casa2:Vconcentraiasuprabaniloribunurilordumneavoastriavei problemenasumareariscurilorfinanciare. Casa3:Vestegreusvschimbaiprerileisacceptaidiferitepuncte devedere.Nusunteipreadeschisctrenoileformedecunoatereicomunicare. Casa4:Sunteiretras.oviinprivinaprsiriicminuluiicercetriide noiorizonturi.Sarputeasvascundeinspatelefamiliei. Casa 5: Avei o aversiune de a fi creativ i de a ncepe noi ocupaii. Sar putea de asemenea s fii ezitant n ceea ce privete distracia. Lipsa dumneavoastr de spontaneitate sar putea evidenia cnd suntei n compania copiilor. Casa6:Sunteiopersoanaobiceiurilor.Aveiunprogramzilnicstrictpe care nu dorii sl schimbai. Sar putea s avei dificulti la nceperea de noi proiecte. Casa 7: Suntei incapabil s renunai la relaiile personale. De asemenea, avei dificulti n acordarea libertii partenerului. Sar putea s nu renunai atuncicndorelaiepersonalestegatasseschimbesaussesfreasc. Casa 8: Suntei incapabil s v eliberai de proiectele comune. Perseverai nc mult timp dup ce greelile trecutului au ieit la suprafa. Sar putea s v temeisriscaicuresurselealtorpersoane. Casa 9: Avei tendine fanatice. Sar putea s fii un adept fervent al unei anumitefilosofii,frcapacitateadeavedeaadevrurilealtoroameni. Casa10:Sunteiovitorcndestevorbasfaceischimbrisauajustrin carieradumneavoastr.Aveidificultinasumarearisculuinprofesiaaleassau prsireavechiuluipentruafacelocnoului. Casa 11: Suntei incapabil s renunai la prieteni. Avei dificulti n prsireagrupurilor.Aderailascopurileiideiledumneavoastrchiarmulttimp dupceacesteaiaudepitperioadadeutilitate. Casa 12: Suntei incapabil de a vedea unitatea n lume. V agai de propriul dumneavoastr adevr spiritual considernd c este unul universal. V estefricsnufiicopleitdealii. 201
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Jupiter este planeta expansiunii, abundenei i nelepciunii. Subliniaz zonelencaretnjimsdescoperimmariadevruri.Deaceeapoatefideasemenea legatdeexces.Cutmmaimultimaimult,attctputemnvaadevrurimai mari.Estecuttorul.Gsimncutare. Interpretri: Berbec: Suntei iubitor de libertate, un cercettor spontan al adevrului. Aveiposibilitateadeafiunconductorfilosoficsaureligios. Taur:Sunteintropermanentcutareaadevrului.Aveicapacitateade afiunnvtorloialinelept.Aveioputernicdorindeabunden. Gemeni(exil):Cutaiunschimbconstantdeinformaii.Sunteiunelevsau unnvtorinconstant. Rac (exaltare): Avei un puternic impuls de a avea grij de cei dragi. Sar puteadeasemeneasfiiidealist.Esteposibilsaveiofamilienumeroas,saus simiiclumeaestefamiliadumneavoastr. Leu: Suntei binevoitor, generos i iubitor de distracie. Suntei ntro cutare entuziast a exprimrii creative. Sar putea de asemenea s iubii mult copiii. Fecioar (cdere): Avei o puternic dorin de a fi de folos. Avei idealuri naltereligioasesauspirituale,darioobsesienprivinaperfeciuniidetaliilor. Balan: V preocup mult dreptatea. Suntei un nvtor diplomat i v exprimaivalorilespiritualencadrulrelaiilor. Scorpion: Suntei ntro cutare intens a adevrului. Avei o puternic dorin de uniune sexual i proiecte comune. Ai putea fi un nvtor transformator. Sgettor (domiciliu): Iubii aventura, filosofia, studiul, religia i culturile strine.Aiputeafiunnvtorentuziastiinspirat. Capricorn (cdere): Avei integritate i valori tradiionale. De asemenea cutaiunstatutprofesionalirecunoatereiputeifipreocupatexcesivdelitera legii. Vrstor:Sunteiuncuttoralnouluiiinspiraiei.Aveivaloriuniversale isunteiunumanitarist. Peti (exaltare): Suntei ntro cutare intuitiv a adevrului. Suntei tipul subordonatului.Aiputeafiunnvtorspiritualsaureligios.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 1: Avei o personalitate supradimensionat i capacitatea de ai nsufleipeceilali.Aiputeafiunpredicatori/saunvtornnscut. Casa 2: Obinei mare satisfacie prin intermediul bunurilor. Respectul de sinecreteprinsporireabaniloribunurilor. Casa3:Sunteiunmaregnditorivorbitor.Cutaireeledecomunicare n continu expansiune i i inspirai pe alii prin puterea dumneavoastr de ptrundere. Casa 4: V plac familiile numeroase. Sar putea s v conducei viaa familialdupprincipiiledumneavoastrfilosoficesaureligioase.Sarputeasv cutainelesulvieiincepnddinmediulfamilial. Casa 5: Cutai moduri de a v extinde posibilitile de autoexprimare creativ.Sarputeasfiiinspiratdecopiisauviceversa.Vplacelibertateadeav exprimaspirituldeamuzamenticreativitate. Casa 6: Programul cotidian, munca i sntatea au o semnificaie importantnviaadumneavoastr.Sarputeasincludeiconvingerilepersonale nmuncazilnicipreocuprilepentrusntate. Casa7:Cutaisvdezvoltaipersonalitateaiconvingerilefilosoficeprin intermediul relaiilor. Sar putea s atragei parteneri cu nclinaii spirituale. Relaiilesuntdeobiceibeneficenviaadumneavoastr. Casa 8: Proiectele comune sunt mijloacele dumneavoastr de dezvoltare personal.Baniiibunurilealtorasarputeadovedideasemeneabeneficepentru dumneavoastr. Casa 9: ntreprindei o cutare avid a nelesului vieii. Mereu cutai cunoaterea prin filosofie, religie, studiu i cltorii. Vastele cunotine sunt baza nelepciuniidumneavoastr. Casa10:Profesiaiviaapublicsuntmijloaceledumneavoastrdeagsi iexprimanelesulvieii.Sarputeasaveionevoiedincencemaiputernicde recunoaterepublic. Casa 11: Avei un cerc de prieteni n continu cretere. Scopurile i perspectivelesarputeadeasemeneasdevinimportantencutareanelesului vieii.Aiputeaaveacapacitateadeansufleigrupurimarideoameni. Casa 12: Cutai nelesul vieii nuntrul dumneavoastr. n cele mai disperate momente ale vieii, avei capacitatea de a v cufunda adnc ntro fntndeoptimism.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Saturn reprezint responsabilitatea, graniele i organizarea; organizarea care furnizeaz un cadru pozitiv n care putem construi sau organizarea care ne limiteazdezvoltareainesiletesnereconsidermrspunderileicalitile. Interpretri: Berbec(cdere):Sunteidescurcreicapabildeaaplicanoimetodentro manierpractic.Leciiledumneavoastrsuntrbdareaincredereansine. Taur: Suntei un muncitor lent dar metodic, cu capaciti practice administrative.Deasemenea,sunteistruitor. Gemeni:Sunteiungnditordisciplinatilogiccucapacitateadeaorganiza detaliile.Preferaivorbireadirect. Rac (exil): Sar putea s fii inhibat emoional i timid. Sar putea s v simiiizolatncadrulproprieifamiliiitotuiveiluanseriosresponsabilitile familiale.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Leu(cdere):Sunteimndrudemuncadumneavoastriaveicapacitatea de a v construi autoritatea personal. Tindei s muncii pentru recunoatere i putere. Fecioar:Sunteimuncitor,practicicapabilsrezolvaiprobleme.Suntei preocupatdereguliiregulamente.Sarputeasurmaioseriedeexerciiifizice sauslucraindomeniulsntii. Balan(exaltare):Aveicapacitateadeantemeiarelaiiresponsabileide durat.Sunteidedicatattpartenerilorintimi,ctsicelordeafaceri. Scorpion:Sunteiangajatintensfademunciproiectecomune.Suntei unmuncitordescurcreihotrt. Sgettor:Sarputeasvdedicaieducaieisuperioareisaveiuncod moralstrict.Sunteideasemeneaunmuncitorcomodioptimist. Capricorn (domiciliu): Suntei conservator i autoritar i avei mari ambiii pmnteti.Sunteiunmuncitorresponsabil. Vrstor (exaltare): Avei capacitatea de a munci bine n grupuri. Munca dumneavoastreadeseaoriginaliinovatoare. Peti: Suntei un muncitor milos i intuitiv, dei putei fi ngrijorat i temtor.Sarputeasaveiokarmputernicderezolvatntimpulacesteiviei. Casa1:Sarputeasncercaioreticenpreventivdeavexprima.Sar putea s fii limitat de sentimente de nepotrivire care izvorsc din copilria timpurie.Sunteiresponsabilidencredereiprobabilcamprecaut. Casa 2: Sar putea s ncercai sentimente de srcie emoional sau financiar, devreme n via. Mai trziu, v vei dezvolta capacitatea de a aduna bunuripersonaleprinmuncdinrsputeri. Casa 3: Capacitatea dumneavoastr de comunicare sar putea s fi fost restrns n copilria timpurie, rezultnd dintro team de autoexprimare. Sar puteasvformaitreptatuntalentdecomunicareprinpropriiledumneavoastr marieforturi. Casa4:Familiasarputeasnuvfisprijinittimpuriunvia,rezultnd sentimentullipseiunuireazemstabil.Maitrziu,vveiconstruiotemeliesolid, bazat pe propria munc struitoare, iar viaa familial va deveni o baz solid pentrudumneavoastr. Casa 5: Sar putea s fi ncercat o lips de distracii simit timpuriu n via, cauznd mai trziu o reticen de a v odihni sau juca. Vei descoperi c organizarea muncii creatoare i timpului de recreare este cea mai bun soluie pentrudumneavoastr. Casa6:Aveinevoiedeomunccotidianorganizat.Sarputeasfiavut problemedesntatetimpuriunvia.Unprogramzilnicdemeninereacondiiei fizice ar putea fi benefic. Ai putea avea de asemenea bune capaciti organizatorice. 205
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa7:Sarputeasvtemeisvangajainrelaii.Devremenvias ar putea s v fi simit copleit de relaiile apropiate. Vei nva mult prin intermediulrelaiilordumneavoastrintime. Casa8:Sarputeasvtemeideproiectelecomune,svsimiicopleit de intimitate sau limitat n exprimarea sexual. Vei nva mult din cercetarea problemelorprofundealevieii. Casa 9: Sar putea s v simii limitat n cercetarea nelesului vieii. Mai trziunviasarputeaeventualsncepeioserioasinvestigaientrmurile filosoficeireligioase. Casa10:Vtemeideeeculpubliciabordaicarieracuprecauie.Dup piedicitimpurii,veidevenimuncitorirespectabilnprofesiaaleas. Casa 11: Suntei timid n grupuri de persoane i avei puini prieteni adevrai.Sarputeasvalegeicugrijprieteniisausieiinspecialcucolegii. Casa 12: V temei de orice e ascuns. Aceasta poate pentru c simii c propriiledumneavoastrgraniesuntpermanentameninate.Ocercetareserioas atrmurilorascunsevarputeaajutasvnvingeitemerile.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Chiron,VindectorulRnit,reprezintrnilenoastreemoionaleifizice.El nedescoperopartelovit,slabivulnerabil.Suntemncurajaisnevindecm rnileiapoisprivimdincolodetrmurilepersonale,pentruavedeasuferina altoraipentruadeveninvtoriivindectori. Interpretri: Berbec:Sensuldeafivafostnclcatcumvaisarputeasvtemeisv afirmai.Sarputeassupracompensaincercndsfiiprimulntoate.Fizic,sar putea s v rnii la cap. Sar putea s devenii un pionier ntrun mod care va aduceserviciiomenirii. Taur: Vei ncerca o criz a valorilor. Sar putea s suportai o lips de ncrederenpropriavaloareissupracompensaiprinsporireaaverii.Sarputea de asemenea s v ndoii de trupul dumneavoastr, sau s simii ca trupul dumneavoastr nu este frumos. Vei nva s v ncredei n experienele fizice propriiiaiputeadeveniunvindector. Gemeni:Sarputeasnuaveincrederenpropriileprocesementale,sau s v temei s comunicai cu ceilali. Sar putea s fi avut o problem de comunicarencopilrie.Educaiatimpuriesarputeasfifostdureroas.Aiputea avea capacitatea de a capta ideile creative universale sau spirituale. Ai putea nvapealiintrunmodbeneficpentruomenire. Rac (exil): Sar putea s v simii nesigur pe dumneavoastr n propria familie. Aceasta ar putea rezulta dintro relaie dureroas cu tatl, sau poate alt experien dureroas n familie. Vei ti n mod intuitiv cum s v ngrijii de membriifamilieiideceidragi. Leu(exil):Vtemeisvdistraiisfiicreativ.Aifostpoatempiedicat s v exprimai n copilrie i avei dificulti n depirea sentimentelor de nepotrivire. Copiii sar putea s v reaminteasc durerea. Ai putea suferi dificultidesarcin.Sarputeasdeveniiunnvtorsauterapeutcreativ. Fecioar (cdere): Vei ncerca o puternic legtur ntre problemele emoionale i sntatea fizic. Sar putea s v temei de sentimente, prefernd muncilepracticedezicuzilumiihaoticeaacestora.Sntateaivindecareavorfi importante pentru dumneavoastr. Sar putea s slujii omenirea devenind vindector.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Balan: Dezechilibrul relaiilor, att personale ct i impersonale, v cauzeaz durere. V vei simi de asemenea vulnerabil n faa nedreptii. Sar puteasafisuferitntrorelaietimpuriecuprinteledesexopus.Veinvamult prinrelaiiiaiputeadeveniunsftuitor. Scorpion:Veisimiodurereprofundcarevaieilasuprafanrelaiile intime.Sarputeasfisuferitotraumprenatal.Propriadurereprofundvva ndemnascercetaimisterelevieii,inclusivnaterea,moarteaisexualitatea.Sar putea si sftuii sau si nvai pe alii. Sar putea de asemenea s studiai metafizicaisdeveniiunvindectorsufletesc. Sgettor: Sar putea s v simii nesigur pe credinele i perspectivele dumneavoastr. Ai putea deveni un fanatic religios pentru a compensa aceast nesiguran.Sarputeasdescoperiicstudiainpermanensaucltoriiprin lumentrunefortdeanelegenelesulvieii.Sarputeasindrumaipealiipe crarealorspiritual. Capricorn: V simii nesigur de locul dumneavoastr n societate. Sar puteasaveidificultingsirealoculuipotrivitnlumeaexterioar.Aceastaar putearezultadintroexperiendureroascumama.Aiputeaalegeoprofesieca vindectorsaunvtor. Ophiucus (domiciliu): Sar putea s v neliniteasc propriul nivel de evoluie spiritual. Suntei idealist i intuitiv. Putei fi un bun nvtor sau cercettor n domeniul esoteric. Credei c fiecare trebuie si gseasc propria cale.Nuinelegeipeaceiacarerefuzsevolueze. Vrstor: Sar putea s v simii nesigur n grupuri. Sar putea de asemenea s fii sensibil la rnile omenirii. Poate pentru c ai suferit din cauza prieteniilor.Veiaveacapacitateadeavalturagrupurilorcuocauz,nspecial aceloracarevindecomenireasaupredauidealurispirituale. Peti (exaltare): Avei dificulti n obinerea propriului sim al individualitii. Avei capacitatea de a simi durerea altora i sar putea s trebuiascsvdetaaiismeditai.Sarputeadeasemeneassuferiidincauza propriei mhniri profunde. Sar putea s lucrai ntro instituie legat de vindecare. Casa1:Sunteirnit,oriafectiv,orifizic.Defiecaredatcndvexprimai esenapersonalitii,sunteirespins.Aceastaarputeaducelaautocercetareiai puteadevenimaitrziuunvindectorsaunvtorrnit. Casa 2: Suferii din cauza pierderilor financiare sau a nesiguranei financiare. Rnile afective timpurii au condus la o prere proast despre sine. Cutareavaloriipersonalearputeansemnacmaitrziuveificapabilsiajutai ipealiisigseascpropriavaloare. 208
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 3: Educaia timpurie sar putea s fi fost o experien dureroas sau aiavutproblemedecomunicarencopilriesaucufraiiisurorile.Aiputeamai trziuscomunicaiacesteexperiene,devenindunnvtorrnit. Casa4:Devremenviasarputeasvfisimitrespinsdefamilie.Viaa familial sar putea s fi fost dureroas. Pe msur ce nfruntai durerea i gsii resurse interioare, vei dezvolta sentimentul de compasiune i capacitatea de ai ajutapealiisivindecernile. Casa 5: Exprimarea dumneavoastr creatoare a fost cumva afectat devreme n via. Cineva sau ceva va mpiedicat s ieii i s v distrai n copilriatimpurie.Maitrziuaiputeanvacopiiisauaiputeaaveacapacitatea deapuneoameniinlegturcupropriileputericreatoare. Casa6:Suferiidincauzasentimentelordenepotrivirefizic.Sarputeas fi ncercat durerea fizic n copilrie. Cutarea vindecrii de sine var putea conduce la vindecarea n mod regulat a celorlali. Ai putea de asemenea preda tehnicidevindecare. Casa 7: Suferii datorit relaiilor rupte i dureroase i datorit sentimentelorderespingeredinparteapartenerului.Aiputeaaveamaitrziuun partenercaresvnveecumsdepiiaceasta,saudumneavoastrlveinva pepartener. Casa 8: Sar putea s v simii nepotrivit sexual. Ai putea fi sensibil la tendineleascunsedureroaseiaiputeafolosiacestecunotinemaitrziu,pentru adeveniunvindectorintuitiv. Casa9:Sarputeasvsimiirespinspentruconvingeriledumneavoastr. Rnile var putea mpinge spre o schimbare de filosofie, iar mai trziu ai putea deveniunnvtoralcunoateriisuperioare. Casa10:Suferiidatoritsentimentelordenepotrivireculumeaexterioar i senzaiei c valoarea dumneavoastr nu este recunoscut. Sar putea s fii nesigurpedrumulprofesional.Maitrziu,aiputeaaveaoprofesiecavindector saunvtorrnit. Casa 11: Durerea pentru dumneavoastr e trit n grupuri. Prietenii dumneavoastrarputeaincludeoamenirnii,vindectoriinvtori.Maitrziu aiputeafiimplicatntrungrupdevindectorisaunvtori. Casa 12: Suferii din cauza rnilor adnc ngropate i momentelor de durere copleitoare. n cercetarea adncurilor acestei dureri ai putea deveni mai trziuuncatalizatorpentruvindecareaaltoraunvindectorsufletesc. 209
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Semnificaie: Uranusreprezintoriginalitateaineconvenionalul,attgeniulneobinuit isclipitor,ctirebelulncpnatfrcauz.Elnespunedesprezonelencare nclcmconveniile,deveniminovatoriincercmcinoi,incitante. Interpretri: Berbec: Aceasta e generaia iniiativei i spontaneitii. Indic distrugerea vechilorstructuriiivireanoului. Taur (cdere): Aceasta e o generaie care are tenacitatea de a urmri noile cialesocietii.Brusc,resurseleomeniriiintrncentrulateniei. Gemeni:Aceastaeogeneraiecareseconcentreazasupraunornoiforme de comunicare i asupra reelelor mondiale. Idei originale i ingenioase pot lua fiin. Rac:Aceastaeogeneraiecarevasprijiniideileivaadugacomponenta emoional.Comunicareaarputeafiimportant,lafelirolulsentimentelor.Cile tradiionaledecomunicarecuceidragisarputeaschimba. Leu (exil): Aceasta e o generaie care caut libertatea de exprimare individual.Creativitateaindividualadevrat devine important, maiales prin culturiart. Fecioar: Aceasta e o generaie care ncepe s se concentreze asupra detaliilor practice ale omenirii. Cercetarea medical, echilibrul dintre munc i odihn,legturiledintreminteitrupintrncentrulateniei. Balan:Aceastaeogeneraiecarecautnoicidearealizarelaiipotrivite. Indic distrugerea formelor vechi de relaie i introducerea celor noi. Aceast generaiearputeaaveadeasemeneanoiconcepiiasupradreptii. Scorpion (exaltare): Aceasta e o generaie care va ncerca sentimente suprancrcate i transformri n via. Aceti oameni vor avea multe idei inovatoaredespreschimbare.Eiarputeatrioprefacerelascarmondial. Sgettor: Aceast generaie va cuta i nva noi perspective asupra omenirii.Vorintroducenoiconceptedefilosofie,religieietic. Capricorn: Aceast generaie va introduce noi structuri, posibil guvernamentalesaudeafaceri.Indicuntimpalconsolidriiideilororiginaleio construirepracticanoilorci. Vrstor (domiciliu): Aceast generaie e capabil de descoperiri tiinifice geniale.Indicnelegereaoriginaliinventivcareaducebeneficiiomenirii.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Peti:Aceastgeneraievaficapabilscercetezeincontientulilucrurile ascunseislucrezecuajutorulintuiiei.OnounelegerearoluluiPmntuluin universarputeafidescoperitdeaceastgeneraie. Casa1:Aveiopersonalitateexcentric,cuimpulsuldeavexprimantr un mod schimbtor i dinamic. Sar putea s sfidai conveniile sau s fii un conductorneobinuit.Cusiguranveifioriginal. Casa2:Veincercaschimbribrutenvenituri.Baniivorfiaicioclipi duinurmtoarea.Aveicapacitateasinventaistrategiidefcutbani.Sarputea deasemeneasaveibunurineobinuiteisvapreciaipropriaoriginalitate. Casa3:Sunteiungnditorrapidioriginal.Vplacesstudiaisubiecte neobinuite,pecareleabordainpropriuldumneavoastrstiloriginal.Sarputea saveiorelaieneobinuitcufraiiisurorile. Casa 4: Avei o via familial activ, neobinuit i neconvenional. n copilriesarputeasfincercatschimbribrutenmediulfamilial.Caadult,vei cutauncminneobinuit. Casa 5: Avei capacitatea de a prelua modele originale i creative. Sar puteasaveipasiunisauscopuricreatoareexcentricesauneconvenionale.Copiii dumneavoastrarputeafioriginaliineconvenionali. Casa 6: Modul dumneavoastr de abordare a vieii cotidiene ar putea fi neobinuit. Sar putea s ncercai schimbri brute de sntate sau s avei animaleneobinuite. Casa 7: Avei nevoie de relaii neconvenionale. Libertatea n cadrul relaiilorvafideasemeneaimportantpentrudumneavoastr.Veinvadespre propriaindividualitateprinintermediulrelaiilorneobinuite. Casa 8: Sar putea s ncercai schimbri brute n via prin aventuri comune.Sarputeadeasemeneasfiifascinatdemetafizicidelaturaprofund avieii. Casa 9: Vei dezvolta filosofii neobinuite i originale. Sar putea s v revoltai mpotriva religiei tradiionale i s v bucurai de izbucniri brute de studiusaucltoriinstrintate. Casa 10: V vei bucura de o carier neconvenional prin care vei putea contribuicucevaoriginalivalorospentrusocietate.Sarputeasvsimiiagitat ntro singur profesie i s descoperii c uneori dorii o schimbare total n orientareavieii. Casa 11: V vei nconjura de prieteni neobinuii i excentrici. Sar putea deasemeneasapreidreptcelciudatngrupuri.Sarputeasdoriiseliberai grupurideoameni. Casa12:Veincercadeseoriscnteierideintuiiesausarputeasiniiai sau s v alturai unei instituii neobinuite. Este posibil s cercetai psihicul umanntrunmodneobinuit. 211
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Semnificaie: Neptun este planeta misticismului i unitii. El reprezint att unitatea binecuvntat a spiritului ct i confuzia care vine din necunoaterea limitelor i granielor. El estompeaz diferenele dintre realitate i nchipuire i ne nva compasiuneaiapropierea. Interpretri: Berbec: Indivizii au potenialul de a fi pionieri n domeniul spiritual. i asum riscul de a cerceta trmurile mistice. Aceast generaie ar putea de asemeneaaveamulipionierindomeniulartelor. Taur: Aceast generaie are capacitatea de a aplica valorile spirituale n domeniul banilor i resurselor. Indivizii pot fi practici relativ la perspectivele mistice.Obiecteiartefrumoasearputeareflectalumeaspiritual. Gemeni (cdere): Aceast generaie i poate dezvolta intuiia i are capacitatea de a nva, scrie, preda i rspndi compasiunea i nelegerea spiritual. Rac: Aceast generaie are capaciti mediumnice poteniale. Indivizii i in convingerile spirituale aproape de inimi cu o msur sigur de ataament emoional. Leu (exaltare): Aceast generaie e legat ndeaproape de artele creatoare. Plcerea i extravagana sunt exprimate att n lumea artistic, ct i n cea spiritual. Fecioar (exil): Indivizii acestei generaii sunt confruntai cu sarcina analizrii exceselor extravaganei i a organizrii unei abordri sistematice a mbinrii spiritualului cu practicul. Ei sunt interesai ca problemele spirituale s devinpartearutineizilnice.Deexemplu,aceastgeneraiearputeavedeamersul regulatlabisericonecesitatepentruoviasntoas. Balan:Aceastgeneraiearecapacitateadeaprivirelaiileumanedintro perspectiv general mai spiritualizat, dect din a legilor i regulilor generale anterioare. Aici pot domni unele confuzii asupra relaiilor umane potrivite. Indivizii vor nzui s obin un echilibru n relaiile umane. Vor fi de asemenea preocupaidedreptate. Scorpion:Aceastgeneraiearecapacitateadeaurmricupasiunevalorile spirituale. Indivizii se vor confrunta cu o lupt ntre dorinele naturale i dorina pentru un mod de via spiritual. Vor cunoate valoarea regenerrii asupra stagnrii.Aceastgeneraiearputeajucaunroltransformatornlume.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sgettor(exaltare):Aceastgeneraiearedarulviziuniispirituale.Indivizii vor fi capabili s ajute oamenii s se concentreze asupra aspiraiilor spirituale, s devinmaicomunicativiisacceptediferiteleraseicredine. Capricorn:Aceastgeneraiearecapacitateadeaaplicadisciplinapecalea spiritual. Vor avea nelepciunea de a includeatt valorile spirituale vechi ct i pecelenoipentruaformaotemeliesolidpentrucretereaspiritualviitoare. Vrstor (cdere): Omenirea va nva s triasc precum un colectiv. Aceast generaie va avea capacitatea de a urmri perspective spirituale noi i diferitedarulrevelaiei. Peti (domiciliu): Aceast generaie ar putea avea capacitatea unitii cu Dumnezeu.Sarputeasfiecapabilisiexprimespiritualitateaprinptrundere psihologic i art. Ar putea fi de asemenea nvtori inspirai, contieni de ntreg,detotalitate. Casa 1: Vei ncerca o lips de frontiere ntre dumneavoastr i ceilali i sarputeasdovediineclaritatenautoexprimare.Aveicapacitateasvcreaio lumeafantezieiisarputeastrebuiascsclarificaicinesunteicuadevrat. Casa2:Sarputeasfiinerealistnapreciereaproprieivalori.Arputeade asemenea exista o lips de claritate n privina banilor i bunurilor. Trebuie s legaivalorilefinanciaredevalorilespirituale. Casa 3: Avei capacitatea de a comunica prin intermediul artelor i preocuprilorcreatoare.Sarputeasncercaideasemeneaconfuziementalis aveiomintezpcit. Casa4:Sarputeaspstraiamintiriidilicedesprecasifamilie,carepot fiadevratesaunu.Arputeaexistadeasemeneaosenzaiedepierderereferitoare lacasifamilie.Cutaisevadaintruncadrufamilialdevis. Casa 5: Avei o natur artistic puternic i capacitatea de a crea prin intuiie. Sar putea s trebuiasc s facei sacrificii, n special pentru copii sau pentruceidragi,naintesputeicrea. Casa 6: Sar putea s avei dificulti n a face fa vieii cotidiene. Sar putea s avei probleme de sntate sau alergii n copilrie. Avei de asemenea capacitateadeafidefolosaltora. Casa 7: Cutai perfeciunea n relaiile personale i sar putea s fii deziluzionat de parteneri imperfeci. Avei de asemenea capacitatea de a atrage uniunispirituale. Casa8:Vsimiiunacuceilaliiaveicapacitateadeatranscendeviaa cotidian prin preocupri metafizice. Sar putea s simii cu uurin tendinele emoionaleascunse. Casa 9: Avei o atitudine de devotament pentru educaia superioar i cutai filosofia perfect. Sar putea s fii dezamgit de realitile studiului, cltoriilornstrintatesaureligiei. 214
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 10: Tnjii s fii de folos prin profesie. Sar putea s ncercai un sentimentdepierderereferitorladireciadeviaaleas.Sarputeasvisecear svsacrificainvreunfelcarieraaleas. Casa 11: Cutai prietenii spirituale i umanitariste. Sar putea s evadai din realitate prin grupuri. Avei capacitatea de a fi de folos prietenilor i grupurilor. Casa 12: V simii copleit de tendinele ascunse ale lumii. Sar putea s evadai din realitate visnd cu ochii deschii i lsnduv liber fantezia. Avei uneorionaturplindecompasiune.

Semnificaie: Pluto este planeta transformrii. Nimic nu rmne la fel n jurul acesteia. Sarcina ei este de a terge trecutul pentru a face loc noului. Aceasta se face exploziv,silindoriceesteascunslasuprafasserisipeasc.OriundestPluton horoscoapelenoastre,trimregenerarea. Interpretri: Berbec (exaltare): Aceasta este generaia revoluiei. Indivizii au capacitatea dearsturnatradiiileideancepedinnou. Taur (exil): Aceasta este generaia schimbrii economice. Indivizii au capacitateadeatransformaproduciamaterialiproceselemonetare. Gemeni: Aceasta este generaia inveniilor transformatoare i progreselor majore n cunoatere. Indivizii sunt martorii noilor descoperiri cu ramificaii mondiale. Rac: Aceasta este generaia schimbri sistemelor sociale. Indivizii sunt nscui n timpuri zbuciumate care le amenin sigurana i familia. Aceast generaiearecapacitateadeaconstituinoiconceptesociale. Leu (exaltare): Aceasta este generaia puterii. Indivizii au capacitatea de a folosiputereaattpozitivctinegativ.Putereaiconducereamondialvorfide asemeneaproblemeimportantepentruacetia. Fecioar: Aceast generaie are capacitatea de a transforma modul cum privete lumea sntatea. Cercetarea medical, bolile mondiale, descoperirile n acestdomeniuilegturiledintreminteitrupvorfincentrulateniei. Balan(cdere):Aceastgeneraievafipreocupatdecauzadreptiiide transformarea relaiilor umane. Indivizii au capacitatea de a vedea necesitatea schimbriinrelaiilepersonaleiglobale.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Scorpion (domiciliu): Aceast generaie are capacitatea de a iniia schimbarea la scar mondial pentru a se ridica deasupra dorinelor de baz ale omenirii. Indivizii ar putea tri un conflict mondial. Vor fi silii s nvee s foloseascnmodcorectresurselelumii. Sgettor: Aceast generaie va ncerca nevoia de transformare a perspectivelorreligioasepentruaincludetoatefilosofiileireligiile. Capricorn: Aceast generaie va avea capacitatea de a transforma vechile structurinaltelenoiidurabile. Vrstor (cdere): Aceasta este generaia cooperrii mondiale. Indivizii au capacitatea de a face progrese tiinifice n beneficiul omenirii i sar putea s fie siliisschimbemodulncareeprivittiina. Peti: Aceasta este generaia unitii spirituale. Ea are capacitatea de a drmaformeleartisticetradiionalepentruapregtiterenulpentruoartnoui ptrunsdespiritualitate. Casa 1: Suntei un conductor transformator, provocndui n mod constant pe alii i pe sine pentru a accepta schimbarea. Avei o personalitate puternic. Casa 2: Banii i bunurile trec n mod constant prin schimbri n viaa dumneavoastr. Chemarea dumneavoastr e s cercetai legtura dintre schimbareaposesiunilorischimbareavalorilorinterioare. Casa3:Aveiominteiscoditoareisunteiunvorbitorputernic.Sarputea sncercailuptepentruputerecufraiiisurorile. Casa 4: Mediul dumneavoastr familial ar putea fi vulcanic. Traume ale copilrieitimpuriiarputeafierbendedesubtulaparenelor.Sarputeasncercai schimbritraumatizanteacas. Casa5:Aveimarenevoiesvexprimaicreativ.Sarputeastrebuiasc svferiideonevoieobsesivdeatenie.Sarputeadeasemeneasfiiexcesiv dedominantcucopiii. Casa6:Rutinazilnicjoacunrolimportantnviaadumneavoastr.Sar puteasncercaischimbridramaticensntate.Chemareadumneavoastres recunoateiputerearelaieidintreminteitrup. Casa 7: Vei ncerca transformri profunde prin intermediul relaiilor. Relaiile dumneavoastr sar putea schimba, sau dumneavoastr vai putea dezvoltaischimbancadrulrelaiilor. Casa8:Aveiodorinputernicdeafiunitcualii.Sarputeasncercai impulsuri i pasiuni puternice, i totui nerecunoscute. Sar putea s cercetai n profunzimesubiectemetafizice. Casa 9: Avei un puternic impuls de a descoperi nelesuri superioare n via.Trebuiesvferiisdeveniidogmaticnfilosofiilepersonale.Sarputeas deveniiobsedatdecltorii,studiusaureligie. 217
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa10:Veifiunconductorputernicncarieraaleasisarputeasv folosii de profesie pentru a v simi puternic. Sar putea de asemenea s trii schimbrimajorenmediulprofesional. Casa 11: Sar putea s v simii atras de grupuri politice puternice i s ncercai conflicte puternice cu prietenii. Avei de asemenea capacitatea de a lega prieteniiprofunde. Casa12:Aveinevoiepresantscercetaitrmurileincontiente,posibil devenindobsedatdecontientizareanecunoscutului.Sarputeasvtreziimereu ncentrulcrizelor,frsnelegeidece.

Nomenclatura este numele tehnic standard sub care este cunoscut o stea. Existmaimultesistemedenomenclaturfolosite.nceleceurmeaz,stelelesunt denumite folosind sistemul Bayer, care folosete o liter greceasc, unic ntro anumitconstelaie,sugerndstrlucirearelativastelei.Deexemplu,Siriuseste CanisMajor,nsemnndceceamaistrlucitoaresteadinconstelaiaCanisMajor. Clasaspectralindiccalitatealuminiiemisedesteaitemperaturasaefectiv.De obicei,constntroliteriunnumr.Literaprecizeazclasageneraliarnumrul poziianclas.Litereleposibile,nordineatemperaturiistelelor,sunt: Litera Denumirea Culoarea Temperatura W WolfRayet verzuialb 80000K O Albastref. verzuialb 36000K calde B Albastrecu albstruialb 1225000K heliu A Cuhidrogen alb 810000K F Metalice glbuialb 67500K G Tipsolar galben 56000K K Galbene portocaliu 4500K portocalii M Cuoxidde portocaliu 3500K titan rou R Carbonate portocaliu 3300K rou N Carbonate rou 3300K S Gigantice rou 3300K variabile
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Magnitudinea este un numr zecimal care indic intensitatea senzaiei pe care o produce energia stelei asupra unui organ receptor. Cu ct numrul e mai mic,cuattsteauaemaistrlucitoare.Ceamaimicmagnitudinevizibilenjur de6. Constelaie, Clas Magni Poziie Natur Nume nomenclatur spectral tudine 15P Achernar Eridanus B9 0,6 12N Acrux Crux B1 1,6 14L t e Acubens Cancer F0 4,3 21R Adara CanisMajor B1 1,6 28L t e Adhafera Leo F0 3,6 24N Agena Centaurus B3 0,9 25G m AlHecka Corvus B2 3,0 28L t e AlJabhar Leo A0 3,6 27E t j AlPherg Pisces G3 3,7 0G lj Alcyone Taurus B7 3,0 10G m Aldebaran Taurus KM 1,1 27L tv Alfard Hydra K3 2,2 9E me Algenib Pegasus B2 2,9 26T tm Algol Perseus B8 var 9R ev Alhena Gemini A1 1,9 9F m3 Alioth UrsaMajor A0 1,7 27F 1 Alkaid UrsaMajor B3 1,9 14T v Almach Andromeda K2 2,3 23G j t Alnilam Orion B0 1,8 25G Alnitak Orion B0 2,0 15E v Alpheratz Andromeda B8 2,2 29E m e Alrisha Pisces A2 3,9 2V Altair Aquila A7 0,9 18L t e Alterf Leo K5 4,5 10S Antares Scorpius MB 1,2 24B Arcturus Bootes K2 0,2 21G t e Arneb Lepus F0 2,7 Asellus 9L ms Cancer K0 4,2 Australis Asellus 8L ms Cancer A0 4,7 Borealis
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nume Constelaie, nomenclatur Triangulum Australis Carina Cetus Orion Orion Aries Carina Auriga Gemini Cassiopeia Cygnus Capricornus Leo UrsaMajor Taurus Cepheus Carina PiscesAustrinus Crux Aries Auriga Sagittarius Crater Pegasus Vela UrsaMajor Orion Gemini Auriga Cetus UrsaMajor Aries Carina Crux Orion Clas spectral Magni tudine Poziie
21S 23F 22E t 21G 29G 21T v 15R t 22G 20R 14T 5P 24V 21F t 15L 22G m 10E 22B 4P 7N 8T mt 19G C 5 27F v 23P 29F t 1F 24G j 15R 0R me 14T t 19L 3T mt 2N 12N 22G j t 6 j 4 t e v m5 j el me me


Atria Avior BatenKaitos Bellatrix Betelgeuse Botein Canopus Capella Castor Cih DenebAdige DenebAlgedi Denebola Dubhe ElNath Erakis Foramen Formalhaut Gacrux Hamal HoedusI KausAustralis Labrum Markab Markeb Megrez Meissa Mekbuda Menkalinan Menkar Merak Mesarthim Miaplacidus Mimosa Mintaka

K5 KB K0 B2 M2 K2 F0 GG AA B0 A2 A5 A4 K0 B7 M2 R A2 M4 K2 KB B9 K0 B9 B3 A3 O8 G0 A2 M2 A1 A0 A0 B1 O9

1,9 1,7 3,9 1,7 var 4,5 0,9 0,2 1,6 var 1,3 3,0 2,2 2,0 1,8 var var 1,3 1,6 2,2 var 2,0 3,8 2,6 2,6 3,4 3,7 var var 2,8 2,4 4,8 1,8 1,5 2,5

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nume Constelaie, nomenclatur Cetus Andromeda Perseus CanisMajor UrsaMajor Columba UrsaMajor UrsaMinor Sagittarius Gemini Clas spectral M6 M0 F5 B1 A2 B8 A0 F8 B8 K0 Magni Poziie Natur tudine 1T t var 0T v 2,4 2G jt 1,9 7R 2,0 16F m2 2,4 22G e v 2,8 0F 7 2,5 28G tv 2,1 C 3 var 23R m 1,2

Mira Mirach Mirfak Mirzam Mizar Phact Phecda Polaris Polis Pollux Prima Hyadum Procyon Propus RasAlgethi RasAlhague Regulus Rigel Sadalmelek Sargas Scheat Schedir Shaula Sheliak Sheratan Sirius Spica TejatPosterior Thuban Toliman Vega Wasat Wesen Zavijava Zosma ZubenElakribi

CanisMinor Gemini Hercules Ophiucus Leo Orion Aquarius Scorpius Pegasus Cassiopeia Scorpius Lyra Aries CanisMajor Virgo Gemini Draco Centaurus Lyra Gemini CanisMajor Virgo Leo Libra

F5 M3 M5 A5 B7 B8 G1 F0 M2 K0 B2 B8 A5 A1 B2 M3 A0 GK A1 A8 G3 F8 A2 A1

0,5 var var 2,1 1,3 0,3 3,2 2,0 2,6 2,5 1,7 var 2,7 1,4 1,2 3,2 3,6 0,1 0,1 3,5 2,0 3,8 2,6 var

6G te 26R 3R 16S 22S 0F 17G 4P 26S 29P 8T tv 24S C 19 4T mt 14R 24B 5R ev 7F tm 29N 15C 18R t 23R 27F e 11F t 15N m v jm jm jt

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nume Constelaie, nomenclatur Clas spectral Magni tudine Poziie



Zuben Elgenubi




Achernar:religie,spiritualitate,revelaie Alcyone:unadincele7surorialePleiadelor;dinpunctdevedereesoteric, Steaua Individualului, guvernnd umanitatea, legat de zodia Vrstorului; presupussteauanjurulcreiasenvrteuniversul Aldebaran:recunoaterepublicameritelor,prosperitate Alfard:fatalitatenrelaiilecuunelepersoanedesexopus Algol:steauaceamaimalefic;pericole,sinucidere,violen,moartesubit Alioth: din punct de vedere esoteric, sursa razei 3, prin Rac, Balan i Capricorn Alkaid: din punct de vedere esoteric, sursa razei 1, prin Berbec, Leu i Capricorn Almach:renume Altair:ansneateptat,prosperitate,darischimbrineateptate Antares: autodistrugere, gust pentru putere, rapacitate, violen, ndrzneal Arcturus:noroc,inspiraie,popularitate,bogie Bellatrix:prestigiucivicdobnditpecmpuldelupt Betelgeuse:onorurimilitare,succesmaterial Capella:protectoriinflueni,situaiesocialprosperistabil(ngeneral) Castor:violen,tendinemalefice Dubhe: din punct de vedere esoteric, sursa razei 5, prin Leu, Sgettor i Vrstor Formalhaut:ans,idealurinobile,transcendenadelauniversulmaterialla celspiritual Markab:pericoldernire Megrez:dinpunctdevedereesoteric,sursarazei4,prinTaur,Scorpioni Sgettor Merak:dinpunctdevedereesoteric,sursarazei6,prinFecioar,Sgettor iPeti Mirach:cstoriefericit,renume Mizar:dinpunctdevedereesoteric,sursarazei2,prinGemeni,Fecioari Peti Phecda: din punct de vedere esoteric, sursa razei 7, prin Berbec, Rac i Capricorn

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Polaris(steauapolar):dinpunctdevedereesoteric,SteauaDirecieisaua Reorientrii,guvernndShamballa;legatdezodiaLeului;steauacaredezvolt arta refacerii i salvrii a ceea ce este pierdut; ea ghideaz omenirea pe calea involutiviinflueneaznmodactivpeceidepeCruceaMutabil Pollux:ascensiunesocial,prestigiu Procyon:celebritate,ans Regulus: idealuri nobile, ascensiune fulgertoare, dar i violen, distrugere, aducnd uneori un declin la fel de fulgertor; durabilitatea creaiei spiritualeidupmoarte Rigel:renume,succesmaterial,capacitatedecreaie Scheat:pericoldenec Sirius: prestigiu, bogie, sinceritate; din punct de vedere esoteric, Strlucitoarea Stea a Sensibilitii, guvernnd Ierarhia; legat de zodia Scorpionului;influeneazsistemulnostrupsihicprinUranus,NeptuniSaturn Vega:ans,reuit,bogie,popularitate,vanitate,lascivitate

Punctuldeavansarebrusc:Asc+Punctuldenoroc(diurn)t=2Asc+lst Punctuldeboal:Asc+mt Punctuldebunuri:Asc+cuspidaC2guvernatorulC2 Punctuldecltoriipeap:Asc+15;Rt Punctuldecltoriipeuscat:Asc+cuspidaC9guvernatorulC9 Punctuldecstorie:Asc+Dscv Punctuldechibzuin:Asc+tv Punctuldecomer:Asc+es Punctuldecunotineonorabile:(diurn)Asc+ s Punctuldenoroc(diurn)= 2sl;(nocturn)Asc+Punctuldenoroc(nocturn)s=2Ascl Punctuldediscordie:Asc+jm Punctuldedistracie:Asc+vm Punctuldedragoste:Asc+vs Punctuldedumani:Asc+cuspidaC12guvernatorulC12 Punctuldefatalitate:Asc+ts Punctuldefii:Asc+jl Punctuldefiice:Asc+vl Punctuldeiluminare:Dsc+ls Punctuldeintuiie:Asc+us Punctuldenfrire:(diurn)Asc+jt;(nocturn)Asc+tj Punctuldentemniare:Asc+sn
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Punctuldenelegere:Asc+me Punctuldekarm:Asc+tp Punctuldelegtur:Asc+l+guvernatorull Punctuldemam:Asc+lv Punctuldemarf:Asc+Punctuldenoroc(diurn)Punctuldespirit(diurn)=Asc+2l2s Punctuldemoarte:Asc+cuspidaC8l Punctuldemotenire:Asc+lt Punctuldenobleeionoare:(diurn)Asc+19;Es;(nocturn)Asc+3;Tl Punctuldenoroc:(diurn)Asc+ls;(nocturn)Asc+sl Punctuldeorganizare:Asc+ps Punctuldepasiune:Asc+ms Punctuldepericol:Asc+guvernatorulC8t Punctuldeprieteni:Asc+lu Punctuldeprofesie:Asc+lt Punctuldeslujitori:Asc+le Punctuldesoart:Asc+el Punctuldespirit:(diurn)Asc+sl;(nocturn)Asc+ls Punctuldesporire:Asc+js Punctuldetat:Asc+st Punctuldetrdare:Asc+ns Punctuldevia:Asc+slunanouprenatal Punctuldevocaie:MC+ls


Punctajeleacordate(propunere): Soare,Lun:6 Mercur,Venus,Marte:4 Jupiter,Saturn:3 Uranus,Neptun,Pluto:2 Asteroizii,inclusivChiron:1 Lilith:2 NodulNord:2,5 Ascendent,MijloculCerului:3

Moduldecalcul: Pentruplaneteiasteroizi,senmuletepunctajuldemaisuscuurmtorii coeficieni(3variantepropuse):

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


1dacplanetaestenzodiadomiciliu 0,97dacestenexaltare 0,9dacestentrigonocraie 0,78dacesteperegrin 0,64dacestencdere 0,5dacestenexil(distribuienormalgaussian) 1dacplanetaestenzodiadomiciliu 0,87dacestenexaltare 0,76dacestentrigonocraie 0,66dacesteperegrin 0,57dacestencdere 0,5dacestenexil(distribuieexponenialnegativ). Pentru Lilith, Nodul Nord, Ascendent i Mijlocul Cerului, se folosete coeficientul1,indiferentdepoziianhoroscop. n funcie de ceea ce se dorete analizat (zodiile, casele, cadranele, emisferele etc.), se adun ponderile punctelor aflate pe teritoriul diviziunilor respective. De exemplu, pentru analiza zodiilor, se adun toate punctele din Berbec, apoi toate cele din Taur .a.m.d. pn la Peti, apoi se observ care zodie/zodii are/au punctajul cel mai mare, i deci ce sectoare au o importan crescutpentruindividulncauz.

1dacplanetaestenzodiadomiciliu 0,9dacestenexaltare 0,8dacestentrigonocraie 0,7dacesteperegrin 0,6dacestencdere 0,5dacestenexil(distribuieliniar)


Berbec puternic: Energie iniiatoare, de pionierat. Independent, ndrzne, curajos, hotrt, arztor, inspirat, direct, decis. Egoist, impulsiv, nerbdtor, agresiv,frsubtilitate. Taur puternic: Stabil i rbdtor, valori puternice, decis, cu picioarele pe pmnt, dorine puternice. Lacom, ncpnat, conservator, prea posesiv, desfrnat.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Gemeniputernici:Agil,multilateral,curios,amabil,vorbre,aerian,multe idei.Nestatornic,schimbtor,superficial,inconstant. Rac puternic: Protector, tenace, sensibil din punct de vedere emoional, rdciniputernice.Insipid,preaprotector,nuvreasrenune,timid,retras. Leuputernic:ncreztornsine,generos,bunlasuflet,conductorputernic, dramatic.Preamndru,vanitos,extravagant,arogant. Fecioar puternic: Meticulos, cu putere de discernmnt, pur, practic, preocupatdesntate,muncitor.Preacritic,meschin,perfecionist. Balan puternic: Echilibrat, armonios, artistic, diplomat, puternic sim al dreptii.Preanclinatsprecompromis,nepstor. Scorpion puternic: Intens, magnetic, percepie penetrant, putere de confruntare.Distructiv,rzbuntor,gelos,preadramatic. Sgettor puternic: Inspirat, viziune larg, entuziast, n cutarea scopului, sincer,aventuros.Nesbuit,nestpnit,frtact. Capricorn puternic: Disciplinat, practic, responsabil, de ncredere, harnic, contiincios.Pesimist,preaconvenional,rigid,materialist,nemilos. Vrstor puternic: Filantrop, inovator, cu contiin de grup, orientat spre progres, dorind si serveasc pe alii. Rebel, excentric, distant, superficial din punctdevedereemoional,preaextravertit. Petiputernici:Milos,sensibil,capabildesacrificiudesine,blnd,intuitiv. Dorindsevadeze,nepractic,hipersensibil,credul.


Casa 1: Identitatea. Personalitatea cum v vedei dumneavoastr i cum vvdalii.Aspectulfizic.Sinele,anima,imagineaproiectat,expresiamotivaiei interioare,scopulsufletului,abordareainiialavieii,aura. Casa 2: Propriile resurse. Ce preuii, de la bunurile fizice i bani pn la respectuldesineitalente.Resurselepersonaleifinanciare,valorileiatitudinile, achiziiile,prana. Casa3:Comunicarea.nvturatimpurie,fraiiisurorile,mediulambiant imediat, cltoriile scurte. Procesele mentale, cutarea activ a cunoaterii, telepatiaienergiamental. Casa 4: Casa i familia. Rdcinile, motenirea i viaa privat. Fundaia psihologic,motenireabiologic,locuina,aramul,karma. Casa 5: Creativitatea. Scopurile artistice, pasiunile, recrearea, copiii i povetile de dragoste. Autoexprimarea, aventurile amoroase, procrearea, timpul liber,jocurileisportul,automplinirea,bucuriaiextazul.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Casa 6: Viaa de zi cu zi. Munca, sntatea, serviciile pe care le facei, obiceiurile.Animalelemici,rutinazilnic,mediulprofesional,priceperile. Casa 7: Parteneriatul. Parteneriatul n afaceri, cstoria sau o relaie angajat.Asociaiipetermenlung,dumaniideclarai,animus,relaiadintresuflet ipersonalitate. Casa8:Sprijinulpecarelprimiidelaalioameni.Regenerarea,moartea, sexul, problemele legale, metafizica. Transformarea, resursele altora, motenirile, transmutaia,lupta. Casa 9: nvtura nalt. Subiectele academice, legea, religia, publicaiile, cultura strin, sportul, cltoriile lungi i filosofia. Cltoria pe Cale, nelepciuneavenic. Casa 10: Viaa public. Poziia n comunitate, cariera, statutul social, atitudineafadecalitateadeprinte.Onoarea,autoritatea,profesiunea,direcian via,realizrile,StpniiiIerarhia. Casa11:Prieteniileirelaiilengrupuri.Speraneleivisurile.cunotinele sociale,grupurile,organizaiileiactivitilelor. Casa 12: Sfriturile. Puterile i slbiciunile ascunse. Instituii precum spitalele, nchisorile, bibliotecile i armata. Temerile, dumanii ascuni, incontientul colectiv, spiritualitatea, datoriile karmice, serviciul altruist n beneficiulomenirii.


1.Voinaiputerea:Puternic,hotrt,struitor,simalscopului,capacitate deconducereiguvernare.Mndrieexcesiv,setedeputere,ncpnare.Pluto, Vulcan.Berbec,Leu,Capricorn. 2. Dragostea i nelepciunea: nelept, iubitor i milos, mare sensibilitate, rbdare i tact. Autocomptimire, hipersensibilitate, fric i lips de hotrre. Soare,Jupiter.Peti,Gemeni,Fecioar. 3. Inteligena activ i adaptabilitatea: Detept, agilitate mental, strategie, vorbitor iscusit, sim al afacerilor, capacitate de gndire abstract. Mndrie intelectual,necinsteiagitaie.Saturn.Rac,Balan,Capricorn. 4.Armoniaprinconflict:Spontan,imaginativ,conciliant,dragostedemuzic i frumos, capacitate de a mpca opuii. ngrijorare, capricios, btios i indecis. Luna,Mercur.Scorpion,Taur,Sgettor. 5.Cunoatereaitiinaconcret:Concentrat,obiectiv,foartecurios,expertn domeniul ales, i place verificarea prin experiment, inventivitate practic. Raionalism excesiv, scepticism i criticism, lips de sensibilitate emoional. Venus.Vrstor,Leu,Sgettor.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


6. Devotamentul i idealismul: Entuziast, loial i devotat, puternic idealism, umilin, capacitate de ai inspira pe alii. Fanatism, credulitate, idealism rigid i hipersensibilitate.Neptun,Marte.Peti,Fecioar,Sgettor. 7.Ordineaceremonialimagia:Bineorganizat,cucontiinsocial,rafinat, simalsincronizrii,capacitatedeacldiiangrijidedetalii.Supraregimentare, perfecionism, materialism i preocupare excesiv pentru reguli. Uranus. Berbec, Rac,Capricorn.


Cadranul1:C1C3;dezvoltareaproprieiidentiti;nevoiadedezvoltarei de preocupare pentru sine; v vedei ca un individ independent, capabil de a v organizaviaa;egocentric;zonelencaredoriisvexprimaipersonalitatea. Cadranul2:C4C6;nevoiadesiguraninterioarirelaiilecualii;suntei receptivcuceilalioameniisensibillatendineleascunsedinrelaii. Cadranul 3: C7C9; problemele i relaiile globale; nevoia de legturi cu societatea;veicutarelaiicuunaspectmaimultobiectivdectpersonal,vreis fiiofigurpublicisvjucairolulnsocietate. Cadranul 4: C10C12; eforturile personale n beneficiul umanitii; nevoia deaficoncentratasupraserviriipublice;vstrduiisvaduceicontribuian lume; acest lucru poate fi benefic, dar i distructiv dac devenii obsedat de un ideal.


Vestic: C10C3; suntei un individ automotivat i autoorientat; v place svurmaipropriuldrum,ncercndgreutidoardaccinevavstncale;v apreciai independena i propria companie; v place compania altora doar dac acetia v acord suficient libertate pentru urmrirea propriilor scopuri; comportareegocentriciegoist. Sudic: C1C6; identitatea i resursele personale sunt bazele oricrui alt succes n via; trebuie s v simii sigur de sine nainte de a pi n lume; rdcinilefamilialeimediulcasnicvvorasigurafundaiilepentrudescoperirea icunoatereadesine,carevorfitemeliilesuccesuluiviitor;trebuiesvasigurai cnuajungeiizolatncas. Estic: C4C9; interaciunile cu ceilali iau un rol extrem de important; v preuii att relaiile personale ct i interaciunile cu umanitatea; avei darul de mediator n relaii, cunoscnd nuanele acestora; nvai despre sine n contextul
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


relaiilor dumneavoastr; trebuie s v asigurai c nu suntei prins n relaii sufocante. Nordic:C7C12;viaapublicefoarteimportantpentrudumneavoastr; vctigaisatisfaciapersonalprinrealizrilenlumeinvaimultdespresine prinpoziianarenapublic;nevoiadeprofilpublicnaltarputeafimplinitatt prin carier ct i prin statutul social; trebuie s v asigurai c realizrile dumneavoastrnusuntfcutepeseamacelordragi.


Cardinal: Dorina de a exprima activ energia i de a cuta provocarea; esenasemnelorcardinaleesupravieuirea.Berbec,Rac,Balan,Capricorn. Cardinalputernic:Vplaceprovocareaiaciuneaideveniifrustratcnd nu avei mijloacele pentru schimbare; v ateptai ca i alii s rspund unei provocri. Cardinal slab: Preferai s urmai ci deschise de alii dect s iniiai aciuni;puteiproduceattatimpctaltcinevaareideileiniiale. Fix: Dorina de a rmne stabil i n siguran; esena semnelor fixe e creterea.Taur,Leu,Scorpion,Vrstor. Fixputernic:Vplacestabilitatea;vateptaicaialiisfiedencredere. Fix slab: V place s trecei de la un lucru la altul, fiinduv greu s v stabiliiundeva;vplaceschimbarea,deivlipsetestabilitateanecesarpentrua vedeaobiectivlucrurile. Mutabil: Dorina de a fi flexibil i adaptabil; esena semnelor mutabile e adaptabilitatea.Gemeni,Fecioar,Sgettor,Peti. Mutabilputernic:ntrzieri;vateptaicaialiisfieflexibili. Mutabilslab:Vegreusvadaptainoilorsituaii;tindeisfiiinflexibil cndvconfruntaicucererialeschimbriiialealtorpersoane.


Foc:Elementmasculin(yang).Denotentuziasm,dinamism,spontaneitate ilipsarefleciei.Berbec,Leu,Sgettor. Foc puternic: Suntei o persoan foarte motivat, cu multe proiecte i aspiraii pentru viitor. Suntei activ i spontan, adesea bucurnduv provocarea deaurmadrumurinoiiaventuroasenvia.Entuziasmuldumneavoastrede
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nestpnit. Slbiciunea dumneavoastr const n tendina de a exagera i incapacitateadeafacefaunoractivitimaipmntetinvia. Foc slab: Avei dificulti n a v motiva pentru atingerea scopurilor. De fapt,uneoriv lipsete chiar ncrederean sine necesar pentruv stabiliscopuri personale. Sar putea s ncercai o lips general de entuziasm, siminduv copleitdeschimbare. Pmnt: Element feminin (yin). Denot ncredere, stabilitate, soliditate, stoicism,senzualitateispiritpractic.Taur,Fecioar,Capricorn. Pmnt puternic: Suntei practic i eficient, cu picioarele pe pmnt. Abordai cu bun sim majoritatea problemelor. Aceasta v ajut n rezolvarea chestiunilorvieiidezi cu zi. Slbiciunea dumneavoastr const nncpnarea cu care refuzai s facei schimbri. Avei tendina de a nbui entuziasmul propriuialcelorlali. Pmnt slab: Facei fa cu greu realitilor vieii de zi cu zi. Problemele practice cotidiene par dincolo de capacitile dumneavoastr i avei dificulti cndtrebuiesvconcentraiasupraunorchestiuniconcrete. Aer: Element masculin (yang). Denot comunicare oral sau scris. gndirea,intelectul,curgerearapidaideilor.Gemeni,Balan,Vrstor. Aer puternic: Suntei obiectiv i filosof, prefernd s privii viaa dintro perspectivintelectual.Minteadumneavoastrraionalvaaveadefiecaredato importanmai maredect sentimentele,deoarececonsiderailumea emoiilor ca fiindiraional.Aveiunputernicsimaldreptiiiogndirelogic.Slbiciunea dumneavoastrconstnfaptulcvedeisentimentelentroluminnegativ. Aerslab:Vlipseteobiectivitateacapacitateadeastadeoparteiaprivi aspectelevieiidintroperspectivdetaatiraional.Aveidificultinluarea deciziiloricntrireauneiproblementromanierlogic. Ap:Elementfeminin(yin).Denotsensibilitate,sprijin,siguran,griji comfort.Rac,Scorpion,Peti. Ap puternic: Vorbii din inim i suntei o persoan miloas i plin de grij,cuoputernicnaturintuitiv.Vpreuiirelaiilepersonale,ncareadesea v asumai rolul de purttor de grij. Suntei att de nelegtor nct adesea sunteiprinsnroluldemampentruceidragi.Slbiciuneadumneavoastrconst n faptul c nu putei privi cu obiectivitate lucrurile, atunci cnd este necesar. Deseorireacionaifrscntriintilucrurile. Ap slab: V e team s v exprimai simmintele. A plnge sau a v pierde sngele rece n faa altor oameni reprezint un gnd ngrozitor pentru dumneavoastr,darmiteaciune.Deseorivlipsetecompasiuneapentruceilali
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


n relaiile personale i trebuie s nvai s preuii att sentimentele dumneavoastr,ctialecelordinjur.


Lunala045nfaaSoarelui:Sunteiopersoanimpulsiv.mereucutnd noi prilejuri de a v exprima ideile. Reacionai din punctul dumneavoastr de vederesubiectiv.Vplacesiniiainoiproiecte. Lunala4590nfaaSoarelui:Sunteiopersoanhotrt,dornicslsai n urm trecutul i s v ndreptai spre viitor. De obicei avei ncredere n capacitateadumneavoastrdeaacceptaoprovocare. Lunala90135nfaaSoarelui:Sunteiopersoanorientatspreaciune,cu capaciti manageriale i dorina de a obine rezultate. Cteodat sar putea s foraipreamultpentruidealuriledumneavoastr. Luna la 135180 n faa Soarelui: Suntei plin de resurse i orientat nspre atingereascopului,cutndsensulnviaadumneavoastr.Deseoriputeifigsit cutndcunoatereapentruacretevaloareavieii. Lunala180135nurmaSoarelui:Sunteipreocupatnprincipaldenatura relaiilor.Nudoarrelaiilepersonale,cioricefelderelaie.Relaiilevoraveadecio importandeosebitnviaadumneavoastr. Luna la 13590 n urma Soarelui: mprtirea cunoaterii cu lumea este o motivaiemajornviaadumneavoastr.Credeicaiadunatmultecunotinei nelepciune prin experienele dumneavoastr i dorii ca i alii s profite de pe urmalor. Luna la 9045 n urma Soarelui: Avei convingeri puternice i probabil le vei pune n aplicare. De obicei avei nelepciunea de a ti cnd s acionai, dar uneoriputeifiinflexibil. Luna la 450 n urma Soarelui: Suntei o persoan orientat spre viitor. Simiicdestinuljoacunrolimportantnviaadumneavoastr,isarputeas aveiuneletalentenprofeieiconducere.

nceleceurmeaz,pentrufiecareplanetsevorpreciza,succint,informaii despre natura i problematica sa general, elementul definitoriu, zodiile de

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


domiciliu, exaltare, cdere i exil, caliti (+), defecte (), interpretri n contextul astrologieisociale(S)ialastrologieimedicale(M). Soarele:identitatea,cumnedefinim,cumavemnevoiesneexprimm,s neremarcmnvia,centrulautoexprimrii;personalitatea,spiritualitatea,suma deprinderilor dobndite n existenele precedente, contientul, personalitatea de baz; simbol al carierei, onorurilor, reputaiei, vocaiei, misiunii sociale, gradul posibil de elevare, ansele de renume, nivelul de influen spontan asupra oamenilor,amplitudineadestinului;tatl.Foc(uscat+cald).Leu/Berbec/Balan/ Vrstor. (+) Caracter bine conturat, creativitate, vitalitate, for, autoritate, mndrie, sim critic, discernmnt, nal situaia social, ntrete sntatea, sporete avuia. () Arogan, egocentrism, sadism, impulsivitate. (S) Autoritatea, monarhia,eful,puterea,guvernul.(M)Inima,sistemulcirculator,splina,coloana vertebral,ochii,pancreasul. Luna: natura emoional, nevoile de baz, modul n care ncercm intimitatea n relaii; mama; tipul de sprijin dorit; sufletul uman, subcontientul colectiv, instinctul i reflexele necondiionate; imaginea intim, gndurile i intuiia, visul secret, angoasa n comportament, afaceri, dragoste, modalitile de exprimare n creaii de orice fel. Ap (umed+rece). Rac / Taur / Scorpion / Capricorn. (+) Sentimentul matern, iubirea filial. () Egoism, hipernervozitate, viclenie, lene, minciun.(S) Publicul, masele, democraia, opinia public,femeile, viaa familial, simul comunitii, agricultura. (M) Stomacul, sistemul limfatic, snii,uterul,ovarele,vezica,digestiaigestaia. Mercur:intelectul,bunulsim,raiunearece,comerul,afacerile;mobilitate, adaptabilitate, elasticitate; obiceiurile de comunicare i nvare, modalitile de gndire; recepia senzorial i reaciile fa de impresiile percepute; schimbarea, calitile de expresie. Pmnt (uscat+rece). Gemeni, Fecioar / Vrstor / Leu / Sgettor,Peti.(+)Spiritpracticidiplomatic,elocven,ndemnareiintuiien cercetare. () ndrzneal insolent, instabilitate psihic, hoi, escroci, ipocrii, spioni, falsificatori, mitomani, cleptomani. (S) Educaia, literatura, propaganda, massmedia, comunicaiile. (M) Sistemul nervos, umerii, minile, braele, coordonareatuturorfunciilor. Venus: cumneplacesneraportmlamediuilaaltepersoane;tipulde relaiepreferat;cepreuim(baniibunuri);echilibruldintreparteintreg,dintre formifond;tendinadeacompletantregul;viaasentimental,dragostea,arta, frumuseea, fuziunea, armonizarea. Aer (umed+cald). Taur, Balan / Peti / Fecioar / Berbec, Scorpion. (+) Via plcut, talent. () Pasiuni nenfrnate, vanitate, senzualitate pronunat, depravare, ncpnare exagerat, dezordine. (S) Moda, artele, muzica, teatrul, plcerile, diplomaia, distraciile, victoria n 233
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


rzboi. (M) Gtul, gura, vocea, sistemul senzorial, laringele, esofagul, rinichii i aparatulreproductorfeminin. Marte: hotrrea,energia,ceneconduce,cumneurmrimdorinele,cene motiveaz; aspiraiile i energiile consumate pentru atingerea scopurilor, dorina de progres, de extindere a propriilor posibiliti. Foc (exces cald+uscat). Berbec, Scorpion/Capricorn/Rac/Taur,Balan.(+)Pasiune,dinamism,energiepsihic i volitiv, iniiativ, loialitate, cuceriri, ndrzneal, curaj, generozitate, onoruri, dezinteres pentru bani. () Impulsivitate, violen, mnie, brutalitate, adversari, obstacole (materiale, umane), accidente, operaii, incendii, distrugere, dumnii, rzbunri oarbe, supunerea intelectului de ctre instincte (mai ales sexuale). (S) Violena, rzboiul, soldaii, agresiunea. (M) Muchii, sngele, aparatul reproductormasculin. Jupiter: expansiunea, abundena, nelepciunea, zonele n care tnjim s descoperim mari adevruri, excesul; ansa providenial, puterea, gloria; modalitatea practic de integrare n lume, aptitudinile i calitile n care acioneazprincipiuldecoeziune,conformareicoordonare.Sgettor/Rac,Peti / Fecioar, Capricorn / Gemeni. (+) Autoritate, protecii, achiziii i profituri materiale, ascensiune pe scara social, ambiii satisfcute. () Arogan viclean, suficien ipocrit i perfid, viciu. Aer (umed+cald uor exces). (S) Religia, filosofia, preoii, prosperitatea, bncile, expansiunea, operele de caritate, aristocraia i clasele dominante, editorii. (M) Ficatul, circulaia arterial (periferic),creterea,bila,regenerarea(sngelui). Saturn: responsabilitatea, graniele i organizarea (care furnizeaz un cadrupozitivsaulimiteaz),nesiletesnereconsidermrspunsurileicalitile, disciplin; influeneaz desvrirea contiineide sine, confer oviziuneglobal asupracomunitiiumane,onelegeresuperioararealitii,putereadeavedea lucrurileaacumsunt,apellarbdare,tact,rezisten,clirepsihic;concentrarea icristalizareavieiiinterioare,naturasoluiiloradoptatecarspunslaprincipiile de autoconservare; modul de detaare de lume, de realizare interioar, sacrificiul pentruatingereascopului;intensitateaaspiraiiloriambiiilor;piedicile,neansa, frustrrile, eecurile. Pmnt (uscat+rece exces). Capricorn / Balan, Vrstor / Berbec, Leu / Rac. (+) Ofer rezisten la durere i oboseal. () Efort, fatalitate, suferine, restricii, sacrificii, abandonuri, trdri, boli, obstacole. (S) Ordinea, autoritatea, limitarea, restriciile, conservatorismul, stabilitatea, tradiiile, poliia, administraia,legile.(M)Sistemulosos,dinii,pielea,unghiile,articulaiile. Uranus: originalitatea, neconvenionalul, zonele n care nclcm conveniile, devenim inovatori i ncercm noi ci; nonconformism, imprevizibil, 234
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


detaare de lumesc, protectori influeni, asociaii progesiste de avangard; generarea primordial, focalizarea vieii interioare, debarasarea, reducerea la esenial,monopolizarea,coagularea,hiperindividualism,dinamism,cutrilepline depasiune.Foc(uscat+uorcald).Vrstor/Scorpion/Taur/Leu.(+)Revoluie, ans neateptat, cutezan creatoare, depirea situaiilor obinuite, noul. () Nelinite devorant, dezinhibiii intens manifestate, lovituri de teatru, ghinioane subite,aventuririscante,excesuri,pierderi,derut.(S)Inovaia,schimbrilebrute, revoluia, anarhia, autocraia, radicalismul, noile ideologii, tehnologiile avansate, energianuclear.(M)Electricitateacerebral,fenomeneleosmoticelanivelcelular, gambeleigleznele. Neptun: misticismul, unitatea, confuzia rezultat din necunoaterea limitelor;estompeazrealitateainchipuirea;compasiunea,apropierea;dragostea absolut de Dumnezeu, filosofia elevat, religia, intuiia genial, mediumnitate, magie, tiine oculte, vindecarea spiritual, medicina naturist, moarte clinic, catalepsie, com prelungit; dilataia extrem pentru o rezolvare, extinde expansivitatea; exaltarea imaginaiei, permeabilitatea la mediu, confuzie i incertitudinindomeniulfinanciar;loculundeeplasatidealuliexaltrilemajore ale existenei. Ap (umed+uor rece). Peti / Leu, Sgettor / Gemeni, Vrstor / Fecioar.(+)Comunicarecuforacolectiv,revelaiispirituale,inspiraieartistici religioas. () Situaii confuze, vise himerice, sperane fr sens, iluzii. (S) Idealismul, reforma, filantropia, moda, stilul i artele. (M) Gleznele i labele picioarelor. Pluto: transformarea, terge exploziv trecutul pentru a face loc noului, regenerarea; justiia divin, schimbarea forat i profund, mutaiile de fond, limitarea liberului arbitru la minimum; se manifest la nivelul de percepie al contiinei colective. Variaia elementelor. Scorpion / Berbec, Leu / Balan, Vrstor / Taur. (+) Puterea ce vine din adncuri, ansa de a accede la aspectele nltoare ale vieii, ruptura de prejudeci i influena mediului, puteri oculte, revelaii superioare, anse stranii. () Stri morbide, drame, distrugeri i autodistrugeri, crize, nevroze, perversitate interioar. (S) Prbuirea, violena, crima, declinul i renaterea naional. (M) Organele sexuale, sistemul excretor i reproductor.

Domiciliulestezodiancareastruliexercitinfluenalaunnivelmaxim. Domiciliul poate fi diurn sau nocturn. El are o aciune pozitiv pentru sine; reprezint o achiziie ce acioneaz n favoarea sa; planeta este ntrit n

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


activitatea sa oferind anse de a controla potenialul i evenimentele pe care aceastalereprezint;planetandomiciliuaratvalorilerealizatecontient,pecalea evoluieiproprii. Exaltatea reprezint zodia n care astrul i exercit influena la un nivel ridicat.Eaaparecaoprogresie,oelevare,oevoluiefavorabilapotenialuluide bazalplanetei,carelproiecteazpeindividpecaleaevoluieispirituale. Trigonocraia reprezint zodia n care astrul este n trigon (120) cu domiciliul.Planetagenereazoexpresiepersonalievolutiv,unpotenialcreativ careaducecaliticomplementarenraportcudomiciliul,permindoexpansiune decontiin. Peregrinaunuiastruseconsiderzodiancareplanetaexercitoinfluen neutr,echilibrulfiindrealizatprinarmoniacontrariilor. Cdereaunuiastruestezodiancareplanetarespectivexercitoinfluen mult diminuat. Reprezint o for ntoars n jos, contrar exaltrii care este sinonimulspiritualitii,eaestesinonimulmaterialitii,oaciunecarenupoatefi dus la ndeplinire, cci se nruie pe parcurs. Sugereaz o poziie de ruptur, de involuie, de regres, n care planeta nu poate si exprime potenialul n bune condiii,deunderisculdecepiei,aldeziluzieisaualproiectelorcesempotmolesc. Exilulestezodiancareastrulexercitoinfluenminim,fiindconstrns sideturnezecalitiledinplanulspiritualncelmaterial.Seprezintcaofor ndreptat spre altul; potenialul planetei acioneaz ntrun mod mai favorabil pentru altul dect pentru individul n cauz. Pentru a surmonta aceast poziie, este necesar detaarea fa de contribuia astrului; va trebui ca persoana respectiv s se conformeze opiniei altuia sau evenimentelor pe care nu le poate controla,leciafiinddovedireaaltruismului. n continuare se prezint n mod grafic influenele planetelor n cele 12 zodii.Interpolareapunctelorsafcutcuajutorulcurbelorsplinecubiceperiodice. Peabscissuntreprezentatezodiile(0=Berbec,1=Taur...,12=Berbecdinnou),iarpe ordonat fora planetei n sectorul respectiv (5=domiciliu, 4=exaltare, 3=trigonocraie,2=peregrin,1=cdere,0=exil).

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Mai jos sunt prezentate efemeridele heliocentrice corespunztoare unei revoluii complete ale planetelor Sistemului Solar (mpreun cu cei 7 asteroizi), precum i graficele reprezentnd perioadele pe care acestea le petrec n fiecare zodie(nzile).ntrunfel,graficulsemnificinverselevitezelorplanetelorstudiate.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

2Dec1997 8Dec1997 13Dec1997 18Dec1997 23Dec1997 28Dec1997 4Ian1998 12Ian1998 22Ian1998 2Feb1998 12Feb1998 21Feb1998 28Feb1998

13:12 07:43 08:49 03:16 01:28 14:47 08:29 18:18 20:31 17:16 21:57 12:44 12:27

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

5Nov1997 24Nov1997 12Dec1997 31Dec1997 18Ian1998 6Feb1998 24Feb1998 15Mar1998 3Apr1998 22Apr1998 11Mai1998 30Mai1998 17Iun1998

06:14 01:54 19:16 10:05 22:31 09:35 21:14 11:31 05:36 03:04 02:18 01:22 23:01

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

23Sep1997 23Oct1997 22Nov1997 21Dec1997 20Ian1998 18Feb1998 20Mar1998 20Apr1998 21Mai1998 21Iun1998 23Iul1998 23Aug1998 23Sep1998

01:45 11:03 08:35 21:55 08:34 22:43 21:44 08:46 07:54 15:51 02:43 09:47 07:25

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

14Feb1998 4Apr1998 27Mai1998 24Iul1998 26Sep1998 3Dec1998 9Feb1999 16Apr1999 15Iun1999 9Aug1999 29Sep1999 16Nov1999 2Ian2000

12:14 17:02 16:44 22:01 14:43 05:39 14:40 04:58 16:54 15:56 03:33 00:37 11:09

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

22Ian1987 15Dec1987 11Nov1988 20Oct1989 14Oct1990 27Oct1991 21Nov1992 22Dec1993 18Ian1995 31Ian1996 25Ian1997 3Ian1998 1Dec1998

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

1Iun1996 19Oct1998 26Ian2001 14Apr2003 28Iun2005 2Oct2007 12Feb2010 13Aug2012 30Mar2015 15Dec2017 3Sep2020 28Apr2023 4Nov2025

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

15Mai1927 13Dec1934 15Apr1942 21Apr1949 29Dec1955 14Iun1962 21Oct1968 17Mar1975 21Oct1981 9Sep1988 4Dec1995 7Iun2003 30Ian2011

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

19Aug1861 29Ian1875 26Iun1888 10Dec1901 25Iun1915 17Feb1929 25Nov1942 26Sep1956 10Aug1970 13Iun1984 17Mar1998 11Nov2011 23Mai2025

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

27Mai1822 29Aug1851 30Aug1883 16Nov1913 15Oct1938 25Iul1957 2Dec1971 6Ian1984 11Sep1995 21Iul2008 22Ian2024 7Iul2043 29Aug2067

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

3Iun1968 3Dec1976 30Oct1983 22Iun1988 16Iul1991 3Oct1993 6Aug1995 13Mai1997 2Mai1999 9Nov2001 25Iun2005 21Dec2010 10Sep2018

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

15Iul1997 11Nov1997 19Mar1998 29Iul1998 5Dec1998 3Apr1999 20Iul1999 27Oct1999 29Ian2000 30Apr2000 3Aug2000 12Nov2000 1Mar2001

10:48 11:42 08:57 08:19 02:46 13:26 18:11 16:43 06:17 15:09 14:37 10:27 17:04

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

3Nov1998 19Apr1999 5Aug1999 25Oct1999 9Ian2000 7Apr2000 29Iul2000 7Dec2000 26Apr2001 24Sep2001 24Mar2002 1Nov2002 16Iun2003

12:11 04:40 08:39 05:55 15:19 10:04 01:31 21:50 12:41 18:42 06:42 16:18 23:14

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

8Ian2001 4Apr2001 19Iun2001 2Sep2001 26Nov2001 14Mar2002 4Aug2002 5Feb2003 3Sep2003 26Mar2004 16Sep2004 31Ian2005 18Mai2005

10:25 15:44 13:22 20:26 21:43 08:03 16:47 10:28 22:40 11:02 08:36 13:14 04:28

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

31Dec1997 4Iun1998 29Oct1998 15Mar1999 20Iul1999 17Nov1999 14Mar2000 14Iul2000 24Nov2000 18Apr2001 21Sep2001 28Feb2002 8Aug2002

13:00 10:15 11:28 14:16 15:28 10:53 08:13 17:07 04:34 08:30 03:00 23:44 04:24

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

7Ian2002 24Iul2002 20Feb2003 18Sep2003 1Apr2004 22Sep2004 24Feb2005 13Iul2005 24Nov2005 7Apr2006 28Aug2006 2Feb2007 31Iul2007

09:54 09:46 10:01 16:26 11:48 22:14 01:40 21:18 01:28 09:34 09:07 18:15 04:23

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ari Tau Gem Can Leo Vir Lib Sco Sag Cap Aqu Pis Ari

18Feb1998 17Iul1998 16Nov1998 25Feb1999 25Mai1999 18Aug1999 13Nov1999 18Feb2000 12Iun2000 31Oct2000 16Apr2001 15Oct2001 6Apr2002

16:49 15:06 15:22 23:06 21:47 05:01 01:41 00:12 05:32 02:20 12:58 04:21 19:56

00Ar00D 00Ta00D 00Ge00D 00Cn00D 00Le00D 00Vi00D 00Li00D 00Sc00D 00Sg00D 00Cp00D 00Aq00D 00Pi00D 00Ar00D

Bibliografie: SolarFireDemonstrationCopy199496EsotericTechnologiesPtyLtd DanCiupercAstrologianNouaEr,Ed.Safire,Bucureti,1994 GabrielMihailoviciTrilogiahoroscopuluipersonal,Ed.TipoDec95 GheorgheChiAstronomie,manualpentruclasaaXIIa Mulumiri: CostelIuracu

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ce,i,tiasoamenicubani,cetiitu! Eah,iamaidinaibii!Iauitecereparbieiistrada. Dacespargelaasfaltul? Pivreasajunglacanale. Cecanale? Danutii?Canalele.TotIauinumaicanalepededesubt.Labirint. Dadece? Vorsaducbieii Dunrea,i! AducDunrea, i dupaia nu maiau o treab.Ap,curent,totceipoftetemuchiuleu.Facbieiihidrocentral. icuBahluiucefac? Eh,Bahluiul las aa, pentru turism.tii, dac vin turitistrini,i duce cubarcapeBahluiilezice:bibiei,priviifrumuseilepatriei! Danulvinde? Cumslvnd? Slvndlaexport.Uite,arabiiardaaurpeel.Petrol!Neartragetubcu petroldirectdinIrak. Ar fi original, da nu vor ruii! Pentru c sar extinde zona de influen arab. Nu,danemiiarvrea.Nemiileardaarme. Pfai,ceticloi...Dalacarespargeacum,vezicnarecablu? Piareciocanpneumaticcuminireactornuclear.Vezi,acolo,lacapt. A,deastaauihainedeasteafosforescente,pentruradiaii. Da original. Adica noi putem s crpm, ci doare pe toi undeva. Te plimbiprinoraiteiradiaz. Da am auzit c e un program naional de iradiat populaia. Ca s vad efectele,acumcamajunsputerenuclear.Uiteacolomainadevrat! Corect. Ai auzit de ministrul de interne din Moldova? Lo arestat n Austria,cconduceaomainfurat. Pinu,cvoiaslarestezelanoi,daIliescuozis:bibiei,staiomu meu.Vatingeideel,vatingeidemine.idupaiavatingeupetoi.Ehei,Iliescu aremnlung! tii c n Moldova aduc maini furate din Nemia, le vnd i apoi dac vinevreounuifacescandal,judectoriaidctigdecauzcumprtorului,ci cumprtorcinstit. Sadic.Daiaducimainiiospargipringropi. iospargitu,cetifraier.Dacetiatentimergipeundetrebuie,nui ospargi. Eu,biboule?Eunicinamcarnet.Fratemiu!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ei,ifratetudecianiarecarnet?Dezece? Dedouzeci!Iodatcarnetodatcubuletinu,nu?Uite,mialuHristea, eutetiupetine,ineaiceacarnet. Chiar,fratetucemaiface? Cesfaciel,pelaturci,pelanemi... Bomboane? Arme! Rachete, tancuri... O fost in strintate: Transnistria, Cecenia, tmpeniideastea!... Nu,acumapebune! Ei,nimic.DarsuntcareseducnTurcia,facbani,apoiseduclanemii cumprelectronice.Dintreidrumuriioadunatgrunele.Banu,dinpatru,cas plteascivama!apoilvezipeunucvineacasbatanucutaxiu!tias oamenicubani,cetiitu! Uiteimecherustacutiftuluidewalkman. Ascultmuzic? Nu,deseneanimate. Auzi,ilavoicurgeapcugustdeclor?Amvrutsspunclorcugustde ap. Lanoisedacumaesendeml. Vezicumvorbeti!Ofensadusautoritii!Iascoatebuletinu! Nam,cmiormasmiciilamdatlufratelemeu. (16mai1996;19.18)

Perspecularite hanc epistulam, enim est exitus qustionum ex tota vita ctus optimorum eruditorum, quamquam absentia in theatro terrarum orbis ob prtercensurinsectationumque. Ultraquadrigentiannis,secretiimpetusreducereTerramadstaduscopuli vertentisinuniversoexperitur,virtuscentriomniumrerumfurantes. SicdicentesobservationesergaSolareRationebonescientercorruptsunt. VeritasquTerraincentrouniversisitaestetomnesplanetsolesquecircumsua circumeunt. Sed illorum orbes circinati non sunt, cum falso antiqui iudicabant. Quanto deferenti tanto epicycli ellipticisunt autemmotus in hac forma dispar se facit. Hic modus pro res adspicere notabile auxilium astrologis confert, ob prterfacilitatisephemeridarumcalculi.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nostra epistula est desperata vox versus conscientia hominum, ab fraudibus venenata. Rerum commutatio necesse est persecuta. Non relinquite veritatemintenebris!Sumus (17maius1996;19.19)

Nowtwoyears,intheyearfromthemakingoftheworld7502,thearmyof EnglandarrivedatthegatesofCarpathians,afterwhatconqueresEurope.Herself thequeenwasridinginthefrontofthesoldiersher,encouragingthemtovictory. Thereplyoftheromanianswasbrave,althoughtheinfantryfoughtofone alonebecausetheplanesmilitaryhadfallenintheyearsfrombehind. ThegovernmentandthepresidentthemselvesrefugedatTimishoara,but couldntescapeoftherageenglish. Thearmyromanianitselfdisorganised,dueofthedesertions,becausethe britishpromisedtothefugitivesnationalityfrench.Theresistancefrommountains ofaftertheconquestextinguishedonunexpectedlyinthewinterwhatfollowed. The population native was obliged to learn the language english and the bandsofmusicromanianweredeportedinAlbania. In 7503, themselves registered ample movements social, provoked of the concerts of the band Sophia. The police intervened, and in the confrontations the soloistvocalandtheplayerguitarwereshotaccidentallyofthelunettistsofelite. TheromanianswerehappythatcanwatchtheBBC. (the19thofMay7504;19.19)

Nlucanpdurevine Uitnddetoateidesine. Solstiiulceruluireine Unsoareverdecantrunclete, Nisipulstpefrunzebine, Topindnaturaceldorete. Mocnindinelulceclipete Unaltsolstiiuossuspine Laveseleleschimburiline
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ninddincubulcevestete. Unaltstelatcntndregete Meninevasubcrengialbine; Iluziaenscine Trecnddetinemaivorbete. (2324mai1996;19.21)

Vntulavenitimiacntatopoveste Erademultdetoti Rzndmiaoptit Secretulluistins Undevadeparteiareuamzis:o Lngtineesteoluniuncer Atingndosteaioploaieiunpotop Lngmineestecuvntuletilerpo Bezmeticprivindploileilunaistelele. (24mai1996;19.21)

DemulttimpseobservaseceleviicopiencoliledinRomnia.Odatcu cretereacantitiidedrepturialeomului,sahotrt,dupndelungatediscuii,ca acestmoddeexprimareaproprieilibertidecontiinsfielegalizat. Msura a dat roade, deoarece sa constatat imediat o mbuntire simitoarearezultatelorcolare. ntruct departajarea imparial, specific oricrei democraii, devenise puinmaidificil,sadecis,nconformitatecurecomandareaConsiliuluiEuropei, canotelesfieacordatenupeconinutullucrrii,cipemetodadecopiere. Aceast rezolvare sa dovedit salutar, pentru c punea accent pe capacitilecreativealeelevilor. Dar numai pentru scurt timp, cci aprecierea profesorilor continua s fie subiectiv. Dup o perioad de deliberri intense, sa stabilit ca fiecare si corectezesingurlucrarea,afirmndusedreptunicstpnalproprieiviei.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nsastaafostntrecut.Acummilitmpentrudesfiinareabibliotecilor. (1iunie1996;19.23)

Acum toat lumea tie c oldovenii sunt proti. Dar acest lucru a fost dovedit riguros abia de curnd, prin contribuia unui grup de doctori honoris causaaiuniversitiidinsectorulagricolilfov,sponsorizaideguvernulromniei iteleviziunearomn. Moldova nu sa remarcat prin nimic n domeniul cultural. Este binecunoscutfaptulcnsuiMihaiEminescusetragedinbuniciardeleni.IarIon CreangeraunsimpluranalecruipovestirierauscrisedeMihaiEminescu. SadiscutatmultdesprerolulaaziseicapitaleaMoldovei,nssavaniis auntrebatpebundreptatecefelderolpoateaveaunoraalcruinsuinume este de origine strin. Este frapant n acest sens asemnarea dintre denumirile Iai,Huiilei,apelativcedesemnantrecutpoporulpolon.Transformarealuiln i i apoi n h este un fenomen specific limbajului moldovenesc, demonstrat de evoluiaslavuluilarbuaniarbuzaiapoinharbuz(pepeneverde). Excesul folosirii regionalismelor n vorbirea curent, accentul slav, sugereazlipsadeinstruire,duntorulpatriotismlocal,carenupoateaducedect deserviciiunitiirii. nciudaniveluluiintelectualsczut,moldoveniitrebuieajutai.Propunem n acest sens nfiinarea marilor ferme agricole cu for de munc adus din Moldova, n special n Cmpia Brganului, Cmpia Olteniei i Cmpia de Vest, adicnprincipalelezonedeproduciedinRomnia. Un proiect de perspectiv mai ndelungat ar fi creearea unei filiale a UniversitiidinClujNapocalaBacu,desigurcustudeniaiUniversitiiMam. n acest mod sar obine o uniformizare a coeficientului de inteligen n diferitele regiuni ale rii, fapt care nu va putea avea dect consecine benefice pentrusporireaniveluluidetraiibunstriinaranoastr. (12iunie1996;19.23)

Literatura popular, expresie a nelepciunii, experienei de via i sensibilitii poporului nostru, este o enciclopedie vie a spiritualitii romneti,
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


parteintegrantaculturiinaionale. B.P.Hasdeu susine c ea i are originea n cea mai adnc antichitate dacic i c lupta dintre zmei i eroii basmelor este trecerea n zona mitului a conflictuluidacoroman. M.Eliade, n Comentarii la legenda mecherului Manole, consider c rdcinile spiritualitii romneti coboar prin timpul getodacic n arhaitatea preindoeuropean,afirmndoriginalitateaivaloarealiteraturiiromnencontext universal. Este ns evident c literatura popular romneasc este mult mai veche, izvoarelesalepierzndusenpreistorie. Pentru jumtatea de nord a rii: zmeii din basmele ntlnite n aceast regiunesunttransfigurareaoamenilordinNeanderthal. Pentru partea de sud a rii: imaginile balaurilor sunt fr ndoial reminiscenealesaurienilordinJurasic. Operele populare au constituit izvor de inspiraie pentru muli poei i prozatori. Literaturaromnnuarfiatinspiscurilepecareaajunsdacnuarfiavut capunctdeplecare,camodeloriginal,creaiadeveacurianetiuilorfuritoride frumosdepeaceastgurderai,careestepmntulromnesc. (1226iunie1996;19.2619.30)

Hei,vinieulashowlluiDanny. Bestial! Mducscumprniteflori,poatenuinchis.Wishmeluck. OK.Auzi,midtaicmeucarul.Gimmefive,baby! Cineaducemuzica? Johnny. Oh,God! Dece?Aretoatehituriledintopuldinvaraasta. Nuhituri.Shituri!tiueucemuziciplaceluJohnny! Astae! Bun,acummduc.Salut! Bye,bye! (22June1996;19.28) ShouldIhavesaidiunie?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


aranoastrsenumeteRomnia.Eaestefoartefrumoasibogat.Eaare multebogiinaturale,soliceisubsolice,deaceeaoameniitriescfericiiiduco viambelugat. n ara noastr nu exist corupie. Toi oamenii sunt apreciai n mod cinstitiegal.Deaceeatoisuntmulumii. ranii i muncesc n linite pmntul distribuit corect iar muncitorii se strduiesc s ne ridice nivelul de trai prin producia industrial obinut. La noi, omajulvadispreancurnd. ara noastr are multe peisaje, invidiate de strini, care au dorit dintotdeaunasnefurepmntul.Darpoporulnostruafostomenos,caracterizat prinospitalitate.Deaceea,toateminoritilenaionalesebucurdedrepturi,lafel caiceteniiromni. Oamenilorpoliticidinaranoastrlepasdenoiidorescsavemovia maibun.ServiciulRomndeInformaiifuncioneaznmodlegalineaprde striniiruvoitori,iarlumeasesimtensiguran. n ara noastr infracionalitatea este n scdere, deoarece jandarmii, gardieniipublici,poliia,gardafinanciaripoliiamilitarifacdatorianmod exemplar,protejnduipeceteni. Embargoul mpotriva Iugoslaviei a fost respectat. Ziarele independente sunt independente. Televiziunea spune numai adevrul. Justiia exist. Politica externesteapreciatdentregpoporulnostru,ntregranielestrmoeti.Copiii romni sunt inteligeni; de aceea vor lucra n strintate, pentru a mbunti imagineariinoastrenlume. nsdinaranoastrnumeritsemigrezi. (22iunie1996;19.28)

Cum sar spune, avem irul: an = an 2 + an 1 , numit parc irul lui Fibonacci(LeonardodinPisa,1175?1250?). Daclum a0 = 0 i a1 = 1 ,primiisitermenivorfi:011235813213455 89144233377610987159725844181... a Fie irul bn = n + 1 , cu nN*. Primii termeni ai lui bn vor fi: an 121,51,6666661,61,6251,6153841,6190471,6176471,618181...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Pentrunmare,deexemplu20,putemscrie: a 10946 b 20 = 21 = = 1,618034 . a 20 6765

Punemproblema:careestelimitaluibnpentru n ?Dupziledechin, 2 observmc1,618034 2 =2,618034=1,618034+1.Deci E1,1 = E1,1 + 1 . Rezolvmecuaia: 2 E1,1 E1,1 1 = 0

= 1+ 4 = 5 1 5 E1,1 = . 2 Pstrmvaloareapozitiv,deci: 1+ 5 E1,1 = = 1,618034 (11.1) 2 Ce se ntmpl ns dac an = 2 an 2 + an 1 ? Folosind calculatorul,

bn 2 (11.2)

Lafel,pentru an = 3 an 2 + 2 an 1 , bn 3 (11.3) Din (11.2) i(11.3), putem generaliza:dac an = q an 2 + (q 1) an 1 , atunci

bn q (11.4)


an = an 2 + 2 an 1 ,

bn 2,414213 = 2 + 1 .



E1, 2 = 2 + 1 (11.5)

Maiaflm,cuajutorulcalculatorului: E3 ,1 = 2,3027756 (11.6)

E4 ,1 = 2,5615528 (11.7) E2 , 3 = 3,5615528 (11.8) E2 , 2 = 2,7320508 = 3 + 1 (11.9) E3 , 3 = 3,7912878 (11.10) E4 , 4 = 4,8284271 (11.11)

Svedemcefacemcuele. Observmc(11.2)sepoatescrie: 1+ 9 1+ 5 ,formasemntoarecu E1,1 = . E2 ,1 = 2 2

Mai observm: 5 = 4 1 + 1 i 9 = 4 2 + 1 , deci: Eq ,1 =

1 + 4q + 1 2


relaiecareverific(11.6)i(11.7). Din(11.5)i(11.9)tragemconcluzia: Eq ,2 = q + 1 + 1 (11.13)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


= 2 + 2 ,deci: E4 ,4 = 2 + 2 2 (11.14) 2 Avemurmtoareasuccesiune: E4 ,4

5 +1 2 3+2 4 2+4 ,E2,2= ,E3,3=?,E4,4= ,deci: 2 2 2 5 + 1 12 + 2 32 + 4 , ,?, . 2 2 2 x +3 E3 ,3 vatrebuisfiedeforma (11.15) 2

E1,1= Echivalnd(11.10)cu(11.15),obinemx=21. Observm: 5 = 1 (1 + 4) , 12 = 2 ( 2 + 4) , 21 = 3 ( 3 + 4) , 32 = 4 ( 4 + 4) , (11.16) 2 Recapitulm(11.12),(11.13),(11.4)i(11.16):
Eq ,1 = Eq ,2 =
4q + 1 + 1 2 4q + 4 + 2 2

rezult: Eq ,q =

q(q + 4) + q

Eq ,q 1 =
Eq ,q =

(q + 1)2 + q 1 2 q(q + 4) + q

. 2 Expresia (q + 1)2 = q 2 + 2q + 1 poatefiscris: 4q + (q 1)2 . Avemi q(q + 4) = 4q + q 2 . Deducemastfelc:

4q + p 2 + p

2 relaiepecareovoinumirelaialuiLeon,cutoatecnutiuctesutedeoamenivor fiajunslaeanainteamea,probabilprindemonstraieriguroas. (redactat:27iunie1996;19.30)

Eq , p =

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Pe 25 mai 1996, Parlamentul Romniei voteaz legea copyrightului, promulgat ase zile mai trziu de Preedintele Iliescu. 27 mai cotidianul Monitorul din Iai anunefectele posibile ale legii asupra pieii audiovizualului: scumpireacaseteloriobligativitateatimbrelorcarescertificelegalitatea.Pnpe 26 iunie, viaa continu s se desfoare normal. Nimic nu anuna ce urma s se ntmple. 26iunie1996,ora0intrareanvigoarealegiicopyrightului.Majoritatea casetelor audio dispar din magazine. Datorit pieei negre care ia natere, Guvernul instituie msuri suplimentare pentru respectarea legii. Se nfiineaz Direcia Audiovizual a Grzii Financiare, prin Ordonana nr. 270/1 iulie 1996. n noaptea5/6iulie1996,DAefectueazprimelearestri. Pe 20 iulie 1996, se constat c posturile comerciale de radio continu s difuzeze piese de pe casete fr timbru. Guvernul, la propunerea Parchetului General, hotrte aplicarea retroactiv a legii. DA procedeaz la confiscarea casetelor netimbrate. Se semnaleaz incidente violente la Bucureti, Arad, Timioara, Constana i Iai. Aici, postul de radio Vox T este distrus complet n urmaconfruntrilor. Datorit semnalelor privind continuarea pirateriei la nivelul persoanelor particulare,DApropunen15augustaplicareamsurilorguvernamentaletuturor cetenilor.Acetiasuntsomaispredeacaseteleachiziionatenaintede26iunie 1996 la centrele special nfiinate, n termen de 30 de zile. Pe 5 septembrie, intervalul de timp este prelungit cu nc 10 zile, pentru a veni n ntmpinarea cereriloroamenilordinzoneledefavorizatedinpunctdevederegeografic. Doar o mic parte din populaie rspunde apelului. Pe 28 noiembrie, Parlamentulnouconstituitvoteazcuomajoritatede72%mputernicireaDAdea efectuapercheziiiladomiciliilepersoanelorsuspecte.Msuraducelaconfiscarea, ntro sptmn, a unei cantiti de casete egal cu aceea predat n 40 de zile. ntruct populaia refuz amenzile contravenionale i se opune arestrilor, Preedinia instituie starea de urgen pe ntreg teritoriul rii. Sunt autorizate deportrileinstigatorilorlarevolt.Muliparlamentaripropuntrimitereaacestora peuneventualantieralcanaluluiDunreBucuretiBraov. Intervine armata pentru restabilirea ordinii. Se nregistreaz din nou ciocniriputernicencapital:42decivilii2militarisuntspitalizai. 2ianuarie1997demisiaGuvernului. 3 ianuarie Parlamentul se autodizolv iar Preedintele anun alegeri anticipateinumeteunguvernprovizoriu.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


3maiParlamentulalesabroglegeacopyrightuluiihotrteapoi,pe 25 mai 1997, retrocedarea ctre populaie a casetelor audio confiscate, n limita stocurilordisponibile. (14iulie1996;19.35)

A fost odat un copil care nu era superstiios. Adic el o treab navea: ncepea diferite lucruri smbta, i fcea poze pe 13, sa pornit s nvee pentru examenmari...Adicnufceanadins,aasenimerea,elnuerasuperstiios.Cnd apicat,msaiazis:tmpitule,incontientule,euiamspuscnuiabun,dartu etitottimpuldeteptinuvreismasculi.Elarspuns:nuiadevrat,numam pregtitsuficient.dartaicsuafcutocriz:cerspunzilumta,boule? Adevrulecnanumitezileisentmplautotfeluldechestii:pe13ia pierdutbuletinuliiaspartmingea,mariisafuratbicicletaiarntrosmbt, dupceafugitpesuboscardupopisicneagr,cinelepersonaliafostclcat deomain. ntronoapte,pelaora0i6minute,venicinelesifacovizit.ispuse: bitticu,lasomaimoale.Dacosoiitotaa,osdaicoluntrobunzi.ns copilul sentoarse cu faala perete, mormind: hai,mar deaici.Toi dm colu ntrobunzi.imaipuneicolirnochi. Dupceaaruncatntruncanalbaniideexcursie,dingreeal,gagicaia zis:cenaibaetiaaghinionist?Dacmaistaumultpeaiciprinpreajm,cinetie ceosmisemaintmple.Plec,iarpesteosptmnsezgriPntrosrm,dar nudduatenie.Toiplngeau,numaielstteadeoparteipresrapiperpejos.L auntrebat:ceetimiaadealdracului?Elnuarspunsnimic.Stteaipresra piperpejos. ntruntrziu,numaincepeanimicsmbta,nuimaifceapozepe13, numainvamari.ialuatexamenele,maialescvzusesoldaipedrum,nu iamaipierdutbuletinul,nuisamaispartmingeainuisamaifuratbicicleta. Pentrucnumaiaveamingeinicibiciclet. Anul trecut, pe 13 iunie, nu vzu trenul la barier, i avea oricum prea multegrijicaslaud.Eramariisegndeaceisevantmpla.Acumefericit. Numaiesingur. (14iulie1996;19.35)
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ncetncet,toioameniidevintelepai.ipotcitigndurileunulaltuiai astamnnebunete.Pentruceunupotfaceacestlucru,orictmastrdui. Nimeni nu mai vorbete pe strad. Merg fr s spun nimic, cteodat zmbesc sau rd, doar ei tiu de ce, iar alteori unii se uit urt la mine, probabil pentrucnulerspundlasalut.Trebuiesfiuatentcegndesc. ntren,oameniimprivesciifacsemne.Sentreabdecetacinuibag nseam.Apoincepsibatjoc,sfacpoante.Dacinjur,sesupr. Mai aud voci doar la televizor i radio. ns nu va mai ine mult. Sa descoperitomodalitatedeatrimitegndurileladistan. miamintescdevremeacndlucrurileerauabialanceput.Ceicareerau deja telepai mi spuneau ct de bine se simeau i ct de uoar devenise astfel comunicarea.Euiaprobamiateptamsajungieucaei. Nam ajuns. Dar nu miam schimbat prerea nici despre ei, nici despre telepatie. Sunt contient c e mai convenabil aa, dar ce s fac? Ei ns iau schimbatprerea.Trecpelngminefrsseopreasc.Amimpresiacdauvina pe mine, c m cred prea ncrezut s stau i s gndesc cu ei. Poate au uitat s vorbeasc. noricecaz,sepreconizeazcnmaximumzeceani,toatomenireavafi telepat. Probabil c excepiile vor fi internate n sanatorii speciale. E perfect normal.Oricumnusarputeaintegrannouasocietate. Pcat c ntro alt arau aprut bande care i vneaz pe netelepai, pe broate.Sperctiadelanoisuntmaicivilizai.Poliiaaspuscnevaapra,c i noi suntem ceteni. ns am neles c deja circul zvonuri i tot felul de minciunidesprenoi,casnendeprtezedesufletulopinieipublice. Defapt,carenoi?Namntlnitdetreilunipenimenicaresnufietelepat. Oricumnaputeasmidauseama.Numaivorbetenimeni.Eaproapeindecent svorbetinzilelenoastre. Dacbroatele nu vor s deschid gura, sunt nite proaste i i merit soarta.Euvreausdeschidgura,dardegeabaofac.Svorbescdeunulsingur? Visezcutoatputerealaobroasc.Darnuetotulpierdut.Niciodatnu tiicndpoiauziovorbbun. (30iulie1996;19.39)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Omulesteungndaccu treipicioare. Capulluiesteplinde antene cucarescurm frncetare,frnumrifr pre, iarcndnugsetenimic sepipiepeelnsui icredectotulncepe isetermincuun gndacplindeantene,cu treipicioare. (27octombrie1996,21:35:4021:37:50;19.63)

Naturaesteunsac plindeguri. Pringuritrecviermi. Prinviermitrecpsri. Prinpsritrecanimale. Prinanimaletrecegndaculcu treipicioare. Pringndactreceunpianjen carencearcslegetoate gurilesacului. Reuete?... (27octombrie1996,21:38:2721:40:45)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Luminastrbatetotul. Afostunfratei cutaluminacare strbatetotul. Cerulsaspartmereunfaaluincurcubee,dar luminanuavenit. Trziu,namaicutatlumina, iarntunericulsadeschiscu poridesgeiotrvite, cnd, naintedeultimasgeat, luminasadeschiscu 14porideoglinzicolorate. Frateleaizbucnitnrsdeculori. (27octombrie1996,21:45:2521:49:05)

Celmaimareuniversesteun totmaimare,formatdin toturimaimici. Dendatceuniversurile devin toturidincencemaimici, formarelordevinetotmai grea, rea, aspr, puternic, groaznic. Ah!Numipotvedeanicimcar ungnd. (27octombrie1996,21:49:2921:51:42)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Soareleesteunrotundgalbenimic. Soareleesterou,portocaliu, galben,verde,albastru, indigo,violetimaimultcaultraviolet. Soareleesteianuarieiaamaideparte. Soareleesteberbectaurgemeniracleufecioarbalanscorpionsgettorcapricornvrstoripeti. Soareleestecauncapmareipleuv, cufocnlocdesprncenei gheanlocdeochiiochin locdegur.Odat. Deocamdat,apusulesterou. (27octombrie1996,21:52:5721:56:48)

nnoapteaplindefantome vineundezechilibrat, ifacecrucicumnastng isepunepenjurat. ibieiitoidingac rditaieopisic iarcusngelececurge omnjescpeogagic. Darcavoulsedeschide ioeapiaucutoi, cSatanacumseivete iimnncpemagoi. (27octombrie1996,21:58:2022:01:24)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Omnpoatespuneadevrul. iluminaizvortedinmn. Florilepotspuneadevrul. iaripilesuntnlnuiteprintreele. Liniilespunadevrul. iaripilesimtvntulridicndule. (27octombrie1996,22:12:1222:14:48)

Timpulpoatefidetreifeluri: trecutprezentiviitor, niciodat i ntotdeauna. Trecutprezentiviitoruleieftin. Niciodatnuestebine. ntotdeaunaeste. Cndtimpulsescumpete, drumulsedespietruiete iindicatoareledevintransparente caoapdincareestearuncat opiatrnlun, dincareieseopicturnnori. Atuncitimpulpoatefidedoufeluri: niciodat i ntotdeauna. Niciodatnuestebine. ntotdeaunaeste. Atunci,omularat, maitrziu,maiacumsaumaidevreme, iargreutateadegetelorenumaialui. Pentrucceiceclipescisuntnchii inumaiceacebateiestedeschis. ibatepnnultimaclip:
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


niciodat, ntotdeauna, niciodat, ntotdeauna... (27octombrie1996,22:15:2322:25:58)

Vlstarulcrete,vlstarulsendoaie, cnddegetualege, ncocrengumnncdinsoare. Ocreangealb, ocreangeneagr, cndnuvreasaleag,vlstarulsendoap. iatuncicnderou, iatuncicndeploaie, ecaiatuncicndcreangaensoare. itotcemaicrete, decreangaedreapt, sendreaptprinsevtulpinaneleapt. itotcemaicrete, decreangaestrmb, atingepmntuliiariseavnt. (27octombrie1996,22:30:4222:37:24)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Parteaproastestecoricinepoatescrieorice.Deexemplu,scriepoezii.La nceputsealegechiariotem,ceeacenuestensobligatoriu.Poifoartebines scriiceitreceprincreierulmic,iapoisipuiuntitlumetaforic,absolut,caresi lasepecititoricubotulpelabe,cumarfiNedefinire,Existenial,Rzvrtire,ntrebare (nacestcaz,poeziatrebuiesseterminecuDece?,eventualDece,Doamne?). Apoi, n timp ce scrii, alegi cteva metaforle, care sar putea potrivi cu tema,daricuoricealtceva.Cuctsuntmaiabstracteimaifrlegtur,cuatte maiprofundpoezia. O adevrat art este tehnica de versificaie, care trebuie musai s fie ct mainonconformist,cuversurictmaiinegale,dintoatepuncteledevedere. Unartisttrebuiesaibctmaimulteliniiformatedincuvintescurte(de exempluconjuncii,prepoziii),alternndcupropoziiintregi.Niciodatversurile nutrebuiesnceapculitermare,nssemaiadmitexcepii,cumarfinceputul uneifraze,ncazcpoeziaareisemnedepunctuaie. Ritmulirimatrebuieevitatecuoricepre,deoarecenumaiversulalbd libertatea necesar exprimrii sentimentelor autorului. Strofele (dac exist o asemeneamprire)nutrebuiesaibcuniciunchipacelainumrdernduri,ca ssevadmaibinezbuciumulcreator. La sfrit este bine s se pun puncte de suspensie, adic cinea scris l invit pe cititor s continue meditaia. Iar dac acesta face ntradevr aa, va ajungefrndoiallaoconcluzie,maidevremesaumaitrziu,isevabucurac a mai neles o poezie contemporan. Iar autorul se va bucura i el c a reuit s facpecinevaspiardtimpulnmodcultural. Asta nu nseamn c astea nou poezii dinainte nu au ceva idei prin ele, chiar dac sunt scrise n form contemporan. Navei dect s v pierdei i voi timpul...

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



Ze creghidne liante dla spvor, vran vi spvorh lond, havrant lande fer:Revon. Zenorandspvorhicridsavrazant: Ferli, fizir nosret ocl cnetifa ro cvihta rerat, vris vricnanondfasspvorh.Cratarastarvrisspvisnanhcar.Cricnandemriba clatar,canhdazvitrandaluttagvriHrad. Revon,nigri,za: Zatar,creghinocsdnasziszedlahrad. Dacda, ferli, dnac dra sizandt cro clindna zend. Zen Crad Vohgal,dalacpalianteslis,Hrad.Randarand,rvlanetifdlamanacvanos, dvocrihnabclatars.Vorandstaflicatsfa,crindlanfapravric,rvladnafac clatanpunvarocsaliantlisvrisdlanondrerat. Revonza: Crahvada,zatar,clanirdevo? Tos,ferli:dastemribaclatar,cratarasmogrvrispunvanHrad.Cri zantefas, vigor fas trenas dla spvoraliant. Cronan de lin ta res clafac, rand detarscatlendecefac,vrisnorandtepademe.Vlifastarvristotemrafas. VocfanderiplaVohgalfa? Pramarfamegclatarstofoga.Crinozantebasfas,Hradtrenatfac cneslianteslis. Vorcdsacard! Do.Dartaresvrisfardecredat!
(A fost odat un inut al spiritelor, condus de un Tmprat btrTn, care avea un singur fiu: Revon. SntronoapteTmpratulTlchemlaeliispuse: Fiule, simt c nu peste mult timp m voi regsi Tntro fiin a pmTntului, i tu vei deveni Tmprat peste spirite. Va trebui s fii bun i si conduci supuii Tn pace. De aceea, cTt mai sunt Tn putere,potTncstesprijinTnluptaTmpotrivaRului. Revon,uimit,spuse: Tat,numiaizisniciodatcexistspiriterele. Aa este, fiule, Tns a venit vremea s afli ce iam ascuns pTn acum. Sn Valea Diavolului, departedeinuturilenoastre,slluieteRul.Pezicetrece,cucTtmaimultmiseapropiesfTritulTn aceast existen, el capt noi puteri. CTnd Tmi voi pierde forele, disprTnd Tn lume, el va pune stpTnirepeimperiu,ameninTndcudistrugereaitrTmurilenoastre,icelepmTnteti. Revonspuse: Cetrebuiesfac,tat,pentruaTmpiedicaacestea? Iat,fiule:cTttemaipotsprijiniTnlupt,trebuiesmergiisTnfruniRul.Dacveireui vei primi sceptrul imperiului. Pe tine lumina nu te va mai alunga, ziua Ti va fi binecuvTntare, iar noapteamTngTiere.Veifibuniveisalvatotul. DarcumvoiajungeTnVale?

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Smi voi folosi ultimele puteri pentru a Tndeplini aceasta. De nu vei reui, Rul ne va cuceri inuturile. Suntgatasplec! Bine.DomnulfiecutineiarizbTndasiTnsoeascpaii!)

Blonar rasla bi selir fJxa Revon va xotar aloe, re ezi beo \m vepe ze. Blofo \m zd\mje o upzilfJ buelde, neo pomi xoz jeale tizshozJ \m xot. Ma \msJbie moso u \mtuoerJ, bi esuru dlipaoe zJ omdli. ZJ omdli o zJ \mvlamdi LJar.ZiebluboitibueldJ.TitomsurulJxpJdieauebdisoatediovuoeaanplineo mijlitis\dmuebdie \mzJo.SanzJzitasJblomdliiri,s\mtmadoemonostizbli zbolodiriliri?Zij\mtosJelvo\mpiribdzJ\msilsineo\md\ozJevris\dneonardi raslalotizbliesizdie,tizblivirar\mselibudvo\mvl\mdioepoeebuozJdliesJ. [msJ \meomditie \mduelsisebar,zonpo \mzbediramebromJ,t\mtao badilio \mslitili.UfJxaaloeJ,erpJsetijhiepJ,tiezableuloxumdaraoodoasJ edamsos\mtiefeebamiomuebdiezifezv\lo,fedlipaoulozJvo \mfomz,ulo zJvovuzdasoztilexirizuelirao.ErdJserimaile. XJlotibeldiusezJsavilizdliriranomediobulmojlJpod \mdlesuru.Ma iledonbtiboiltad.Egamzis\mtramealsezisaubernJbisilopJda\mjientidlio ulo.Aezitizshozi. MuebdiezJpoetasJpasaloi!alJir.IazamdRevon. opoiezinimie!Iazamdux\mJ. [rbuvdo \mJamdlaozieixelJbiambedtomoilpaloovrulo,vepJ \m vepJ. SitlanalolJdJsido,Revon, \mmuebdiebulpootizshozi?Bieosomeneo dlisadmonimotis\mtexisiezeludodtidlioulo.odusneoesan, \mmuebdie bulpootizshozi?! FlieazJdlistomsuru.DlipaoizJdlistomsuru. X\mezsueziampobJdo\o\mslasoJn\omoribiboibd. Tlaniparimipam,madoosidiediebdJ!amzomjalzbolode \mtlJxmod zJnieljJesuru.doosioze\md\nbred? Evuzdasoz. X\mex\npoozazbomJ: Ma...Zedlemzvulned\mzbolodlJa. Revon\mslinimooamvoul\rsablomzitomslididb\mJmdJrbo.Mazi edibdezireezde.Mazibadie\mshobaolJa.[mzJmaefietieriz. LJartifomibixosidlisineobadilmos.DlipaoizJr\nboitos. Somiidoda,Revon? Zamdvoar[nbJledarao. X\metJtatomseb: [mpirij.TelblonigtoemaineonosJ.OeltesJteojli,LJarfesasilodudar. doa.Daidoux\mJpamJ?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Zamdux\mJpamJ. Edamso,egadJnJ!ZbaminosanzJ\mfomj! SlixosJtesJsomifeelvodoadsanzJ\mfomjJ,melvo\mfomz? RevonrJzJblofolie\mguz.X\mezi\mdlozdJ. EnzJpozbamubufizdi. Pomi. E vuzd utedJ, \m ranie ranomoo, am subor mivilosod. Siorerpo suboo mar \mpirijieaorpedgusulieaoelirelvofladzJzilJxpami,tel \oiledienJ.Ma ti siorerpo, so ti zomi, sJso ile pam. Edamso nen taz re ir o oen xoz: Ti si br\mjo? TesJ \po diljo reslonori, \po fuo \mtibromo u tulompJ. Cuborar \o dilzi reslonori o zbazi: Fliea zJ bud bulamso foziri sirul si foziexJ. Oel ia en hudJl\d:EezJvoi!Shoeltietuaexo,ozielJdJ \mzunmamaopJoedseli \r anorozi ti neo nardi ulo o \r enimompezi sJ \r fe pedi. Va vueldi zalblomz re \msibad,s\mt \otJtazienesJlajJnomdieozi \nbromoziosJ \mdletifJlbadie onbamifoziri.[mesiemuebdi,fJx\mts\dtizrepilepJoedar\mdonbsitulnie,\o ebJlaorshomao,anoromtarozbam\mtao \mvepJduediraslaloribiselimao rizbazizi \mdonbarxorio.TizsubilosJileed\dtiaulzJvesolJaosJ \ovJsie shoel brJsili zJ voi ir sir badilmos. [m xoae alnJdueli, pJoedar bJlie upuzod o zabJled,\mzJfimoreiro\rrufosabanmar,vJlJzJzsuedJamsaf\md.Muebdie, Sarioc, sJso ee \r shine bi subor, o zi elJdJ tom mua \m foz, \r shomao o \r enimompJsJtesJmaotJbesi,\ofulnalobJlompoo.[oneozbazizJosielJoildeli \mjimamsho,tiveJsaduposiorerposuboo.Tiedamso,pJoedarmazineoebluboi ti Sarioc, tel mao sila oildeli. [mzJ esizde fimo \m voiseli muebdi, donb ti u zJbdJn\mJ, oel \m siri tom alnJ pJoedar, seli \o oapie bJlompoo, \o sJrsJ n\mtloeovJsasiiesiozizbazizi.Sariocile\msarnievilosoloo,sJso\mfJpezisan zJ zi ebili. DlisalJ emo, o ir egamzi am d\mJl \m duedJ badilie f\lzdio o zi \mtlJjuzdotiuvedJ.Telvedeoapiebierdsomife.Sariocridlonozireen\mtuofozi al\di, \msils\mt zJ f\li x\xemoi \mdli io. Sa duedi esizdie, tlejuzdie rul ile deli. Edamsoir\oebJlabimdlablonetedJvidio,zerf\mtus\mtilepJdadJobiseritie vo fouredJ ti oapodar io. Zi elJdJ pam o demtla o u vJsa zJo esulti \mslitili. Dlixomtazi, vede zusudo fozar am zinm o zi tizbJlpo ti erizar zJa. Sarioc \o raJ rusar. [mfJpezi zJ sasiliezsJ. Tel vede ma zi lotosJ re \mJrponie fozarao rao o SariocdlipaozJolienomdiezsJtixenJjolieo \mvl\mjilie.NeodlisalJemo.Amio vinio \o brJsa ti ir o vJsa dud si ile \m zdeli zJo bresJ o ie rao Sarioc. Zi sJzJdulolJ oel ir \mfJpJ zJ voi sasilod. Tom mua dlisalJ emo. Uppomazi dud si tulozi.[mdluxo,\otulozJvoisumtasJdul.Ilebadilmos,telmosoutedJmonimo maolisamuzsazibadilie. [mzJsumtasJdularileerizbifoepJ. [obadiesumfomji aulbipJdl\mootomzvedzJreriejJbiirzassizul.TuelnueldiesumtasJdularao tizbJlpiefozartilierodedi.Dudao,nueldieamaounilesifezilouz,neozilouztis\d dudsivJsazifliutedJ.TeltivoiselitedJuppomazisiiesitulozi.Esantulieezde.Zi \mtuoamdonb,ebuo \rvJsabisumtasJdulzJooexoriri. [oraJrusaroezdvir 281
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sarioc \mfJpJ zJ edesi. Tunmo narpo emo \m besi, vJlJ \nbudlofolo tom beldie zabaorul,ovaoapodoblipaodseamunpamotlibd.B\mJs\mtnueldie\rraJ tomranieranomoo. Revonezsardezisaedimpoi.X\meetJajJ: Tiedamsoiamaneotuln. Tisi?oxpasmoir,raedbimiedibdedi. [noebeli\mfozonJshomaoi. DJsausrobJoebuolJzbamzi\mdlipJloomiluzdodi: Esan i tomsuru. Oel ia dud \no enomdizs ti suborar seli br\mjie ti anorompJ. RevonedibdJ,telx\memaneozsueziufulpJ.Zij\mtosJmuebdiedlisie ed\dtilibiti.ZilotosJobrisJ,al\mt: MuebdiezJpoetasJpasaloi! Teliemaxozimonos. XJlo \m tibJldeli am pultio bi suar sJlaoe oiiea van o zs\mdio. Nilzi nard, sJso tozdempe ile neo neli tis\d \o \mshobaozi. Zuzo \m siri tom alnJ o pJda\maJtidlioulo.Tizshoziambodos. MuebdiezJpoetasJpasaloi!zbaziir.IazamdRevon. OmdlJ. [mpultiomaileatis\duzupJounJzapJbiselizievreadliosJlpo. Siseapo,blompari,\msurparesizde\mtibJldeder\nbJlJpoio? SeaduserizJ\mfomjLJar. SlixosJtesJsomifeelvosamuzsadserie,melvoalnedu? doa, tel somife e neo nilz \meomdie nie. Dlipaoi zJ doo ti ir. Ze dlemzvulned\mzbolodlJa. E efad ti eriz \mdli e tifimo lJa o e \md\rmo tom mua zueliri o ranie ranomoo. Da meo ti eriz, bimdla sJ doo sJ LJar el \mfomji blom domi dudar. TesJfosduloemafevoede \mesiezdJmuebdi,fedlipaozJdiboilxooelJo \m rani. En\mpiriz.Dudao,mabupozJnJegapo? BudzJpozbamubufizdi. Pomi. Itizblituouenimooux\mJ.Biblonarun \rshineCasioroileardonar tommienarzJa.Bubularraovaziziambubulnomamed,fodiexo \mpiribd, \mzJ ti si e muaeziludie neo tibeldi, \msibalJzJ tuliezsJ pujJpoeonJlolie o voiseli ma zi neo j\mtie tis\d re zomi. Dlibded, tifimolJ lJo, reo o \mslixapo, oel zavridirirulzizshonpelJ\mmibJzeli.Maneobamieablipbimonos,mosonJselbi io \moo. Amoo briselJ o ro zi boilta alne, erpoo nalolJ. Casior e \msilsed zJo dlixiezsJ, tel ma rea raed \m zienJ. Ebuo am erd mien \o edesJ o \o asozi bi dupo;CasiorzsJbJblomdlunomami.LJdJsoboiltadnardixori,b\mJzihudJl\zJ vesJ fliam rasla seli zJ lJn\mJ bizdi donb. Fla zJ zi \mzupiezsJ sa u x\mJ. Bi er 282
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


tuorie un \r shine Rosiac. Ir vazizi sumzotiled tomdudtieame ti eo zJo am dob soated,sJsobidlisiexori \mdlijoblomsutlomianprepo,sJad\mtsiiesimienarzJa maobadiete. [mdlumuebdi, \mdlubuoimopJ,fJxaux\mJ \mf\ldomtazi \m ranomeramoo.TomdlamonpurtmiedibdedomizdJb\mod,zilibixoreieo\o labzielobori.X\mesJxabibJn\mdo \msibazJbr\mjJ.Rosiac \osilaoildelioo zbazi sJ maneo oapolie \r \mtinmezi re ee u vebdJ misajidedJ. Ie xozi sJ i blie tiflini, sJ moso ma tizshozizi \msJ ushoo, tel re zdJlaompiri rao, \o tifimo zupoi. DlJolJ \mbesiamdonb,ebuoRosiacupzilfJsJx\mebaldeniliabin\omomodi nJmaovueldivomi,telre\mdlipJlorizeriie\olJzbamzisJiudeomJbiselielvo neopomizJmauevrimosoutedJ,titlejarvilosoloorul. [mdlumuebdi,n\medti u salouxodedi mipamiezsJ, bi s\mt x\me tulnie, \o zsuezi \msid nJmae ti re n\me zd\mjJ. FJxa \m berne tizvJsadJ am usho seli zi tizshozi, srobo o zbazi: somifliezJeopJdudardlipaoizJvoiblijJdodzJboeltJdudar.Rosiaczizbiloio pobJ. X\me zi dlixo, \mzJ ma tizshozi ushoo. [o xozi maneo, sa dlozdipi, sJ e bulmodbiamtlanvJlJ \mduelsiliosJiteduelizJnieljJb\mJresebJd. [oneo xozi zJo zsuedJ o siererdJ nJmaJ, ebuo zJ \mpiriejJ sJ zi fe dlemzvulne \m x\mJsabadilotibromitueltesJsomifefevesiamzeslovosoabimdlaie.TesJma,zi fe blivesi \m flJgodueli. Rosiac \mdlipJ si zeslovosoa, oel x\me lJzbamzi sJ fe dlipao zJo zbiri n\omori \mdlam fez anbrad sa z\mjiri amao un tom ranie ranomoo, seli ma neo elimonos ti boiltad. Rosiac \o tJta ziene sJ ma ir ile esire. Edamso,biesurudlisaCasior,sJad\mtamrus \mselizJlJn\mJamdonb,sJsoile upuzod,purmefovJlJzbilempJ.Rosiac \rfJxao \ozbazitizblimizJpaompeze. CasiormazdJdabij\mtalo,zislizdJreun\mJo \ozsalziz\mjiri \mdlamfez bimdla x\mJ. Ie \o et\mso berniri, tizshozi ushoo, \o slizsa elobo o xpalJ, xos\mtao rao Casior sJ ma fe vo aoded mosoutedJ, bimdla sJ x\miri zamd minalodueli.Rosiac,saomonextlupodJ,brisJ\mebuoreeozJo,oelCasiorlJnezibi ganJdedi nuld \m surope si vazizi sJnomar sirul tuo. Dudao, lisamudompe x\mio \o tJta badili zJ dlJoezsJ neo tibeldi o bizdi baom, nilzi zJ u seadi, sJso esanefieamzsub.RosiacpuronardJflinioelzavridarzJabulmooirzJuseadibi x\mJ.UjJzo,\mzJie\ozbazisJmaneobudvo\nbliamJ,voomtsJbadiloribiseli ri efie esan ri zdJdiea \m seri. Ma badie vesi pomi tis\d tesJ mao vJsie pomi zoio.Ir\mdlipJsomiiletifomJ,oeliexozi:LJar \mzao.EdamsoRosiacnilzi\m muebdiebulpootizshozizJ \mvlamdiLJar,telva \mfomz.Oelx\mezavilonard oel gatisede ezable pomirao o lJarao \o zrJpo. Ile bi bamsdar ti e zi blivesi \m x\mJlie. Bodosarmaneofulpo.Revon\mdlipJ: TelsaunarsirJrerd,Casior,size\md\nbred? Zazbom\mt,bodosarzbazi: Casior e egamz blie d\lxoa. [mzJ ma ze rJzed \mfomz. E etamed samudompioeliaodzJuegadibix\mJ. RevonelJdJzblinJzapetomnogrusarsJnJlapio: 283
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sizamdesirie? Seldie tom zd\mje sablomti dud siie si ze zsloz b\mJ esan. Sie tom nogrus siie si zi fe zsloi ti esan o b\mJ re zv\lodar donbarao. Oel sie tom tliebdesiiesimazifezsloimosoutedJ.NiliabejomorisJlpootomnogruszieteajJ sJlpoo tom zd\mje, tel sie tom tliebde lJn\mi mizshonpedJ, sJso doompe o midoompemaslizsomazset,tuelziezsamtozieledJ.S\mtbinezJfulvotuel tuaJsJlpo,dudarfevovuzd. [rblofousrobJ,ebuo\oxozi: Difuoegadeobidomi.Tizshotiseldietomtliebde! Revonutizshoziosodo.Bodosarzbazi: Eo tizshozu re esiieo bejomJ se x\me. Tlanalori fuezdli zel badie zJ zi \md\rmiezsJ.EsandlipaoizJbriso.ZuelirimaediebdJ. Eei.[ponaranizs,Casior. MuebdiezJpoetasJpasaloi,[nbJledi! Mafulpobluzdoo,nulnJoRevon. Oiotompultiobis\nboi.RamebromJile\msebarsilarao.Neotibeldima ilemonos.DlipaoezJzi\mduelsJ. ZieixJbibJn\md,\mshoziushooonalnalJ: Sariocsirbadilmos,zdJb\marfozirul,ia,Revon,robzodtibadili,saushoo \mshootomlexiriramoo,dishin!EledJnodi! Etulno,oel\mzunm\oebJlaSarioc. MuebdiezJpoetasJpasaloi!IazamdRevon. doasomiido,siidoosifliozJvoo. FlieazJpobamu\mdlipeli.AmezomjalJ. EbadiezJdiasotshoelesan.[mzJedibdzJmodierJdalo. [posamuzsbadilie.FlieazJpobamu\mdlipeli. Zbami. otabJesiie,\nofio\mjJtaozJnJdlixizs,sezJbuddlisiblombueldJ? [pofuo\mjJtao. LJarbuedivo\mfomz? Buedi. Revonzidlixo.Sariocilezomjalarselidoeserieoirbadiebulamsofoziri. Bulmo\mvajJsJdlisezex\mio. Blofie tom mua re xotar aloe, ti tabJ seli ma neo badie zonpo ranome ramoo.Efiemifuoitizblogom.doesJfevesidudsiofezde\mbadompJ,dudao efiemifuoitisomifeselizJotie\mslitili.[mvepJileLJar,\mzbediileFerie. DedJ,egadJnJ! Dienegaded,telmaneobudzJdiegad.Esanzamdunesan. VJsabezar. Revondar 284
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

(Primul lucru pe carel vzu Revon fu zidul uria, la ase pai Tn faa sa. Privi Tn stTnga i observpoarta,maibinezisgauradeschisTnzid.NuTncpeanicioTndoial,peacolotrebuiasintre. S intre i s Tnfrunte Rul. Se apropie de poart. De dincolo rzbteau oapte ciudate i foiau umbre mainegredecTtnoapteaTnsi.Cumsseducprintreele,cTndnutianimicdesprespiritelerele?Se gTndicarfiTneleptsTncercemaiTntTisaflecTtmaimultelucruridespreacestea,desprefelulTncare potfiTnfrTnteiabiaapoistreac. SncTnaintedeaTntoarcecapul,simiTnspatelunaplin,dTnduiputereiTncredere.Ovzu uria,albcadeghea,deasupraorizontuluiitiucatuncicTndeavaapuneinoapteasevasfTri, vatrebuiorisfiTnvins,orisfifostucisderazelesoarelui.Altcalenuera. ZrideparteocascuferestreleluminateipornigrbitTntracolo.Nueratimpdepierdut. AjunsecTndlunaurcasecuopalmpeceribtuTngeamdetreiori.Uasedeschise. Noapteasiaducbucurie!urel.EusuntRevon. iieasemenea!EusuntozTn. SlpoftiTnuntruiseaezarpeunpatdinierburiiflori,faTnfa. Cedrumurirtceti,Revon,Tnnoapteaporiideschise?PeaicinamaitrecutnimenidecTnd azeceasarotitdetreiori.itocmaiacum,Tnnoapteaporiideschise?! Vreaustrecdincolo.Trebuiestrecdincolo. ZTnascoaseuniptiTiTncrucimTinilepepiept. Drumeulenebun,nutiiceteateapt!UnsingurspiritaTndrznitsmeargacolo.tiicei saTntTmplat? Afostucis. ZTnazTmbiisuspin: Nu...SatransformatTnspiritru. RevonTncremeniiunfiorTlcuprinsedincretetpTnntlpi.Nuseateptaselaasta.Nuse puteaTnchipuiru.Snsnuaveadeales. Ruldevinepezicetrecemaiputernic.TrebuieslTmpiedic. Cineetitu,Revon? SuntfiulSmpratului. ZTnaddudincap: Sneleg.Darprimejdianuemaimic.Iardacdaigre,Rulvacuceritotul. tiu.TuetiozTnbun? SuntozTnbun. Atunci,ajutm!SpunemicumsTnving! CrezicdaccinevaarfitiutcumsTnving,narfiTnvins? RevonlsprivireaTnjos.ZTnaseTntrist. Amsispunopoveste. Bine. Afostodat,Tnlumealuminii,uncopilnefericit.CeilalicopiinulTnelegeauilbatjocoreau iarelarfivrutsserzbune,darTierateam.Nudeceilali,cidesine,ccierabun.Atuncimamdusla el i iam zis: De ce plTngi? Dac Ti tergi lacrimile, Ti voi Tndeplini o dorin. Copilul Ti terse lacrimileispuse:Vreauspotporunciviselecelorceviseaz.IareuamhotrTt:Aasfie!Chiar deadouazi,iseartTnsomnunuibiatcareTlumilisedemaimulteoriiTlameninasecTlvabate. FufoartesurprinslaTnceput,cTndTidduseamacrugminteaiseTmpliniseicTntradevrputea impune visele. Sn acea noapte, vzTnd cTt de slab era biatul Tn timp ce dormea, Ti apru il chinui, umilindulispunTnduiTnfatoatelucrurilepecarenuilespuseseTntimpulzilei.Descopericera atTtdeuorsfaciruicTifceachiarplceresfieelcelputernic.Snziuaurmtoare,biatulprea obositisuprat,TnsvenilaeliTllovicupumnul,frsscoatuncuvTnt.Noaptea,Sarioc,cciaaTl chemapecopil,iseartdinnouTnvis,TlchinuiiTlamenincdacnuidpace,Tivormuriprinii. Si mai spuse si cear iertare Tn genunchi, de fa cu toi ceilali copii. De atunci, biatul nu se mai apropiedeSarioc,darnuiceruiertare.SnsacestaveniTnfiecarenoapte,timpdeosptmTn,iarTn celedinurmbiatul,careTiiubeaprinii,TiclcmTndriaifcuceeaceisespusese.SarioceraTn

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


culmeafericirii,cciTnvasecumsseapere.Trecurani,ielajunseuntTnrTntoatputereavTrsteii seTndrgostideofat.Darfataiubeapealtcineva.SariocletrimiselaamTndoiviseurTte,TncercTnds vTrezTzanieTntreei.Cutoateacestea,dragostealoreratare.AtuncielTiaprupentruprimadatfetei, salvTndocTnderabtutipecaledeafiviolatdeiubitulei.Seartbunitandruiofcusiacorde Tncredere.Trezinduse,fatasocotivisulunsemnisedespridealesulsu.SariocTilulocul.Snvase s cucereasc. Dar fata nu se ridic la Tnlimea visului lui i Sarioc trebui si reaminteasc dezamgireaiTnfrTngerea.Maitrecurani.UneifemeiTiplcudeelifcutotceeraTnstaresiplac iealuiSarioc.SecstoririarelTnvsfiecucerit.Dinnoutrecurani.Obinusetotcedorise.Sntro zi, Ti dori s fie conductor. Era puternic, dar niciodat nimeni nui recunoscuse puterea. Sns conductoruleraalespevia.SiputeaconvingeuorpebtrTniidinsfatslaleagpeelsuccesor.Doar moarteaconductoruluidespreavisulderealitate.Totui,moarteaunuiomeracevaserios,maiserios decTttotcefcusevreodat.Dardefiecaredatobinuseceeacedorise.Acumdoreaasta.SeTndoiun timp,apoiTlfcupeconductorsiiazilele.SiluloculiastfelSariocTnvsatace.Domnimuliani Tn pace, fr Tmpotriviri din partea supuilor, i fu iubit i preuit ca un om bun i drept. PTn cTnd moarteaTlludinlumealuminii. Revonascultasecuatenie.ZTnaadug: Deatuncieunumaidorm. Dece?izbucniel,luatpeneateptate. SmiapareTnvisimchinuie. TcuoclipiapoirspunseTntrebriinerostite: Acumedincolo.IareutotTmiamintescdecopilulcareplTngeadeumilin. Revonatept,darzTnanumaiscoaseovorb.SegTndicnoapteatreceaatTtderepede.Se ridiciplec,urTnd: Noapteasiaducbucurie! Dareanuzisenimic. ZriTndeprtareunbordeipecoulcruiaieeaufumiscTntei.Mersemult,ccidistanaera maimaredecTtTiTnchipuise.SosiTnceledinurmibtuTnudetreiori.Deschiseunpitic. Noapteasiaducbucurie!spuseel.EusuntRevon. Intr. SnbordeinueraudecTtosobiomsupecareseaflautreicri. Cecaui,prinule,TncolulacestaTndeprtatalTmpriei? CautocalesTnvingRul. Crezicdaccinevaarficunoscutcalea,narfiurmato? tiu,darcinevaamaimersTnainteamea.Trebuiestiideel.SatransformatTnspiritru. AavutdealesTntreadeveniruiaTntTlnidinnousoareleilumealuminii.Tunaideales, pentructiicRularTnvingeprintinetotul.DacvictorianuvafiataTnaceastnoapte,vatrebuis tepierziiariTnlume. AmTneles.Totui,nupoismajui? Potsispunopoveste. Bine. EdespredoioameniiozTn.PeprimulomTlchemaCasiorieraultimuldinneamulsu. Poporulluifuseseunpoporminunat,viteaziTnelept,Tnsdeceanouaseroteamaideparte,Tncepur s doreasc bogia i mrirea i fiecare nu se mai gTndea decTt la sine. Treptat, devenir ri, lai i Tncrezui,iarsufletelelorseschimbarTnnepsare.Numaipuneauprepenimic,nicimcarpeeiTnii. Uniiplecarilisepierduurma,aliimurir.CasioraTncercatsitrezeasc,darnulauluatTnseam. ApoiunaltneamTiataciTiucisepetoi;Casiorscpprintrominune.Rtcipierdutmultezile,pTn sehotrTsfacvreunlucrucaresrmTnpestetimp.VrusseTnsoeasccuozTn.PealdoileaomTl chema Rosiac. El fusese considerat dintotdeauna de ai si un tip ciudat, cci petrecea zile Tntregi prin codri neumblai, cutTnd ceea ce neamul su nui putea da. Sntro noapte, Tntro poieni, vzu o zTn TnvTrtinduseTnluminalunii.DintrunimboldneateptatinestpTnit,serepezilaeaiTirupsearipile. ZTnaczupepmTntiTncepusplTng.RosiacTiceruiertareiispusecnumaiiubireaTlTndemnasela

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


aaofaptnecugetat.Eazisecepreadevreme,cnicinudeschiseseTncochii,darlastruinelelui, Tidevenisoie.TrirTnpaceuntimp,apoiRosiacobservczTnapurtamereupemTininitemnui foartefine,darlaTntrebrilesaleeaTirspunseceotainpecarearfimaibinesnuoafleniciodat, dedragulfericiriilor.Sntronoapte,mTnatdeocuriozitatenebuneasc,pecTndzTnadormea,Tiscoase TncetmnuadelamTnastTng.VzuTnpalmadesfcutunochicaresedeschise,clipiispuse:Cine vreasaibtotultrebuiesfiepregtitspiardtotul.Rosiacsesperieiip.ZTnasetrezi,Tnsnu deschiseochii.Sizisenumai,cutristee,capornitpeundrumfrTntoarcereicedatoaresmearg pTnlacapt.Simaizisesiscoaticealaltmnu,apoisTneleagcsevatransformaTnzTncu puteri depline doar dac cineva va face un sacrificiu pentru ea. Dac nu, se va preface Tn vrjitoare. Rosiac Tntreb ce sacrificiu, iar zTna rspunse c va trebui si spele mTinile Tntrun vas umplut cu sTngeleunuiomdinlumealuminii,carenumaiarenimicdepierdut.RosiacTidduseamacnuelera acela.Atunci,peacolotrecuCasior,cutTndunlocTncaresrmTnuntimp,ccieraobosit,bolnavi frsperan.RosiacTlvzuiTispusedesprenesbuinasa.CasiornusttupegTnduri,secrestlao mTniTiscursesTngeleTntrunvaspentruzTn.EaTiadTncipalmele,deschiseochii,Ticrescuaripii zbur, zicTndui lui Casior c nu va fi uitat niciodat, pentru c zTnele sunt nemuritoare. Rosiac, cu inima zdrobit, plec Tnapoi la ai si, iar Casior rmase pe jumtate mort Tn coliba ce fusese cminul celor doi. Totui, recunotina zTnei Ti ddu putere s triasc mai departe i peste puin, merse s o caute,cciacumaveaunscop.RosiacbolimultvremeiarsufletulsuporniielsocautepezTn.O gsi,TnseaTispusecnumaipotfiTmpreun,fiindcputerilepecareleaveaacumlestteauTncale. NuputeafacebinedecTtdacnuifceabinesiei.ElTntrebcineeradevin,iareazise:RulTnsui. AtunciRosiac merseTnnoapteaporiideschisesTnfrunteRul, darfuTnvins.IarzTnasuferimultiar judecataasuprabineluiiruluiTislbi.ErapepunctuldeaseprefaceTnzTnrea. Piticulnumaivorbi.RevonTntreb: Darcuomulcellalt,Casior,cesaTntTmplat? SuspinTnd,piticulspuse: CasioraajunspreatTrziu.SnsnusalsatTnvins.Aadunatcunotineiareuitsoajutepe zTn. Revonartspremsuadinmijloculcmruei: Cesuntacelea? CarteadinstTngacuprindetotceeacesascrispTnacum.Ceadinmijlocceeacesevascrie de acum i pTn la sfTritul timpului. Iar cea din dreapta ceea ce nu se va scrie niciodat. Mereu paginilecriidinmijlocseadaugcriidinstTnga,darceadindreaptarmTneneschimbat,ccitiina inetiinanucrescinuscad,doarseascundisearat.CTndpemasvorfidoardoucri,totulvafi fost. Slprivioclip,apoiTizise: Tevoiajutaipetine.Deschidecarteadindreapta! Revonodeschiseiciti.Piticulspuse: AideschisolaaceeaipagincazTna.DrumurilevoastresarputeasseTntTlneasc.Acum trebuiespleci.Soarelenuateapt. Aae.Simulumesc,Casior. Noapteasiaducbucurie,Smprate! Nuvorbiprostii,mormiRevon. IeidinbordeipecTmpie.LunaplineraTncapulcerului.Maidepartenueranimic.Trebuia sseTntoarc. SeaezpepmTnt,Tnchiseochiiimurmur: Sarioc cel puternic, stpTnul viselor, eu, Revon, lipsit de putere, cu ochii Tnchii din razele lunii,techem!Aratmite! Adormi,iarTnsomnTiapruSarioc. Noapteasiaducbucurie!EusuntRevon. tiucineeti,ceetiicevreisfii. VreausipunoTntrebare.Unasingur.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Aputeasteucidchiaracum.Snsateptsnitealturi. Sicunoscputerea.VreausipunoTntrebare. Spune. idupaceea,TmiveiTngduismtrezesc,caspottreceprinpoart? SivoiTngdui. RulpoatefiTnvins? Poate. Revonsetrezi.Sariocerasingurulcaretiacaleaielputeaporuncivisele.PorniTnfugctre casazTnei. Priveadinnoulaziduluria,dedupcarenumaiputeasimiluminalunii.Aveanevoiede sprijin.tiacvafacetotceivastaTnputin,totuiaveanevoiedecinevacaresideaTncredere.Sn faeraRul,TnspateeraValea. Tat,ajutm! Teamajutat,darnumaipotsteajut.Acumsuntomacum. Fcupasul.)

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nul duruse niciodat nimic. Nu simise niciodat nimic. Nu tiuse niciodatnimic.Aacseduselaneleptslvindece. Acestalpriviiispuse: Cesimteleulcndisfieprada? Elsenfuriiplec. Pesteuntimpvenidinnou: neleptule,mdorcolii.Cepotsfac? Cesimteranulcndisappmntul? Elidduseamacmaiareundrumlungiplec. Pesteovremesentoarse: neleptule,decemdorminile? Cesimtepmntulnrsritulsoarelui? Ellneleseiplec. Veniiari: neleptule,mdoareinima.Edestul? Cesimtesavantulprivindoinsect? Elidduseamacomuldinfaasaaveadreptateiplec. Dedataaceasta,trecumaimulttimppnssentoarc. neleptule,icapulmdoare.Dece? Cesimtevulturulprivindpmntulnrsrit? Elticaaeraiplec. Pesteunan,veniiseaeznfaaneleptului. Mdorochii,neleptule. Cesimiacum? Ellprivi,iarcellaltintoarseprivirea. Trecurmulianiineleptuluitdeel.Darelvenidinnouiseaezla cptiulacestuia. Oh,mdoraripile! neleptulmurmur: Avreasteajut,darnutemaipotvedea. Iarelnusiminimiciplec. (2mai1995;18.14)
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1




ntro zi, zeii au rpit din lume doi oameni, un brbat i o femeie, ducnduintroaezareciudat,undeputeaugsitotcedoreau.Daraezareaera ngrditdejurmprejurdezidurigroase,ceseridicaupnlacer. Zeiileauartatatunciunizvormicu,laomarginedecolinileauspus: Priviiinelegei:cinevabeaprimulapdinacestizvorvafipierdut,iar cellaltsevantoarcenlume. Apoi zeii nu se mai fcur auzii i oamenii rmaser gnditori lng firiceluldeap.Nusecunoteau,dariddurseamaimediatcpentruapleca ctmairepededinacelelocuri,trebuiausseurascifiecaretrebuiaslfacpe dumansbeadeacolo. Cu aceste planuri n minte, se ntoarser n oraul din mijlocul aezrii. Gsirbijuterii,straieregeti,mncarecapentrucelemaimariospee,darniciun stropdeap. Vatrebuisvedemcinerezistmaimult,zisecineva. iatunciunuldineifumaincreztor.Darceluilaltivenioidee:sparse un fruct de badaf i din el se scurse ap limpede. n locul fructului spart se ivi ndataltulproaspt. Ceminune,spuserei,avemtotcedorim! Soarelestrbtude5oricerul,iarbucuriancepusscad,ccileerador decunoscuiiprieteniivoiaussentoarcnlume.Deciuralersridinnoun suflete. Maibineammergelaizvor.Dacvombeanacelaitimp,zeiinuvormai aveacefaceinevomsalvaamndoi. Seduserlngcolin,fiecarecugndulslateptepecellaltsbea.Dar acolosecodirilefufric,aacsentoarsernora. Zi de zi, unul din ei ncerca sl ispiteasc pe cellalt, iar acesta fcea acelai lucru, la rndul su. Dar, cu toate c timpul nu nsemna nimic n acele locuri, aceste fapte erau tot mai rare i mai lipsite de convingere. i odat ele ncetarcutotul.Seobinuircunoualorviaisendrgirunulpecellalt. ntronoapte,brbatulizise: Ceegoistamfost!Numamgnditcpoateeiilipsetelumeamaimult dectmie.Dacamcuraj,eaivaaminticubucuriedefaptamea. Atunciplecspreizvor. Larndulsu,femeiaispuse: Ce egoist am fost! Nu mam gndit c poate lui i lipsete lumea mai multdectmie.Dacamcuraj,elivaaminticubucuriedefaptamea.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Segrbiieaspremargineadecolin. Acolo se ntlnir mirai, dar cu fericire n suflete. Privir spre izvor i nelesercsecase.istrnserminileistelelelucirasupralor.


Jmalaaeraoplanetlafelcaaltesutedemiliarde1,dar,nacelaitimp, unicnUniversprincalitileneobinuitealelocuitorilorsi.Fiecareindividavea onsuirecareldeosebeaderestulpopulaiei:unulputeacitigndurilecelorlali, altulmicaobiecteprintelekinezie,cinevaputeapriviprincorpulcuiva,altcineva tia dinainte ce se va ntmpla n viitor. Aceasta din urm l definea pe el. i numelesueraHzgta. Munca pe cmpul de ciuperci2 prea la prima vedere obositoare. Orice muncparegrealanceput,pentrucaapoi,cutimpul,obinuinaispecializarea, experiena,sispuncuvntul. Dup10ani,meseriadestropitornumaiaveapentruelmultesecrete.De fapt,erau10anidecndpreluasefunciadelatatlsu,daracestaavusesegrij slnveedemicdiverseleingredienteimodullordecombinare,pentruaobine substanelenutritivenecesarerecoltei.Dinciupercileuscatesefceaofinfolosit lapreparareacelormaimultefeluridealimentejmalaane. Eradiminea.Soarelenuseridicasenclaorizont,noricenuiirzleise trauuorpecerivntullerspndeafrignoase.HzgtaiSabatnajunser lamargineacmpuluiiitraserrsuflareanaintedeancepe.Erancdestulde ntunericiceidoimaiputeaupercepeurmeinfraroiinntindereanemrginit, naintecaacesteasfienghiitedefinitivdecafeniulattdefamiliar. Plecochiinpmntiiseiviimediatnfachipulluieviemi.Strnse pleoapelecusete,ncercndparcsfrngimaginea,daraceastaiintrnsuflet, redeschizndranapecareelsestrduiasonchid.Realizdeodatcmuchii si faciali formaser involuntar expresia durerii. Se for s se concentreze, mulumind n gnd zeilor c Sabatn era n spatele lui i nu putuse observa momentuldeslbiciune. Trebuie s m vindec. i nu voi reui, atta vreme ct nu pot privi obiectivlucrurile.Afostoprostiedelanceput,idinparteameaidinparteaei! Seapropiardeprimulrnddeciuperci.Hzgtaseapleciinspectcu unaerplictisitstarealordedezvoltare,precumiplanteleparazitedepetulpinile albe.idictconcluziileluiSabatn,concretizatentruncodde3litere. Continuarnacelaifelpncndsoarelesenlde2palmepecer.
1 2

deaicinainte,numerelevorfiexprimatenbaza8 jm.zuf

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Poateterminmpnsentunec,mormiHzgta. Poate. Binecmaprobi! naintaser cam 300 de pai n masa compact cenuie, dar el tia c mai aveau nc de 10 ori pe atta. Izbi furios cu pumnul o plrie uguiat care i ajungeapnlabru. Dacnutecalmezi,veigrei. ntoarsecapulspreSabatn,careformancurajare. Hzgtasegndicamceartrebuisrspund,darnuiveninicioidee. iacumeuceszic? Mulumesc. n ochii lui Sabatn strlucea rsritul soarelui. Hzgta intenionase pentru o clip s exprime dispre, dar acea mic scnteiere de lumin i ndrzneallmbun.Zmbiincercdinnousuitedeeviemi. Cnddisculalborbitorajunselazenit,stropitorulefscrniprintredini: Haisstmpuin. nregul,spuseSabatn,aruncndpejoscarnetulncarenotasedatele depnatunciisechircilaumbrauneiciupercimainalte. Hzgtaiurmexemplul. Vdcetibinedispusastzi,vorbielfrslpriveasc. isingurul,dealtfel. efulsemulumisidreagglasul,frszicnimic. Separecaiprobleme.Arajutasidescarciinima? Ha!Nuideajunscmimergtoateprost,maitrebuieslefacipublice! Sabatn nu ripost. Asta era destul de ciudat, fiindc de obicei gsea replici destul de uor, indiferent de subiectul conversaiei. Deci nu voise s rspund. Hzgta l privi pentru prima oar: era ntruchiparea linitii i detarii. Suntdatorsispun,dinrespect,odatceneaflmacummpreun! Credc... Seopriunmoment,nehotrt.Cellaltmimatenie. ...cdemineosportdinnounsemnulverde! Seateptasecadestinuireasfiemaidificil.Senfiorderspunsulcare urmasvin. Etiunbulgredepmnt.ivreispariopiatr! Opaldevntscuturatmosferancremenit. Aiaveanevoiestiicestecinevalngtine.Ceaestelngtine? Oh,terog,lasm! Unajutordinafartearputeaajutasnelegiproblemamaibine. tii,nultimultimpchiarcredeamcamnceputsmcunoscctdect. Cnuvoiapelaniciodatlaunnelegtornloc.iuiteundeamajuns!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Autocomptimireaelatineprimasauadouafaz? Hzgta l fix mirat. Ct i era de uor si ptrund sufletul, i nc exprimnduseattdeconcis. Darsimaispunochestie.Eusuntsfietorul,nuea. SedelectapoicumirareasinceraluiSabatn. Pentrucpurisimplununeputemnelege!Nuputemcomunica! iatuncidecevaiscosnsemnele? Rspunsesumbru: Eraunlucruinteresant.Oexperiennou...cred. Da.Daroprostie. Hzgtaizbucninrs: Iateuitecumstsubciupercicritic! Cellaltadmiseirseiel. Oricum, spuse acesta dup cteva clipe, decizia asta a ta e un pas important. Chiar dac acum suferi puin, e bine c teai trezit. Unii nu se trezesc nicicndmor! Da. Contientizndfrazaurmtoareainterlocutorului,Hzgtaizise: Zeilor!Deundetiesta?! Sabatnvorbi: Am impresia c nici nu erai legata de ea, n mod special. Te gndeai la visultu,ieraunlucruinteresantsoidentificicuacesta.iacumidentificarea adevenitmaiputernicdectminteata. eful simi uoare furnicturi n picioare i se ridic. Fcu civa pai i ntinse minile ct mai sus spre cer, ca s se dezmoreasc. Cellalt l privea zmbitordejos. Einaidegndsispui? Amsispunmine. Cercetndcuatenieotulpinneted,elanunsenteniossfritulpauzei: D1222R43GFZ. Lucr n continuu nc 2 ore, cu mintea golit de alte gnduri, pentru a obineoeficienmaxim.Ziuaavea10ore. D2445R42GFZ. Sabatn not contiincios. Hzgta fcu un pas, trecnd la rndul urmtor.Deodatscoaseoexclamaiedeuimire. ntre 2 ciuperci mari rsrea singur o floare roie de revi. O privi ndelung. Cinetiedelacedeprtareaadusvntulsmna,cucttimpnurm, pentru ca so vd eu acum. Izolat n cmpul uria i ostil, ncpnat s triasc...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Seapleciprinsefirulsubiredarputernic,smulgndulcugrijdaricu efort. Se ridic i ncerc s apuce floarea mai bine, dar un spin i intr cu atta puterentrundeget,nctapruimediatopicturdesnge,lafelderoiecai petalelencrustate. Hzgtastrnsedindini,darnuiddudrumul.Nuschiniciungest, fixndocahipnotizat.Stropiidesngecdeauunulcteunulnpmntuluscat. Sabatnseapropie,fascinatdenfruntare. Laso!optiel. Hzgta,catrezitdinsomn,apucfloareacucealaltmn,atentsnu senepe,apsnduidegetulrnitnpalm,pentruaoprisngerarea. Astasunteu,ziseelprivindroulaprins. Astasuntemtoi,vorbiSabatn. Banu,astasunteu.Avreasamorevipemormnt! Privi n pmnt, ca s nu vad o eventual expresie ironic sau dezaprobatoare pe faa celuilalt.3 Daracesta nu reacion n nici un fel, ntorcnd capulspresoarelecaresepregteasapun. Hzgtaidict: D2445R43GFZ. Sabatnformsurprindere,darefultrecularndulurmtor. n trei sferturi de or terminar. Bilanul era mbucurtor: peste 7 din 10 exemplare prezentau caracteristici normale de evoluie. Erau viguroase i sntoase.imaimultdectatt,reuiserunrecorddevitez:cmpulregalera unul din cele mai ntinse de pe continent, i multor stropitori lear fi trebuit cel puin3zilepentrutestare.Lorlefusesernecesaredoar11ore. Se ndreptar deci extenuai dar mulumii spre locuinele de serviciu din apropiere. Hzgta nu le aprecia n mod deosebit, dar era contient de utilitatealorntimpulcampaniilordestropire,careaveaulocdoarde10oripean. nrest,puteafacetotcedorea.AveaocasnoraulcapitalalregiuniiHerad,n careurmassentoarcpeste3zile,cndlucrrilesevorfiterminat. napoila...eviemi?Cechestieciudat! tiacpestectevaore,carevortrecedesigurinstantaneu,caintreagasa via,vafifanfacueaivatrebuisiexplicerespingerea,celpuinformal. Cititoriidegndurisuntavantajai,nucrezi?lntrebpeSabatn,care mergeatcutalturi. Frndoialmulidintreeiseconsiderbtuidesoart. Decespuiasta?

3 Pe Jmalaa, doar persoanele care descopereauun principiu nou aveau dreptul la un mormnt, pe care se nscriau numele, descoperirea i se grava o floare aleas de cel n cauz. Cine dezvolta un principiu deja descoperit, era incinerat, dar cenua sa era pstrat. Trupul celui care nu se fcea cunoscutprinnimicnumeritaamintireacolectivasemenilor.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Bine.Tuetifericitctiiviitorul? Nucunoscdect12minute.Tepercepiprezentulcapeunpunct.Euca peunsegment. Etifericit? Nu n mod deosebit. Dar nu m cred btut de soart. Fa de unul fr niciundar... Seopri,simindungolnstomac.lprivipecellaltcuvinovie. Iartm.Namvrut... ...tiucnuteaireferitnspeciallamine.Dardactiaicmvoisimi prost,decenuaievitatremarca? Aaecniciunomnunelegeperfectdarulaltuia? Aae. Nutiamcesevantmpla.Amnvatsnudauatenienmodnormal dectprezentuluipunct. Dece? Sabatnexprimamirare. Nu ai observat c toi oamenii manifest o tendin de apropiere, inexplicabil? Toi ncearc s vad numai lucrurile comune, n ciuda faptului c fiecareeunic. Nuechiaraadeinexplicabilattatimpctitufolosetimetoda. Hzgtaseopridezorientat.ideschisepercepiapentregulinterval.n clipaurmtoareirecptsigurana,darformncontinuaredificultate,pentru caatrebuia. Teampusnncurctur?forSabatn. ivenisizbucneascnhohote. Cemaincurctur! Cellaltiinuctevamomenterespiraia.Eraevidentciprearudece spusese. Eadevratcnumamexprimatbine,ziseHzgta,darnueoprosties sepunattaaccentpeunire,cnddefapttoisuntemdiferii? Sabatnurmasspun:Suntemasemntoriprindiferene. ntradevr,acestatraseaernpiept,ncercndssecalmeze,apoivorbi: Suntemasemntoriprindiferene. tiamcveiziceaa. Bineneles.Poismispuicarevafiatreiameareplicdeaicinainte? Nuecorect. Sigurcda.Darnuivoispune. Dece? Poatecveincercasoschimbi.Darnudeastanuizic,cipentrucnu vdnviitorlucrulacesta. Practicfacidoarceisespunesfaci!Nuaiputereaalegerii.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


icemiarajuta?Amnschimbsigurana.Nusuntsurprins.Dardemulte orimprefacsurprins,pentrucaatrebuie. Nuecorect. Eprotecie.Detaare. Presupun c e o senzaie plcut s vezi cum se scurge lumea pe lng tine,attdeprevizibil! Hzgtaschiunsurs. Mntrebcevoipercepecu12minutenaintedeamuri. Poateveiti! Arficeva!Pnacumdarulnumiafolositlanimic. Hm.ncearcsschimbiprezentul! Tentaia i frica i se strecurar simultan n suflet. Ar fi fost de ajuns si spunluiSabatnMineveivedeaultimulrsrit,itoatordineaexistenta lumii sar fi schimbat. Inima i zvcnea n piept ca vntul prins ntro cuc. Nu puteagndiisimidectcuvinteleCearfidac? Primameadecizie!Primulmeuactdelibertate! n viitorulsegment, el nu mai scotea nici o vorb iar cellalt i respecta tcerea,pncndajungeauacas.Puteavisaliber. Sfactotcevreau!Pentrucpotghicicevoraliidelamine. Acestaeraunlucruinteresant,darpentrumoment,numaiatt.Trebuias seconcentrezelaconfruntareadinziuaurmtoare. De obicei iar fi imaginat diverse situaii, n care era personajul pozitiv, aflatdeasupratuturor,saupersonajulnegativ,darnumainviziuneacelorlali.i plcea s se nchipuie drept nenelesul persecutat, care nfrunta adversitile cu demnitateimil. Acum ns toate acestea i preau strine. Atmosfera linitit l golea de gnduri i l umplea de senzaii. De jur mprejur era doar cmpie nesfrit. Ciupercilermsesermultnurmiarnainte,spreorizont,seputeauvedeadeja locuinele. Privea ierburile albstrui i norii nconjurai de reflexii roiatice pe cerulntunecatisesimeaattdemic,nctaproapecnumaiconta.Eradoaro partedinuniversulcarelcopleeacuncntare.Cemainsemnaeviemiacum? Cemainsemnaeviemi?eviemi... Cnd se desprir, i spuse lui Sabatn c a doua zi diminea va lipsi puin.Acestazmbi. Seculcfrsimaifacprobleme. Viscevanclcitisetreziobositiindispus.Afarerantuneric.nuntru era frig. Se ghemui n pat, ncercnd s respire regulat pentru ai calma btile inimii. Trebuia s o ntlneasc pe eviemi. Si vorbeasc. Cear fi dac ar ajungelaobazminimdediscuieidesprireanarmaifinecesar?iarcere amndoiiertaredeinarfinevoie,sarmpca,iardeschidesufleteleunulaltuia.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sau ea l va trata cu dispre: Ai terminat aa repede lucrrile? Sau tea pusregelepeliber?ElvardeivagndiEtimaiproastdectcredeam.Dar vatcea.isevantrebacumdeputusealegeaaceva. iprivivestagalbenaruncatneglijentpemas. Omdetiindemnaadoua...Galbenulsepotrivetecualbastrul! Ccieviemierajudectoare. Omoaroamenicuajutorulpreoilorizeilor! Izbucni n rs, amuzat de definiia carei trecuse prin cap. Se hotr s porneasc. Peste o or, intra cu trsura pe strzile oraului. Nu tia dac si lrgeasc sau nu percepia temporal, dar, dat fiind faptul c urma o experien important,aleseprimavariant. Urmasmearglaunmagazindembrcminte,sicumpereunnsemn verde.Eraoideebun,pentruclscuteadeexplicaiisuplimentare. Oamenieraupuinipedrum,prvliileabiasedeschideau.Sesculasecam devreme. Trase trsura pe o linie moart ca s nu mpiedice traficul principal, apoi se post n ateptare n faa unei firme care anuna pompos Articole vestimentare. n acel moment realiz ct i era de scrb. Toat tevatura cu nsemnele, discuiile... Lucruri fr rost! Mai bine luam trsura i nu m mai opream pn n cellaltcaptalregiunii... Proprietarul catadicsi n sfrit s deschid. Probabil l urmrise o vreme prinfereastr,cciserepezilael,jovial,ntrebnduldacdoreteceva. Osrm,rspunseelneutru. Negustorul l conduse nuntru, chinuinduse sl consoleze. Hzgta depusemarieforturisnuformezeoexpresiejignitoaresaushohoteasc. Cellalt i art mai multe tipuri, ndemnndul s aleag. Le privi cu atenie, oprinduse nspecial asupraunei simple buci de pnzverde i aunui nsemnelastic,brodatcuplatin. Negustorul, observnd ezitarea, i le aduse pe amndou n fa, ca s se convingdecalitilefiecruia. Simplitateaifrumuseea. ncercssimtcareisarpotrivimaibine.ntinsemnactrebucatade pnz i atunci i dori nsemnul brodat. ntradevr, atingndul, percepu comuniunea.Alegereaseterminase;hotrse. Abia acum i ddu seama c i limitase imaginea temporal. Era curios dacoptasepentruceeacetrebuiasopteze.Aaera. Pltiiitrasepebrabanderola.iveneabine.Isepotrivea.Maitrebuia sseducacas.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nu era departe, aa c ls trsura i porni pe jos. Peisajul i era att de familiar! Emoia i se aduna din ce n ce mai mult n suflet. Se opri i se privi cu detaare.Seprivicapeunstrin.Nuvoiasneleagdecefceaceeaceerape calesfac.Iarfiplcutcaeviemisciteascgndurile.Dareadoarcunotea adevrul. Btulau,innduirespiraia.Apoiseliniticaprinfarmec. i deschise eviemi. Era mbrcat pentru exterior i vesta albastr era frumoaspentrucopurtaea. Oprivinochi.Nutiacesspuniarevieminuvoiasspunnimic. Avea pe bra un nsemn simplu de pnz. Cnd observ i ea n sfrit, form surpriziarHzgtaoimit,pentrusimetrie. Apoieavorbi: Amavutaceeaiidee,nu? Hzgtazmbi.Secereaunrspunsinteligent,carensnuvenipentru cnarfivenitniciodat. Credcamsplec,ziseeviemi. Crezi?Nuetisigur?replicelpeuntonironic. Bun.Maiaicevasmispui? Nu,firete.Defapt,namavutniciodat. Eaexprimiritare: Nuneleg.Cevreidelamine? Smnelegi. eviemi pru c sa lmurit. Dac i mai rmseser dubii, aceast propoziie savant i le spulberase. Form lehamite i iei, ndreptnduse spre strad. Acum, n mod ciudat, ar fi trebuit si strige Dar tu? Asta, ca s fac poatedesprireamaidrgu.Easarfiopritoclipiapoi,frsntoarccapul, iarfirspunsdispreuitorEunu! Daraacevaarfifostonjosire.Cineeraeviemi,casirefuzentrun astfeldemodmnantins? Dininerie,dinobinuin,aproapecdeschisesegura.Seforstaci clipatrecu.Nurealizpedeplincesentmplase,totuieaseoprioclip,apoii continudrumul.Oapucpestradintrunminutsepierduprintrecase. Hzgta rmase mpietrit. De ce se oprise? Dar, mai mult dect att, ce fcuseel?Pentruprimaoarnviaschimbaseprezentulidefaptnuschimbase nimic. Suntdoarunsimplusclav?sentrebcuuimireiamrciune.Oarei ceilalipremonitorisimtlafel?Chiardaceaa,cucemajutpemine?Trebuies vedemparteafrumoasalucrurilor.Saterminattotulfrcomplicaii. inicinuseumilise.eviemiplecase.Eracuriosdacsevormaintlni.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Privicasandelung,gnditor,apoipornipestrzi.Timpde7anistudiase comportamentul oamenilor, trsturile lor de caracter i ajunsese la concluzii absolutsurprinztoare.ncepusedelapremisacfiecarefiinestedeosebit.Dar pnundemergeauoaredeosebirile?ncercasedecisgrupezediverseletipuride personalitate.Prinobservaiediscretnuarfipututaflamarelucru,iceipecarei cunotea ct de ct bine erau prea puini pentru ai face o impresie corect de ansamblu. Singura soluie rmneau ntrebrile directe, dialogul. Se folosise de faptulcpurtavestagalbenaomuluidetiin.Chiardactiinasaserezuma lastropitulburuienilor,ncontextuldatputeafiuorluatdreptunnelegtorn loc, care fcea cine tie ce experiment. Aa c oamenii i rspunseser cu bunvoini,pectposibil,cusinceritate. 2 ani se chinui astfel, aproape n fiecare zi, asta bineneles n afara campaniilordestropire.Daclanceputcrezusecnumaiorevelaieiarfiputut descoperi mecanismele minii omeneti, n acel moment i se prea c desluise uneleasemnrivagi,uneletipuri.Fusesecumvaorevelaie? Dinal3leaanncepusinotezetoatediscuiileislegrupeze.intro zipecarenovauitaniciodat,ofemeieadugaselatrsturilepropriiidatade natere. Desigur,Hzgtanudduacestuifaptmareimportan,darlreinu.Era onoupist,careputeafoartebinessedovedeascgreit,sau,cupuinnoroc, dimpotriv. Deci, de atunci nainte, ceru i aceast informaie alturi de toate celelalte. Dea lungul cercetrii, i descoperise cu bucurie puterea de sintez, devenise contient c era n stare s ptrund esena lucrurilor, s nlture elementeleparazite.Ocalitatedecareacumeramndru. Gsinscurttimpolegturciudatntrecaracteristicileuneipersoanei data la care aceasta vzuse lumina zilei. Oamenii nscui n aceeai lun aveau trsturidebazasemntoare! Era ilogic, dar totodat era singurul fapt palpabil la care ajunsese. Continu discuiile, acordnd mai mult atenie fenomenului respectiv. Un an ntregseluptstragniteconcluziiferme,pentruc,deiinexplicabil,lucrurile sepotriveau. n al 5leaan se gndi cum iar putea face cunoscut descoperirea. Ar fi fost fr ndoial considerat nebun, pentru c oamenii lar fi condamnat de la nceput, fr s ncerce mcar s neleag. El nu era o personalitate tiinific recunoscut.Dacnvaiiregeluiarfiajunslaaceleaiconcluzii,arfifostsocotii geniali. l apuc o scrb imens, un sentiment fizic de saturaie. Opri totul i cu greusestpnisnuiardtoatecaieteledensemnri. nal6leaan,recitindule,simicobservaiilesaleerauadevrate.ncepu sviseze.Trebuiasspunlumii.ivoiasfieapreciat,ridicatnslvi.Nimeninu se mai gndise vreodat la acest mod de cunoatere a indivizilor. De ce oare
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nelegtoriinloc nu puseser cap la cap toate informaiile disparate pe care desigurleaveau? Apoi,dinpcate,ontlnisepeeviemi.Eraominciun.Fuseseopauz binevenit.Avusesenevoiedeovreme,casipunordinengnduri. Un rcnet furios l trezi din amintire. Trupul uria al pagzlui unei trsuri zvcnea nervos la 2 palme n stnga sa. Nici nui dduse seama ce se ntmplase. Nu simea fric, nu simea nimic. tia doar ci datoreaz viaa vizitiului,darnacelaitimperacontientcnuseputeasfifostomort. nacelmomentadresntrebarea: Ceestediferitncele10lunialeanului? iunrspunsveni: Ziuadrumulsoareluiestediferit,iarnoapteastelelesuntdiferite.


TrsurafugeactredomeniileregaleiHzgtarealiznsfrittristeea imens, copleitoare. Soarele lucea pe cerul senin, peste tot de jur mprejur era lumin.ninimasaeransntuneric. Celumenepstoare!gndielcumhnire. De attea ori nainte primise cu bucurie razele calde i strlucitoare. Dar acumacesteaipreaucrudeideprtate.Sesimeasingur.ipentrumomentnici nu dorea compania cuiva. Voia linite, ca si nfrng durerea. Privirea i se nceopentruoclip. Ajunse n sfrit lng lanul de ciuperci. Lucrtorii l ntmpinar cu o oarecare nedumerire, dar, observndui indispoziia, i vzu fiecare de treburile sale. Pnseara,hotrsubstanelenecesareattpentruplantelenormale,cti pentru cele care prezentau caracteristici distincte sau parazii. Urma prepararea soluiilorpropriuziseiapoistropireacmpului. ndimineaaultimeizileacampaniei,setreziisimiclarcntmplrile ceavuseserlocerauacumtrecut.Eraveselibinedispus. Se mbrc repede i se grbi spre laborator. Rolul su se terminase, cci substanele eraugata. Dar de fiecare dat lamuzas priveasctransportarea lor pecmpiapoimprtiereaasupraciupercilor. Ca de obicei, n sal era o hrmlaie asurzitoare. Cum planul de aciune era mereu acelai i toi l cunoteau, totul sar fi putut desfura n linite, dar bineneles fiecare lucrtor avea cte o problem important de rezolvat, care nu sufereaamnare.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hzgta i roti ochii peste mulime i l vzu n sfrit pe Sabatn, explicndcufoccevaunuiomulecareiajungeapnlapiept.Seapropiecuriosi ascultultimaparteaconversaiei.Piticulerafrndoialuntelekinetic,convins, nu se tie de ce, c i se fcea o mare nedreptate fiindc i se cerea s transporte o cantitatededouorimaimaredectceilalimuncitori.Faptulcaveaocapacitate psihic dubl nu prezenta o nsemntate deosebit. Sabatn nu ncerc ns sl convingprinargumentelogice,ciispuseclumeaoamenilorestenedreapt,c trebuie aadar s se sacrifice pentru semenii si i c zeii l vor rsplti pentru altruismuldecareddeadovad.Piticuliddudreptateoftnd,apoisendeprt, pregtindusesisuportecustoicismsupliciul. Hzgta i reprim cu greu un zmbet. Nu putea s nui recunoasc sentimentul de vie admiraie pentru omul cu plete albstrui. Acesta, siminduse probabilprivit,sentoarsebrusc.Observndul,formbucurieicomplicitate. Amajunslacaptidedataasta!ziseel,venindlngHzgta Mda,mormieful,urmrindagitaianconjurtoare. Aiaflatdevizit? Hzgtantoarsecapulmirat: Nu.Cevizit? Putea afla instantaneu, mrindui percepia, dar hotr s guste treptat ntreagaexplicaie. Trebuiestreacpelanoiastronomulregelui.EndrumspreNoi. Iauzi!Vaszic,uniimuncescialiiseplimb! Da, cam aa ceva, replic vesel Sabatn. Am neles c a expus n ConsiliulnelepilornutiucedescoperireiacumsentoarcelaObservator. Hzgtaplecprivirea. Toifacdescoperiri! Oclipnusegndilanimic,apoiispuse: Drumulsoarelui!Stelele!Desigur! ncercndsivoalezeentuziasmul,lntrebnepstor: i...opreteaici? Nu.Deundeiamaivenitiideeaasta?Cescauteellaniteciupercari?! Hzgtazmbifals: Desigur. Santmplatceva? Iarncepe. Nu.Auzi,continuelrepede,potsizicceva...opreresincer? Sabatnexprimatenie. Miseparecpoiintuiuorsentimenteleoamenilor,i... Seoprincurcat. Nuteaignditniciodatsfaciuntestdenelegtornloc? Ctdeevident!ierafric!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Decesstaitoatviaantrunloccasta?Cerupoatefidacncerci? Cellaltsurseincepuspriveascngol. Viseaz. Cred c ai dreptate, opti ntrun trziu. Am s m gndesc i am s ncerc... Secorectimediat: Credcamsncerc. Vociferrile se mai potoliser, semn c sarcinile fuseser n mare parte fixate.Urmncrcareabutoaielorncrueiprocesiuneapnnlan.Hzgta mersetotdrumulalturideSabatn,frsscoatnsniciuncuvnt.Persoana acestuia i ddea fiori de siguran: era singurul pe care l cunotea mai bine din mareadestrini. Observ drele fine lsate de crue pe pmntul uscat i i concentr atenia asupra mecanismului de ungere. De o parte i de alta a fiecrei tlpici se aflau 2 aprtori. n fa, printrun mic canal de scurgere, picura n permanen uleiul care, ajungnd sub suporturile curbe, reducea considerabil frecarea, evapornduse apoi imediat. Pagzl care trgea crua ndeplinea o simpl formalitate.Unommaivoinicarfipututfaceacelailucrucudestulsucces. Cineofidescoperitproprietileuleiuluiderah? Metodaaceastadetransportsefoloseadincelemaivechitimpuri. Existoarevreoaltmodalitate,lafeldebunsauchiarmaibun? Oroatdeciuliniserostogoleapurtatdevntndeprtare. Coloana,careacumsedeplasanlinite,aveaunaersolemn.Hzgtase simeadeparcarfindeplinitunritualmagicciudat.Defiecaredatsentmpla la fel. Poate era i un smbure de realitate n senzaia aceasta. Deja se putea zri ntindereacenuie,lafeldecenuiecahainelemuncitorilor.Continuausmearg mecanic, ca n trans. La 20 de pai n fa, reui s disting vesta violet a unui preotiplecpentruunmomentprivireanpmnt,curespect.Aceastcategorie reprezenta vrful ierarhiei jmalaane, datorit seleciei deosebit de stricte: un preot trebuia s aib cel puin 2 daruri distincte, dintre care unul citirea gndurilor,pentruareceptamesajeledivine.ntoatviaa,nucunoscusepersonal niciunomcuaceastnsuire. Oarecumesisetiecelemaiintimesecrete? Ajunserlamargineacmpului.Seopririuniincepursvorbeascn oapt.Hzgtaapreciecerauacolonjurde500deoameni.Preotulieinfa i ntinse braele asupra mulimii. Toi nclinar capetele mormind mulumirea pentrubinecuvntare: Precumminiletaleacumiaici,lafelndrumareazeilornaltetimpurii locuri! Celvioletspuse:
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sunt Cobortorul Sorii, Braul mie trecutul, Mintea mie prezentul, Judecatamieviitorul. MrireTrimitorilor! Smulumimcacestmomentexistiatuncicndsuntemdezndjduii s ne nchipuim culmea dezndejdii, pe care din fericire nu a trebuit so urcm. Aceasta este ultima lucrare: anul sa sfrit. Privii recolta care va veni i fii mndri.Viaaoamenilordepindeidevoi. Apoipreotullsbraelenjosireveninmulime.Cuvntarearostitera ceamailungpecareoauzisevreodatHzgta,nasemeneamprejurri. n continuare, dup o mic pauz, butoaiele din crue ncepur s se ridice rnd pe rnd n aer, sub aciunea gndurilor telekineticilor. Recipientele aveau la baz cte un mic robinet, ce permitea substanelor s curg direct la rdcinafiecreiciuperci. Dup 4 ore se puteau vedea, adnc n lan, butoaie dansnd pe deasupra plriilorcenuii,caniteuriaeinsectestrlucitoare. Hzgta rmsese mult n urm, abia la 20 de pai de marginea cmpului, privind absent aciunea. Sabatn oscilase ntre a urmri de aproape reprezentaiaomuleiloriaiineluideurt.nfinal,nualesesenimic,aacse aflalamijloculdistaneidintreceledouposibileopiuni. Ce plictiseal! i zise Hzgta. Mcar dac a fi putut vorbi cu astronomullanenorocit,poatearetotuloexplicaietiinific... Auzinduntropitdinspredrum,sentoarseivzuotrsurapropiindu sengoan.Eraprobabilastronomul.Arfivrutstiecedescoperirefcuse. Iatcumtrecemunulpelngaltul,frcadrumurilesnisentretaie. Trsuratrecuprindreptullui. Casoareleistelele.Cumarmergeoaresoareleprintrestele? Trsuraseopri. Privincontinuaregnditor,pnsneleag.Apoinuiveniscread.O usedeschiseiunomcobor.Aveavestadeungalbendeschis,strlucitor,carei certifica rangul important. Fcur amndoi cte un pas unul spre cellalt iar Hzgtaselovideociuperc.Ciocnirealtrezi. Gsinduse cel mai aproape de drum, era normal ca el s fie cel care sl ntmpinepeoaspete.Dinacestpunctdevederenueranicioproblem. Cnd ajunse n faa astronomului, se simi pentru o clip intimidat, dei aveapercepiatemporaldeschis.Puteafi,era,urmasfieocotiturnviaasa. ipotfidefoloscuceva? Astronomulpruncurcat. Amsimitungnddespresoareistele. Cellaltzmbiiprucschieazoexpresiederecunotin. Amsimitungnddespresoareistele. Hzgtaexpirunamestecdeuuraredublatdetensiune.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Euamfost.imulumesccaioprit.imulumesccetitelepat. Astronomulizbucninrs,topindgheaadintreei. Eusuntultimulcruiaartrebuisimulumetipentruasta! Edrept. Zmbiiel. iceteaatraslagndulmeu? Eoimagineinteresant.Eoteoriefrumoas,nucrezi? Nutiucescred. Acumvaspune. A...aivreasviicumine?LaNoi?Aivreastiidecemergesoarele printrestele? Asta nsemna renunarea la tot ce reprezentase pn acum modul lui de via. O ruptur. i auzea vuietul sacadat al sngelui n timpane. Ca n trans, vorbi: Accept. Numaitiaceface. Astronomullprinsedeumr,sprijinindulimbrbtndul.lconduse pnlatrsur.naintespeascnuntru,ntoarsecapulsprecmpulcenuiu, pecarelsimeaacumattdeapropiat,attdeprieten. La 40 de pai l vedea pe Sabatn, privindul aparent impasibil. Dar Hzgtaiauzeaparcrespiraiatremurtoareiprereaderu. lntrebpeastronom: Cegndeteomulacela?Celcuprulalbastru? Nu tie ce se ntmpl de fapt, dar bnuiete c e ceva important n destinultu.Sebucurpentrutine,chiardacregretcveipleca. Dardeundetiecvoipleca? Eunnelegtornloc,frniciondoial. Da.Aae.Aatrebuiesfie. Spersfiefericit,optiapoi. ntreaga natur era nemicat. Simi o presiune intens la baza gtului i fcupasulnainte.Douurmefierbiniibrzdarchipul. Cellalturc,seaeznfaaluiifcusemnvizitiuluisporneasc. Mult timp merser n tcere, iar Hzgta se liniti treptattreptat. Gndurileirevenirnminte. Nicimcarnumiamluatbanii,iziseelcassemainveseleasc. Niciogrij,spuseastronomul. Cesifaci,nusunttoinelegtorinloc! Ah,izbucni,sprecnuteamjignit! Numaijignit,rsecellalt.ioricum,cndetitelepat,trebuiesnvei saccepiadevrul.nmintealor,oameniinusuntdelocplinidetact. Etiprimulcuacestdarpecarelamcunoscutnviaaasta.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Atunci sper s nui faci o impresie prea proast despre mine i despre cititoriidegnduri. Hm.Ceszic?ieusper.Edoarninteresulmeu,nu? Astronomultcusurznd.Hzgtacontinu: Darsuntcurioscumsevedeomuldininterior?! Directnmiezulproblemei.Dacaiputeavedeactdediferitefaadade sufletulunorpersoane,probabilaifiocat.Esteocutotulaltdimensiune.Uite,de exemplu,dacnchiziunochi,veziuncerc.Dacldeschizi,veziosfer. Oaredacaimaiaveaunochi,aivedeamaimultdectosfer? ntrebarermasfrrspuns. E adevrat c de multe ori oamenii renun la folosirea darurilor individualenfavoareasimurilorcomune? CellalttresriiiridicprivireanochiiluiHzgta. Da.Altfelcoeziuneasocialarfislbit. Dardece?Complementaritateanuajut? Punnduseaccentpediferene,nutepoiateptalaunire. Suntemasemntoriprindiferene. Astronomultcu. Acummicitetigndurile? Nu. Dinbunvoinpentrumine? iatunci,cusoareleistelele...? A!Mplictiseami... Deobiceinuifoloseticapacitiletelepatice? Cellaltsefoipebanchet,prndcseaflnncurctur. Deobicei...nutiu...Depinde.Depindecucinestaudevorb.Depindede situaie. Da.neleg. Numinea.incazulluieralafel. Toatedepinddetoate. Astronomulformaprobare. Hzgtaiaminti deSabatn.Nu se despriser nici de o or ideja simeaziduldenetrecutcesenlantreei. Aiputeafipreot,nu?ntrebel,netiindcumdeiveniseaaoidee. Dece?Nuamdectunsingurdar. Hzgtancercssescuze: Dar m gndeam c ar trebui s fii i nelegtornloc, odat ce poi vedeansufleteleoamenilor... Cellaltizbucninrs:

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nici pomeneal! Eu pot doar afla gndurile nivelul contient al cuiva. Nu percep nici senzaiile, nici sentimentele. Ca s neleg aciunile unui om, ar trebuicaelnsuisileneleag.Sseneleag. AtuncicumaighicitdespreSabatn? Omulcupralbastru. i spusese intenionat pe nume, pentru ca sl foreze pe astronom si citeascmintea,ncutareauneiexplicaii,pecareiooferisecumrinimie. Fiecaredaripuneamprentaasupracontiinei. Nu se artase mirat, deci fcuse aa cum se ateptase Hzgta. Aceast curs nevinovat reuit i aduse bun dispoziie, cci interlocutorul l ascultase. Era destul si deschid percepia temporal pentru ca toi oamenii, inclusiv el nsui,sdevinprevizibili.Previzibilinsfrocauzevident.Acumelfusese cauza,provocatorul,deincnumaiounealtadestinului. Dinpcate,suntattdepuiniceicesenelegcomplet!iculmea,ceilali inchipuiecaceastcunoaterealor,superficial,estesuficient,sau,mairu, nici nui pun problema. i apoi, cnd se ntlnesc cu ei nii, alearg pe la nelegtorinloc! Hzgtazmbimelancolic: Etrist. Se ls linitea. Pe geamul trsurii se vedea n continuare cmpia prnd cserotete,datoritperspectivei. Trecemprincapital? Da.Dece? Hm. Trebuie si spun ceva... Am studiat i eu oamenii, dac se poate numistudiuceamfcuteu.Iamntrebatdesprepropriiletrsturidecaracter.i amajunslaoconcluzieciudat.Acasnzgamnitecaiete. ivenioidee. Avreastrecemslelum,dacsepoate. Sepoate,exprimcellalt. i am s i le dau ie s le citeti, ca s vedem dac ajungi la aceeai concluziicamine.Darsnumicitetigndurile! Bine,ziseveselastronomul. Probabilisepreaunjocinteresant. Ctevaminutesescursernetulburate.Seapropiaudeora.Hzgtai dduseamacdefaptnutiacucinevorbete. Sfacemcunotin!spuseel. Interlocutorul,fiindmainvrsticurangsuperior,ntrebprimul: Cineetiicineafostnainteata? Suntfiulluihzgt.imarcameapersonalesteA. EumnumescAgatadn.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Formarapoibucurie,respect,speranidorindecolaborare.Hzgta iaminticpnla10aninureuisecuniciunchipsexecutecorectsuccesiunea de expresii faciale. Pn la urm trebuise s nvee. Dei acum mplinise ritualul ireproabil,imairmsesetotuioumbrderepulsiepentruacestobicei. Narfioricummainormalcaoameniisispunsimplunumeleigata? Cutoateastea,ntroziosfiubtrninenorocitiattaconsolareosmaiam: spunntrebareaidentitii. Intrarncapital. Ajunsernfaacaseilui. Hzgtacobordintrsur,ilucaieteleisentoarse.iplngeainima, darminteaispuneascontinue. Plecar.


Noi eraunorel ridicat dea dreptul pe un munte, aproape de centrul regiunii.Cutoateastea,eraunadintrecelemaiimportanteaezritiinificedepe planet, sediul Universitii din Herad i al Observatorului Astronomic. ntreaga elit a oamenilor de tiin din regiune avea legturi mai mult sau mai puin strnsecuacestora. HzgtanunvaselaUniversitate.Meseriadestropitornupresupunea cunotine deosebite, totui cel ce o practica nu putea fi considerat un simplu muncitor. Acum, dac i sar fi permis s studieze aici, ar fi trebuit si aleag o disciplinnou.Ceamainimeritisepreaastronomia. Cnd sosir era deja ntuneric. Drumul i se pruse pe ct de frumos (uneori chiar periculos), pe att de epuizant. La aceasta contribuise probabil i aerulmairarefiatdatorataltitudiniimari,dartiacprincipalacauzfusesevalul copleitor de noutate care i sfrmase echilibrul. i trebuia un timp ca s accepte evenimentele. Cndcoborrdintrsur,funtmpinatimediatdeaerulrecedemunte, cuunmirosciudatdepiatr,derocdur.nlprivireaifuuimitdeclaritatea cucaresevedeaustelele. Agatadnlntrebaparentnepstor: iplace? Nutiucumsispun.Parcepustiu.Nuvdniciunompestrzi.Sau culcatcutoii? Astronomulrspunsevesel:

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Dar la ce te ateptai? S piard nopile degeaba? Programul de studii i relaxareafostconceputcasdeaeficienmaxim.Armasneschimbatde200de ani. Hzgtaformsurpriziadmiraie.Apoizise: Parc m aflu deja n alt lume. Prin capital nu se vorbete prea mult despreUniversitate. Chiarteaflinaltlume.isnutemiridaclegilesuntaltele. Hzgtamiminvoluntarobosealispuse: Namsmmir. Intrarntrocldirefrniciunsemndistinctiv.Agatadnolunaintei ncepusdiscutenoaptcuunomcaresttealaomsuimnca.Dupcteva momente, el form nelegere i respect, se uit ntrun caiet ii comunic ceva astronomului.AcestaifcusemnluiHzgtasseapropie,apoiivorbi: Ai camera 1747. Vezi s ii bine minte numrul sta. Dac intri din greealnaltcamer,veifidesigurgonitdinora. Agatadn se ndrept spre nite scri i el l urm. Urcar la primul etaj, apoi merser pe un coridor cu ui de o parte i de alta, att de aproape una de cealaltnctsentrebcumarputeaartaicamerelepropriuzise. Se oprir n faa unei ui ce purta inscripionat cu litere infraroii de muchinumrul1747. Aicie,optiastronomul.Nufidezamgit,cerculnicinanceput! Hzgtanuzisenimic,deschiseiintr.Dinurm,auziglasul: Numiaidatcaietele! Abia acum i aduse aminte de ele, dei le inuse tot timpul sub bra. Se ntoarseiilenmn.Agatadnzmbi,mimndncurajareiapoiplec. Dup ce intr i nchise ua, Hzgta simi cum enervarea crescnd i topetemoleealadecarefusesecuprins.Cameraeralatde3paiilungde5,cu unpatsimpluiomsu.Dduunutnea,apoinelesecnuputeafacenimic altceva,aaciscoasehaineleiseculc.Patuleratarecapiatra,totuiatmosfera eraprotectoare,purificatoare.Nerviilprsirimediatiaccepttotul. Maivedemnoimine. Adormi. A doua zi fu trezit de un sunet insistent de fluier. Se simea bine. Se mbrciieidincamer.Aliifceaulafel.Eradezorientatcomplet,dariurmri peceilaliisedescurc.Dupceifcutoaleta(iobservimportananumerelor deordine),mersesmnnce.nsuireadeparteaturmeinuifceanicioplcere, dar ce rost ar fi avut s se arate el mai cu mo? Fiecare mas era ptrat, fiecare latur avnd un numr nscris pe margine. i gsi destul de repede locul i se aez.Maivenir3iseaezariei.Dupctevamomentedetceredeplin,n care se ferir s se priveasc n ochi, acetia ncepur s uoteasc, excluzndul
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


pe Hzgta. Deschizndui percepia temporal, afl cum i cheam, dar din pcatemaiaveadendeplinitformalitatea.Eltrebuiasfacprimulpas. Cearfismapucsmadresezfiecruiadirectpenume?Hm.Arfio impolitee. Suntnouaici.Snecunoatem! Celdinmijloc,probabilcelmaiimportant,sechinuifacomutragreabil izise: Cineetiicineafostnainteata? Suntfiulluihzgt.imarcameapersonalesteA. Apoiispuserieinumele.Nustudianiciunulastronomia. Cndterminarmasa,Hzgtantreb: Euundetrebuiesmerg? Omijiorirspunse: Uite,lvezipela? Artcumnaspreuntnrdelamasaalturat. Etotlaastronomie.Dutecuel! Mda.Aaamsfac. Atept ca acesta s se ridice i l urmri pn cnd ieir din sal. Apoi grbipasulilajunse. Amauzitcetilaastronomie,nu?lntrebzmbind. Da,aiauzitbine. Preavesel. ProbabilaiauzitdelaOmijior. Hzgtaaprob. Eaitiepetoi Tcuoclip. Nuteammaivzut.Etivenitdepuintimp,nu? Ieri. A!fcuelmimndrespect. Hzgtaizbucninrs,urmatimediatdecellalt. Haisnumaipierdemtimpul:miemispuneAnbzf. MieHzgta. nsfritvdieupeunulcarenusecomplic. Tucedarai? Nutiu.Numcomplic. Deiarfipututanticipaacestrspuns,nuofcuseiacumfuseseprinspe piciorgreit: itu? DecilaicunoscutpeAgatadn. Da.Deundetii?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


NumainoidoisuntemtelepaintotNoiul.Ecelmaideteptprofesori edetreab.Euunulmnelegbinecudnsul.Defapt,nunumaieu.Toi. SpersfiuieuprintretiaiziseHzgtaisurse. n clipa aceea o vzu venind din sens opus. Continu s zmbeasc dar sufletul i tresri. Ceea ce observ n primul rnd la ea era faa faa care iradia frumusee.Faaipleteleportocalii.ieazmbea.Seuitarunulnochiiceluilalt, aproape ca hipnotizai. Ochii i zmbetul erau totul. Trecur unul pe lng altul. Hzgta nu ntoarse capul, nu schi nici un gest. Continu discuia ca i cum nimicnusarfintmplat.Darfericireaiclocoteaninim. Tot mergnd observ c se ndreptau spre marginea orelului. ObservatorulAstronomicpropriuziseraoricumaltundeva.Deodat,Anbzfi fcusemnsintredupelntrocldirecu2etajecare,bineneles,nuaveaniciea absolutniciunnscrisdistinctiv. tiiceaidefcut?ntrebcellaltcasseaflentreab. Hzgta nu consider necesar s rspund. Anbzf i art o u galbeniizise: Acolo e Agatadn. Dute i vezi ce o si spun el. Eu te atept n bibliotecSusla1. Mda.Bine. Se duse spreu.Profesoruli citise caietele. Darcenaiba se ntmplase? Sun din clopoel contrariat. Imediat panoul galben culis i Agatadn l invit nuntru.nncpereeraunumaiomsuacoperitdehrtiiidulapuricucri. Staijos,isespuse. Seaeznpoziiadediscuie,urmatdeprofesor.Acestascoasecaietelede sub foile mprtiate i i le ntinse. Hzgta constat cu uimire c minile astronomului tremurau uor. Le lu i se uit la ele, de parc ar fi fost nite documentenoi,necunoscute. Uitelacemamomortatiaani! Cecrezi?lntrebpeAgatadn. Ferinduseslpriveascnochi,acestazise: Amconstatatcapreciezisinceritatea. Mimaprobare,fierbnddedurereineputin. Nam putut trage nici o concluzie. Nu neleg ce ai extras tu din aceste relatri.Saucumaifcuto. Hzgtadeschiselantmplareuncaietiiaruncochiipedialogulcu unbrbatnscutnlunaLuminii. Cesextrag?!Dareevident.Sociabilitate.Entuziasm.Puinnehotrre. 3dintrunfoc.Aasunttoi. Iartm,vorbiprofesorul.Mienumisaprutdelocevident. Nuigseacuvintele.Niciunuldintreeinuigseacuvintele.Agatadn formncurajare.Eraofigurcareireueademinune.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cesituaiepenibil!gndiHzgta iveneasintrenpmntderuine. Citinduimintea,vdctucrezintradevrndescoperireata. Da.Cred.icefolos,dacsuntsinguruldinlume? Nu.Staipuin.Amprocedatdelanceputgreit.Maibinemiaiexplicatu totul.Separecnustaubinecudeduciile. Acum? Hm. Nu poi smi scrii concluziile i s mi le dai mine, mpreun cu caietele? Decenu? Oricumsarputeasnaibrost. i ar mai fi ceva. Dac tot suntem n Noi, nai vrea s urmezi astronomia?ndefinitiv,gnduriletaleeraudespresoareistele.inuiarstrica ctevadungipevest.Saupoatechiaroveststrlucitoare,cndva.Astadacnu teaihotrtsmoriprintreciuperci. Hzgta nu replic imediat. Dei spusele profesorului aveau un fond binevoitor, forma n care fuseser exprimate nu era cea mai fericit. n alte circumstane,iveninddelaaltepersoane,learficonsideratchiarjignitoare. Suntdeacord.Cetrebuiesfac? Dutelabibliotec,laetajul1 tiu. incepescitetiprimacartealuiNatapda.iiminte? in. Cenunelegi,noteziimntrebi.Astaeprocedura.Mgsetiaicidela ora2la4.Dupceterminicartea,veidauntestiveiprimiodungpevest. Hzgtazmbi.Nueradelocceseateptase.Dar,ladreptvorbind,lace seateptase? Urclabibliotec.lntmpinunomulenvestcenuie,carelntreb plictisitcedorete. PrimacartealuiNatapda. Urmeazm. Dupcivapai,Hzgtasetrezinfaauneisliuriae,curnduride dulapuripoziionateimpecabil,attdinpunctdevedereestetic,ctifuncional. Omuleul se ndrept spre primul ir. O carte zbur dintrun raft i i se aez supusnmn.ApoisentoarselngHzgta,iodduiiartoulateral albdeabiaobservabil. Intrastfelntroaltncpere,maimic,cubncilungidelemndispuse aproape dintrun perete n cel opus. Din loc n loc, desigur, era notat cte un numr. Doar jumtate din poziii erau ocupate de studeni aezai pe podea, cu nitecriicaietenfa.Preauabsorbiicomplet.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cutcuinimastrns1747.Erachiarnmargineiarntreeliceilaliera unlocliber.Darnuifcuproblemedinaceastcauz.Sentrebdacslcaute cuprivireapeAnbzf,darrenun,pentrucnarfifostungestpreaelegant. Se aez n poziia de concentrare, trnti caietele pe banc i deschise cartea. Citi prima pagin, apoi ncepu s rd spasmodic, lsndui capul pe lemnulrece.TocmaiaflasecJmalaaseroteanjurulSoarelui,mpreuncualte 7planete. El tiuse dintotdeauna cSoarelese nvrte n jurul Jmalaei, ct despre alteplanete Ceciudatidurerosesdescopericlucrurincareaicrezuttoatviaa suntdoarminciuni.Numinciuni,cineadevruri.Sieitotuldelanceput! DrumulSoareluiprintrestele!Zeilor!Amintuit! Aadar,Jmalaaeradoarunbolovanrotitor,lafelcaalte7.idecenarfi fostndefinitivi777?!Cuojumtatedeornurmplanetaluieraunic.Cemai era acum? Trebuia s nvee s triasc pe o lume inferioar, czut odat cu locuitoriiei.Trebuiasrealizezecnicielnueraunic,caltemilioanetriauinu sedeosebeaunfondcunimicdeel,lafelcumiJmalaatrebuiassenvrtla nesfrit,frrost,printrecelelalteplanete. Aveanevoiedepuinvremecasistemulsusasimilezenoileconceptei siformezeonouperspectiv. Deschisecaietele.SegndisifacoschemluiAgatadn,cutrsturile fiecreiluni.Secutprinbuzunareidescopericnaveanimicdescris.Nutia nicideundeiarputealua.ntoarsecapulsprestnga.Untnrmbrcatnvest alb citea ct se poate de concentrat, notnd unele lucruri din cnd n cnd. Uitndusedejurmprejurobservcmajoritateaeraumbrcainalbculoarea discipolilor. i aminti cu oarecare nostalgie de perioada cnd o purtase i el. Se for s revin n realitate. Cel din stnga continua s citeasc i s scrie ca un disperat.Fatadinfapreamairelaxat.Seridiciseapropiedeeanlateral. Avreastentrebceva. Aceastalprivicapeoinsect,frszicnimic. Deundepotcumpraunrezervor? Fatavorbicuundispretotal: Dinora. Hzgtaopriviiel,formnemulumireisegndidacsispunceva legatdeaspectulfizicsausolasenaibii. Cinetiecedaromaifiavndinenorocitaasta! Aa c alese a doua variant. i lu caietele de pe mas, iei din sal, cobor scrile i ajunse n strad. ntreb din nou i i se explic. Trebuia s traverseze iar jumtate din Noi. Prima surpriz fu cnd afl c nu trebuie s plteascnimic.Adouaoavupedrum,cndsentorcealabibliotec.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Mergeafrssegndeasclacevanmodspecial,uitnduselacldirile anoste i lipsite de semne distinctive. Deodat, ochii i fur atrai aproape involuntardepleteleportocaliiidechipulceiradiafrumusee.ntoarsecapuln altparte,ncercndssecomportectmainaturalictmaidegajat,odatcese simea privit. Voia s fac o impresie bun. i compuse o min agreabil, uor detaat, dei sufletul i tremura. Ea venea pe partea opus a strzii. Ca din ntmplare,seuitnaceadirecie.nacelmoment,ochiilisentlniriari,apoi trecurunulpelngcellalt. n sala de studiu nimic nu prea schimbat. Pn i prima carte a lui Natapdaeranemicatpebanc,aacumolsase.Seaez,executunexerciiu derespiraiecasseliniteascincepuschemapentruprofesor. Dup 2 ore sun un clopoel i studenii se ridicar rnd pe rnd, ndreptndusespreieire. Maistai?auziunglasiHzgtaticeraAnbzf. Seadundepejos,strnsecaieteleisedusespreel. Decenulaicaieteleaici?Oricumnentoarcemnjumtatedeor. Fie. Sentoarsedindrumiledepusepebancadelemn. Odatajuninstrad,Anbzfvorbi: iefoame?Vreismncmceva? Nu. Ceicutine?Nupercepniciungnddealtu. Nugndescnimic. Cellaltddudincapiseuitaiurea. Mergeauntcere,HzgtaurmndulmecanicpeAnbzf.Acesta,n loc si respecte meditaia, din plictiseal ncepu s povesteasc ceva stupid i neinteresant iar Hzgta forma din cnd n cnd, din politee, aprobare i invitaiedeacontinua. Soareleurcasprezenitiargraduldeiluminarecrescusepuin;trecuseun sfertdeor. Nu trebuie s ne ntoarcem? gndi Hzgta, iar cellalt se grbi s schimbesensuldemicare. Strada era aproape plin de nvcei, plimbnduse singuri, perechi sau, mairar,ngrupuri.Uneorimaitreceaicteunprofesor,mndrindusecuvesta trivrstatsaustrlucitoare.ila10paidistanmergeaea.ieraimposibilso confunde.Frndoial,trecusepelngel,inovzuse.Anbzftotvorbea.Ea seoprisdiscutecuunprofesor.Eiseapropiarla4pai.Eaterminisentoarse cufaaspreHzgta.Inimaisestrnse.ideschisepercepiatemporaliapoi rmase n expectativ, contemplndui nfrngerea. Fata i rnji unui biat necunoscut,dindreaptaluiAnbzf.Niciungndcontientnuiaprunminte,
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


aa nct cellalt nu simi nimic. Dac Sabatn ar fi fost acolo, ar fi spus Sa ntmplatceva? Nu,nimic,decentrebi?ziseAnbzf. Hzgtanurspunse,zmbindcuamrciune. Deatunciontlnidemaimulteori,oprivi,maisiminc,darfrfolos, ccifarmeculdispruse. Labiblioteclucrtimpde2ore,reuindstermineschemageneral.Din nouseauziclinchetuldeclopoeliceilaliseridicar,uniilundcueicrilesau carnetele. Hzgta lu doar notiele scrise n acea zi, cu gnd s i le dea lui Agatadn. Anbzf se ivi i el. Probabil i fcea plcere rolul de ghid n lumea universitar. Dup prnz, se apuc si arate funciile diferitelor cldiri din Noi i Hzgta afl astfel sediile bibliotecilor de geometrie, fizic, chimie i multe altele. Era chiar curios s citeasc ultimele lucrri de chimie, deoarece cunotinelesaleotiaeraulimitate,pninacestdomeniu.Daracumavea tot timpul s nvee. O alt ramur care merita toat atenia era nsi tiina darurilor! Pentru un moment, regret c alesese astronomia, cnd existau attea lucruri maiinteresante, dari ddea seama c trebuia s termine ce ncepuse, c trebuiasiexpliceconcluziile. Nicinurealizasecerepedetrecusetimpul:sefcusedejaora10. Ei,deacumhaisnedistrm!iziseAnbzfildusentrocldirecu etaj,aproapencentruloraului. ncdelaintrareobservatmosferadestins,zgomotelediverse,rsetelei ipetele,ncontrastcuausteritateadeafar. Ceaivreasjoci? Nutiu.Ceaputeasjoc? Fzip,ncurteadinspate,gimnastic,aicilaparter,peuadindreaptai jocurilogicelaetaj. Vdcsunteidotai,nuglum!Credcamergesus. Nu prea avea chef de efort fizic. Urcar i Hzgta i alese din cele 15 varianteunacaresenumeaMbof.Eradefaptomasdreptunghiular,cumargini nlate. n latura stng erau 10 resorturi, care mpingeau fiecare cte o bil, la momente aleatoare. Acestea se ciocneau de marginea opus, se ntorceau, se ciocneau din nou i tot aa. Pe mijlocul laturii dinspre juctor exista un resort mobil,careseputeadeplasaladreaptasaulastnga.Juctorulialegeaopoziie convenabil i, dup trecerea prin faa ei a unei bile laterale, avea voie s mpingnterenbilasa.Aceastaputeasciocneasclarnduleimarginilemeseii celelalte bile, apoi, cnd se ntorcea spre latura dinspre juctor, era msurat distanadelalocullansriilaloculsosirii.Cucteaeramaimic,cuattrezultatul eramaibun.Idealarfifostcabilasnuciocneascdectmargineaopusisse ntoarcnacelailoc.Darastanusentmplapreades.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Lui Hzgta i se ntmpl de 3 ori. Juc pn se ntunec i trebuir s mearglaculcare. A doua zi diminea urm iari ritualul necesar i apoi se ndrept spre bibliotec.Trecupelaprofesor,darnimeninudeschiselasunetuldeclopoel.Ori era ocupat, ori era n alt parte. Aa c urc la primul etaj. i ocup locul i constatcnimicnufuseseschimbat:totuleralafelcanziuaprecedent.Doarel numaieraacelai.Reuisesaccepteinformaiile.Eragatasconstruiascpenoua baz.Sepregteasdeschidcartea,cnddeodatcinevaseaezlngel,la1750. ntoarsecurioscapul.Eraofatcuvestgalben,cuodungstrlucitoare. avea ochi verzi i plete roiatice, dar nu asta conta, ci faptul c i zmbea cu simpatie. Hzgta era ct pe ce so ntrebe cum o cheam, dar se opri la timp, contientcarfijignito.Aacatept.Easpuse: Cineetiicineafostnainteata? Suntfiulluihzgt.imarcameapersonalesteA. Ochiieirdeau. EumnumescLooure. Hzgtasecutremur. Zeilor!Avemacelainume!4


ntrozi,zeiifcurunrudeapvie,carensntoeapeoricinenotade alungulsu.Darcursulacestuiaeraunulnemaivzut:aveaintervalelargiiline, presratedinlocnloccudefileuristrmtencareapasenvolburaslbatic. Oamenii venir plini de speran i ncredere, vznd captul de nceput domol i ntins ca un cerc de cristal. De cum intrau n ap, rnile preau s li se vindece,iardurerilesnceteze.Dartiaucpentruvindecareadeplintrebuiaus ajunglacaptulcellalt. Purtai uor de curent, oamenii notau liberi i fericii, la dreapta sau la stnga,apropiindusesaudeprtndusedemaluri. Dar de la un timp observar c viteza apei cretea, iar n deprtare se vedeaustnciascuite.Rulsengustacufiecareclip,ilaunmomentdat,cnd limeasaabiadepeapatrupai,drumulsedesprindou. Ceicaretrecurprindreaptavzurcuuimirecunelernilisenchiser pentru totdeauna i unele boli se stinser pe negndite, iar cei care trecur prin stngafurloviidestnciicptarrniproaspete.
4Alfabetulheradianeraformatdin17perechidelitereconcrete:(E,A),(I,),(O,),(U,),(,G),(J,F), (,Z), (L,H), (M,P), (V,B), (,N), (R,T), (,C), (,D), (,S). Prima liter din pereche era feminin iar a douamasculin.Eleerauechivalenteiputeaufisubstituiteunaalteia.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ndefileulurmtor,uniioamenineleserinotarprindreapta,iaralii, luaidecurent,ivtmartrupurilencuiteledepiatr. Cndajunsernsfritlacapt,uniimulumirzeilorcsntatealucea nei,iaraliisetrrafarblestemnd.Darprivindnzare,vzurapalucindca uncercdecristal.


Fuseseprinsdinnoupepiciorgreit.Defapt,surprinsarfifostoricum,ce diferen ar fi reprezentat cteva minute? Looure prea si fi pstrat calmul. Astansnunsemnamarelucru,dacerasiaminteascspuseleluiAgatadn. Tradiia spunea c 2 persoane cu acelai nume brbat i femeie erau sortiteunaalteia,imaimultdectatt,numaiogreealgravdinparteaunuia dineiarfimpiedicatmntuireaamndorura.Probabilcnurmcu200deaniar fifostobligaisiscoatnsemneleverzi,daracumnusemaipuneamareprepe obiceiurideacestfel.Seputeaconsideraclecrescuseastfelgraduldelibertate? Fatancepusformezeexpresiilesuccesivealeaflriiidentitii.Hzgta, din cauza emoiei, nu reui de prima oar i strnse din dini, furios pe propria lipsdecontrol,dareaatept,frnicioreacie. Cestudiezi? Cestudiez?Oamenii!idinntmplareastronomia. PrimacartealuiNatapda. Atuncietilanceput.Totuiaivestgalben. Da.Defaptsunt ciupercar stropitordeciuperci.Daracumnvastronomie. Aha. E destul de interesant. i eu sunt tot la nceput. Cercetez tiina darurilor. Hzgtadevenicurios. icelegturestentredaruriiastronomie? AiobservatctoioameniicunoscoricndpoziiaSoareluipecerideci timpul?Vreausvddacexistoexplicaietiinific. Aceast nsuire era ceva att de evident nct nui pusese niciodat problema. Dar era i aceasta ntradevr o ntrebare i cineva trebuia s gseasc rspunsul. Se ls linite. Looure privi caietele aezate n dreapta lui, aproape de extremitatea bncii, dar nu exprim nimic. Hzgta nu ti dac s deschid chiareldiscuiadespreele,aacprefersnofac.LucartealuiNatapdaise apucdecitit,urmatimediatdefat.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ntradevr,eradestuldeinteresant.Astapnajunselanitedemonstraii ciudate,cefoloseauprincipiidecarenuauzisenviaalui.Reinuacestelucrurii se duse sl caute pe Agatadn, dar nul gsi. Se plictisi, i duse nsemnrile n camerihotrsseplimbeprinmprejurimi.Nuieibinepeporileoraului,c Anbzf se i ivi, dornic si arate peisajul. Se nser mai repede dect sar fi ateptat.Obositinciudatcmaipierduseozidepoman,sentoarsencameri adormi. Viscseaflantrocasuria,cunenumratecamere.Prinpreajmmai erau cteva persoane. i ddu seama c venise n vizit, ns nu tia cine era gazda.Untimpnusepetrecunimicneobinuit,apoiiaminticaveaasupralui uncarnetceidovedeacalificareadeomdetiin.Pentrumaimultsiguran,l scoasedinbuzunaripipinvelitoareadinmtaseviolet,apoildeschise.Inimai sestrnsecndvzucpeprimapagineranscrisunaltnume,iardataeradin urmcu12ani.ncepuscautedisperatprincas,trecnddintrocamernalta, pe lng grupuri mici de invitai, care discutau n linite, fr sl ia n seam. Deodat, observ pe cineva scond un carnet cu nvelitoare violet, i apoi disprnddupuncol.Gazdalntrebcesentmplase,elipovestiipornir duppersoanavzut.Merserctvatimp,frsrealizezenimic,dupcareeli dduseamacnunvelitoareafuseseschimbat.Seopri,uitndusedinnounjur. Auzi unele zgomote ciudate n deprtare i urc pe o scar din dreapta lui. Treptele cotir i el deveni contient c va ajunge pe acoperi. n stnga sa descoperiunstlpdecorativdelemn,pecarelsmulse,gndindusecsarputea sifienecesar.Supeacoperi,seapropidemargineiprivindnjosobservpe cineva schimbnd nvelitorile la dou carnete. ti c unul era al lui i vru s se ntoarc pe scri, s coboare, dar nu le mai gsi. Porni pe un culoar strmt, care preasinguracale.Deodatdrumulischimbdirecianunghidreptielsegsi din nou pe margine. ntoarse capul i vzu pe cineva innd carnetul su. Se apropi, vrnd si deslueasc chipul. Era o persoan cunoscut, cu faa schimonositdeurancaresetransformaseiubirea.Aceastasriasupralui,else pregtisloveasccubta,nsavuomicezitare.Czungol,mpins.Setrezi, siminduipicioarelengheate.Sttuunmoment,sseliniteasc,daradormidin nou.Seaflanacelailoc,naceleaicircumstane.Czudinnou,dariamintic acestlucrunuestebun.Sedetept,tiindcdefaptfusesempinsaproapefrs fieatins,aproapedelasine. Adouazidiminea,lucaieteleiseduselaAgatadn.Fuprimitimediat iinvitatsseaeze.Astronomulpreantrodispoziiedezilemari.Glumicuel, njur starea de lucruri cci regele nu se arta prea mulumit de randamentul cercettorilor din Noi i apoi se interes de soarta pregtirii lui Hzgta. Acestaizise,iarAgatadniexplicdecetrebuiasiasciteascatreiacartealui Vilerue.Seartdeadreptulentuziasmatdeschematipurilordepersonalitatei lasigurcosoanalizezecuceamaimareatenie.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hzgtaieidincamercutotuluimitdetransformareaprofesorului.n acelaitimp,aveaoarecumimpresiacvervaacestuianueracompletsincer,dei tiacnasemeneacazuriseputeanelafoarteuor. n urmtoarele 30 de zile, nv principiile de baz ale geometriei. Agatadn nu fu de gsit, iar Anbzf i mrturisi c acest lucru era destul de neobinuit. Probabil era angajat n nite studii de mare importan, care nu sufereauamnare. Trecur2luni.Termingeometriaiocartedealgebr,necesarnelegerii unoroperaiiiexplicaii. Era o zi nnorat i friguroas. Un dor nelmurit l fcu pe Hzgta s prseasc oraul i s urce din nou pe munte, fr un obiectiv precis, admirnd frumuseea seac i impersonal a peisajului. Vntul btea din ce n ce mai tare, darelnuseopri. Deodat,zriopatglbuiela100depaimaisus.Seapropiiiddu seamaceraLooure,npicioarepemargineauneistnci,nfaauneiprpstii depefundulcreiaseridicauaburicenuii.Haineleifluturaunvntulslbatic, dar ea sttea nemicat, cu privirea pironit n zare. Hzgta veni lng ea, urmrindnoriintunecai. Odatmamnepatntrofloarederevi. Loourezmbi,frsspunnimic. Pe atunci m credeam singur, fiindc nu vedeam pe cel de lng mine. Abiaacumtiuceesingurtatea. Poiticuadevrat? Orafalmaiputernicifcusseclatine. Aidreptate. Dupuntimp,maizise: Tutii? Drept rspuns, o lacrim izvor pe chipul palid, iar vntul se grbi s o usuce. Astzieziuaprimeilucrri.Mntrebcinendrumcampaniadestropire, nloculmeu.MntrebdeSabatn. Eleraceldelngtine Da.Eranelegtornloc,ieunamneles.Cegreunenelegemuniipe alii! Cegreunenelegempenoinine! Astanartrebuissentmple Darsentmpl. Emarepcat. Loouretcupuin,apoisurse: Tunelegicesentmplcumine?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nu te cunosc. Dar vd c eti singur i fr speran. Dezamgit de lumeipoatedetinensi.Aivenitaici,crezndctotulserezolvprintrunpas?! Ealscapulnjos. Nu poi scpa de soart. Dac o evii acum, ncercarea te va ajunge n viaaurmtoare. tiu. AincredereAincredere. Tuaincredere? Msimtattdeslabnfurtun! optins: Da!5 Cuvntul uier cu o siguran neateptat, surprinzndul. Looure ntoarseprivireaspreelizmbi: Bine. iapucncheieturaminiidrepteiiostrnsecuputere.Palmaeieraatt de rece, nct l trecur fiori. Hzgta ddu napoi i ea l urm. Apoi se ntoarseripornirprintrepietrespreora. Se scurser nc 10 zile. Agatadn continua sl duc cu vorba, zicndui cmaiaredestudiattrsturilelunilor,darelnusesupr.Oricumvoiasnvee pentruodungstrlucitoare. nbibliotec,atmosferaeraaceeai.Hzgtasegndicaafusesedela nceputurileNoiuluiiaavafipncndcrilesevorprefacenprafizidurile sevorprbui. irelulocul,dejaattdefamiliarincepusnvee.Launmomentdat ntoarsecapulspreLooure.Aceastaiprinsesefaanpalmeiseghemuisepe podea,tremurnduor.Hzgtasesperi.Segrbisvinlngea,idesprinse minileiicuprinsecapul,atingnduicudegeteletmpleleibazafrunii.Simi de ndat surplusul energetic i trecu la masajul standard pentru eliminarea sa. Apoiispuse: Haisneplimbmpuinpeafar!Ostesimimaibine. Oludebraioajutsseridice.Ieirdinbibliotec,apoidinoraii dduseamacseineauncdemn,deisprijinulnumaieranecesar. Eticuminecndamnevoie.Eticelmaiaproape. Hzgtanurspunse.Gndidoar: Avemacelainume. Deundetiitehnicaaceeademasaj?Aproapecmiatrecutimediat. iamspuscsuntstropitor. Da.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Am fcut un curs special de autoaprare. Substanele chimice pe care le folosim eunumaisuntdintreei potfiuneoriduntoare. E foarte bine s cunoti astfel de metode. Oricnd se pot ivi situaii dificile.Caacum. ntradevr. Evitafondulproblemei. tiistratezimulte? Nusuntvindector!Darncazurimaiuoare,ajut. iaintlnitmultecazuriuoare? Elfcuopauz. Credeamcaincrederenmine. Loouremimvinovieizmbincurcat. Iartm.Aiobservatcsuntnefericit. Eevident,azice. Nuexistevidene,cidoardemonstraiisimple.Saudimpotriv. Mda.Nutiideceesteora474. Fatalprivicuunamestecdemirare,admiraieiamuzament. Nuteaignditniciodatsfaciuntestdenelegtornloc? Vremeaecadrumulsoareluiprintrestele. Nucredcaraveavreunrost. Decenu?Arfipcatsfiintradevrisnufiisigurniciodat. Nusimtcsunt. Ams Seoprilatimp.ErasspunAmsmgndesc. Amsfactestul.Decenu? Loouresurse.Poateerasinguraeivictorienultimultimp.Reuisesi impun punctul de vedere, chiar dac nu era o chestiune foarte important (sau era?)ipreamulumit. Mbucur. DaChiar,povestetemiimieceeaaciudatcutematadecercetare!? Earsecufurie. E ntradevr ceva de povestit! tiai c profesorii o ncadreaz la adevrurinedemonstrabile? Pidacenedemonstrabil,cumdeiaudatoie? Fatanurspunseimediat.ntruntrziu,vorbi: tiicedarameu? Deundestiu? Ghicete!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hzgta se gndi puin, ntrebnduse ce daruri ar putea n general oameniidetiin.Eraudestulevariante,ccinuntotdeaunameseriaeraaleasn funciedeaptitudini.tiinelenucereaucalitispeciale. Oprivi,mimndcuriozitate. Percepevenimentedinviitor. Casvezi!ieusuntpremonitor. Prezentliniar? Pe12minute. Bnuiam. tiinadarurilor. Eucunoscfaptendeprtate.Deexemplu,peste20sau100deani.Uneori chiar1000.Dinpcate,suntsituaiidisparate,darlenotezdefiecaredatcndmi apar. Nulepoicontrolacontient? NuNiciodatacesttipdepremoniienuapututficontrolatcontient. M rog, vorbeam despre adevruri nedemonstrabile Cnd i se d aa un subiect,singuraansesfacioaltdescoperirepeparcursisspericedestul de important pentru nc o dung strlucitoare. De la 2 dungi, poi si alegi singurtemadecercetare.Dacnuedestuldeimportant,poifoartebinespleci dinNoi.Uniiiaumncattoatviaacutndrspuns. ituacumncercisgsetiorezolvarelaproblemsauapelezilanoroc, pentruodescoperireintermediar? Nu,amncercat,nupotszic!Auzisemeucenzadar,daramvrutsi dauoans,nu? Cui? iaigsit!Nutiucesmaifac.Nutiuundesmaicaut! ntradevr,paredestuldegreu.Poateaitrecutpelngrspuns,darnu lailuatnseam! Da,esteovariantfoarteprobabil.Deobiceiunulsechinuieogrmad devremeialtulvinedinurmcuideea,dininspiraiesauintuiie,pentrucarenu amuncitdeloc. Hzgtasesimicompletdeacord.Segndisedemulteorilaacestlucru isebucuraacumcaltcinevaimprteaprerile,chiarnerostite. Aiperfectdreptate! Mda.Mntrebcepotsfac.Amsmaistaucelmultunan.Sevagsi undevaunlocipentrumine. Esteunlocpentrufiecare.Undeeloculmeu? Da Spunemidespretine! Ce si spun?! Sunt din zg, am fost stropitor , am ajuns acum i la Universitate
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Looureatepta.Elidreseglasul. Amamfcutodescoperire,cred Eantoarsecapulinochiiseciteasurpriza.Hzgtaisusinuprivirea. Dupctevaclipe,zise: Trsturiledebazalepersonalitiiunuiomvariaznfunciedelunan caresanscut.Maiexact,ceinscuinaceeailun,auaceleaitrsturidebaz. Era curioas. Nu credea, dar voia s fie convins. Dar el nu putea so conving. Nici el nu era complet sigur c un lucru att de inexplicabil, aparent ilogic,arputeafiadevrat. ipovestinsaventuracudiscuiiledepestrad,ipovestidesprevictorii ieecuri,desprencredereidezamgire.Cndsfri,aproapetremura.Looure fusese singura persoan creia i destinuise vreodat aceste lucruri, n afar de Agatadn.NutianiciGeviemi.NicimcarGeviemi. Easursecutimiditateispuse,plindetandree: Mulumesc. ntro zi, Hzgta nchise cartea i privi spre Looure. Aceasta citea plindedezinteresunmanuscrisruginitdevreme,ntorcndcte2foiodat. Amterminat,spuseel. Fatantoarsecapul. Aiterminat? Da. Eazmbiiconcomitentformfelicitate,nelegere,bucurie. Cefigurexpresiv!Eunaputeasartatteasentimentenicidacmi aaranjafaacuminile! Aisdaitest. tiu. Cunotivreotehnicdememorizaresautrebuiesrepei? CunosctehnicaIoerel. Mirareaiapruinvoluntarpechip. O!Etiplindesurprize.Undeainvato? Amfcutuncursspecialcnderamcopil.Tatlmeumispuneacos amnevoiedeeacndosmateptmaipuin.iaavutdreptate. Cegradai? 7. Zeilor! Uimireaisetransformntroizbucnirenecontrolat. Zeilor! repet ea. nseamn c nu uii nimic! Probabil ii minte i ce ai mncatacum10aniiozi. Hzgtazmbi,cumvastnjenit: SnuexagermNureindectcemintereseaz. nurmcu10aniiozimncasepentruprimaoarunfructdebadaf.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Mda. tii c pn acum 100 de ani, capacitatea de memorare extins era socotitdar?PnavenitIoerelcumetodaeiciudat.Euamnvatodoarde4 ani. iaigradul4. iamgradul4.Dartotmiamintesccaiodatoriefademine. Nuteaignditniciodatsfaciuntestdenelegtornloc? Exact. Darunde?nNoinusuntcentredealelor. Nu, ntradevr. ns mam interesat. Cel mai apropiat centru este n Vdmi.Trebuiedoarscobormmuntele. Scoborm.ipasdemine!? nainte de asta, continu Looure, trebuie s ceri ngduina ndrumtoruluitu.Agatadn,nu? Da.A,apropo,ndrumtorultucinee?Cineiadat? Seuitsemnificativsprepaginiledinfaaei. Badgp.Elecelmaimarecercettorntiinadarurilor.Ascrisvreo17 cri. Nul cunosc. De fapt, m i mir ct de puini oameni cunosc n Noi. ComparativcuOmijior,deexemplu. Fatantoarsecapulsprepereteleopus. Crezicaifimaifericitdaciaicunoatepetoi? Hzgtanuzisenimic.Looureaveadinnoudreptate. Se gndi c trebuie sl anune pe astronom. Trecuse de mult ora 2, dar ncnueraora3. MduclaAgatadn. Bine. Chiar,tunuceringduinaluiBadgp?Pentrucmergiitu,nu? Nu.Merg,darnudaueutestul. Tutiimaibine Seridiciieidinbibliotec. Profesorullprimi,invitndulsialoc.Nueravesel.Cercetndviitorul, Hzgtaidduseamacfusesescutitdechinuluneiexplicaiiverbale. Avreasfacuntestdenelegtornloc,ispuseiispuse. Astronomulnuscoaseniciuncuvntinuformnicioexpresie.Figurai erampietrit.Oarecegndea? Nucredcamanse,dartrebuiesmerg.Eodatorie. neleg. VoceaierarececavnturiledinNoi. Nucrezicaianse?!Decenu?Totui,nuuitacviitorultuncepeaici. Hzgta se simea intimidat, de parc ar fi fcut un lucru ce nu sar fi cuvenit.Glasulitremurcndvorbi:
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Amngduinata? Agatadnprivinpmnt; Etiliber. Seridicrepedeiplec,caicumiarfifostfricsnuserzgndeasc cellalt.iziseluiLooure: Cnd? Eradimineacndseurcarntrsur.Ceruleraacoperitdenorigroii frigulaproapeiamorea. Osplou,spusevizitiul,lundhurile. Nuerabinesfacidrumlungpeploaie,cciapaslbeacalitileuleiului derah.Pagzloboseamairepedeiarcltoriaeraplindesmucituri. Duppuintimpncepufurtuna.Nuputeauvedeadirectfulgerele,cidoar lumina lor asupra ntinderii de piatr, zguduit concomitent de tunete. Se ineau strns de mn i priveau spectacolul fascinai, tiinduse cu toate acestea n siguran,apraidepereiitrsurii. Ori de cte ori va fi furtun, mi voi aminti clipa asta. Clipa asta va fi trecut.Estedejatrecut. iauzeauprintrsnetebtileinimilor.isimeaulacrimilenevrsatei gndurilenerostite.Acumeraumpreun.Treptat,speranalecrescunsufleteile aduse linitea. Ploaia rmase n urm. Coborser muntele i se apropiau de Vdmi. OraulnueralaprimavederediferitdeNoi:aceiaioamenimbrcain vestegalbene,aceleaicldirifrnsemne,aproapeaceeaimrimensdecum intrarpeporilesaleintmpinatmosferamultmaidegajat,maiprietenoas, mai uman. La aceasta contribuia probabil i peisajul dealuri line i o zare de muntemunteleundeeraNoiul,cumirosulsudepiatrsearbd. Coborrdintrsuriseuitarnjur,netiindpecinesntrebe.Merser vreo400depainspreinimaorauluiideodatopatrulvenilngei. Patrulele erau alctuite n general dintrun nelegtornloc de rang mediu i dintrun aprtor i rolul lor era asigurarea linitii i respectrii convenienelorsocialeacceptate. nacestcaz,eitrebuiausiprimeascisindrumepenoiivenii.Omul ngalbenvorbiprimul: SunteioaspeinVdmi,nuiaa? Da,amvenitpentruuntest,rspunseHzgta. Tulnsoeti,nu? ntocmai,spuseiLooure. Preabine. nelegtorulnlocfcuunpasnapoi.Omulnverdezise: Dacvrei,vputemconducelaloculdetestare. Vrem.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Urmaine. Cldireancaretrebuiausintreerachiarncentruiavea3etaje.Chiar cndHzgtaitrecupragul,omulngalbenistrig: Noroc!Dartestulnuesoarta! Elnuntoarsecapul,muluminsufletinaint. La o mas stteau dou femei n veste cenuii. Imediat, una din ele se ridiciieingrab.Cealaltipoftisseaeze. Undesaduscolegata?ntrebLooure. Sadussichemepeprofesoriicaretesteaz. Dardacvreunulareolucrareimportantinupoateveni? Nimicnuemaiimportantdectdescoperireaunuifrate. Acestrspunspusecaptconversaieifirave,alcreiscopevidenteraacela deaimairisipidinteamluiHzgta.Rmasernemicaintcere12minute, dup care ua se deschise i intrar 4 profesori cu veste strlucitoare, urmai de femeiancenuiu,ceiineacapulplecat,nsemnderespect. Urmeazne,izisecelmaibtrndintreei.Singur. Inimavoiasisardinpiept. Urcar la etaj. ntro camer destul de mic, cu perei portocalii, se afla numaiomasrotund,njurulcreiaseaezarcutoii.Masaeracald. Cineetiicineafostnainteata? Suntfiulluihzgt.imarcameapersonalesteA. Undeteainscut? nzg. Aidejavestgalben. Da.Amfoststropitor.Acumstudiezastronomia. CunotimetodaIoerel,nu? Da.7. Bine.Privetenjur:portocaliu.Povesteteneceiseparemaiviu. mi amintesc c aveam 6 ani. Voiam o minge din esen de vf, din aceleacaresarpnaproapelaaceeainlimedelacareaufostlsatescad. Profesoriizmbirncurajator. Mamrugatmulttimpdetatasmicumpereuna,nsmingileasteaerau destul de scumpe, iar tata nu era dect stropitor. n ziua a 15a a lunii arpelui, tatl meu mia spus c vom merge s cumprm o minge. Era o diminea rece, ploua,cerulerannourat.Euerambucuroscnsfritvoicptacedoream,dar numiplceavremea.Ammerspejospnlamagazin,amintratinegustorulne aartatomulimedemingi,detoateformeleiculorile.Preurileeraudiferite,dar tata mia spus s mio aleg pe aceea caremi place cel mai mult. Am ales una portocalie,maredeopalmjumtate.Tataazmbitiacumprato.Cndam ieit afar, ploaia ncetase. Mam uitat pe cer. Norii se crpaser i printre ei
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


puteam vedea soarele. Era portocaliu i mare ct mingea mea. Eram acum cu adevratfericit.mipreacamcumpratsoarele. Tcu.Profesorulcelbtrnsurseiari: Eoamintirefrumoas. Da,este,ntradevr,ziseHzgta. idduseamacnuimaierateamdeloc. Putemncepe,nu? Desigur. Celdinstngasavorbi: ivoipuneontrebare.Derspunsultudepindetotul:dacmergimai departesaunu.Etipregtit? Hzgtasegndioclip.Aveapercepiatemporaldeschis. Nucredcnelegereaunuiomdepindedenumaiontrebare.Nucredc voirspundecorect. HmTocmaiaifcuto. Celdindreaptasavorbi: Cecrezidespreoameni? Oamenii sunt la fel; indivizii sunt diferii. Indivizii ntlnesc n general indivizi,doarpuinidintreeiaupututcunoateoameni,ideaceeaauoprerede multeorigreitdespreacetiacredctoioameniisuntcaindiviziipecareiau cunoscut. Tunucreziaa. Nu. De fapt, la drept vorbind, sar prea c i oamenii pot fi mprii pe tipuri. Spunetotcegndeti!replicprofesorulcareadresasentrebarea.Dacne miniacumpenoi,teminidefaptpetine. Nu mint, spuse Hzgta i i repet gndul cu voce tare, adugnd apoi:Numreferladaruri,profesie,vrstsauexperien,cilapersonalitate. Examinatoriiseprivircontrariai. Deundetii?zisecelmaibtrn. Nutiu.ncbnuiesc. Nuvrusdeaalteamnunte.Darprofesoriiprurssemulumeasccu att. Cecrezipnacumdespretest? Hzgtanelesectrecuseiadouaprob. Sunt surprins. Credeam c e altfel nu tiu nelegtoriinloc simt. Noipnacumamvorbit. Greise.Simiacestlucru.Aceastaeraatreiaprob.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mipareru.ntradevr,minchipuicunnelegtornloctrebuies aibnprimulrndoperspectivcorectasupracelorpecareianalizeaz.Trebuie siinterpretezeisncadrezeceeacesimteiintuiete. Profesorii se ridicar. Se ridic i el. n timp ce ieeau din camer, unul spuse: Da, pn acum e bine. ntrun fel, aveai puin dreptate n afirmaia ta pripit. i dai seama c un nelegtornloc experimentat recunoate darul altui om,chiardacnuilpoatenelegepedeplin.Testulesteduspnlasfritpentru ca acela si dea singur seama dac are darul sau nu. n cazul tu, trebuie si mrturisesc c suntem cumva ncurcai n deducia preliminar. Ai, desigur, o perspectiv de nelegtornloc, ns nu putem spune dac ai i darul. Numai probaaceasta,probapractic,nevalmuri. ipeeiipemine. Setrezinstrad,lngLooure. Cesantmplat?ntrebelbuimac. Fatalprivioclip,apointoarsecapul. Namluattestul. nmodciudat,gndulacestanulafectnniciunfel.Oarecum,iseprea normal. Nu simise niciodat c ar fi nelegtornloc. Se ntreb dac Sabatn simisevreodat. Se chinui si reaminteasc etapele testului, s vad unde greise, ns constatcusurprindereispaimcnuiputeaamintidectprimaparte,ncare sttusedevorbcuprofesoriincameraportocalie.Arfitrebuitsurmezeproba practic,nsnuiddeaseamacesentmplase. ipentrucinevacugradul7Ioerel,aacevaeranprimulrnddureros i umilitor. Singura explicaie era un blocaj mental provocat de o persoan cu gradul 10. Dac el ar fi studiat n continuare i ar fi urcat pe ultima treapt a tehniciidememorizare,iarfiadusamintecusiguranideceleceurmaser. Loourenuartanicieasuprat.ifcusemncucapulsmeargspre ieirea din ora, unde i atepta trsura. Trecuser doar 40 de minute de cnd veniser. nNoitimpulnupreascurg. Adouazi,Hzgtaseduselaastronom.Firete,fuprimitiinvitatsia locnuntru. Nutrebuiesmispuinimic.iamcititgndurile. Cebine! Aveainevoiestiisigur. Eramcurios,ntrunfel,darnuaveamnevoie.Afostdefaptodatorie. Oricum,ceaizicesvorbimpuindespreastronomie. Despreastronomie? AiterminatprimacartealuiNatapda,nu?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Da,amterminato. Structuratamentalaratcfolosetiotehnicdememorizare. ntradevr,Ioerel7. n ultima vreme i se menionase de prea multe ori aceast nsuire, nct ncepuseslindispun. Discipolii obinuii dau un test, ca s vd ct au reinut i ct au neles dinceaucitit.Numndoiescctutiiloculfiecreiliterencrilepecareleai studiat Aaera. nsainelestotul? Amneles. Perfect. Atunci vreau s porneti un proces de rememorare general a crilor.Amsteurmresc. Hzgtanchiseochiiiilscapulpespate,modificnduinacelai timp ritmul respirator i cardiac. Rememorarea general nu era un proces complicat,cicomplex,deoarecesecereauattinformaiileasimilate,ctiordinea asimilriilor.ncepusilegeneritmiccapul,imaginnduifigurigeometricede diferite culori, ce se roteau i se transformau dintruna n alta, pe msur ce noiuniletreceaupentruoclipdoarnmemoriacontient. Volumul de informaii era destul de mare, i dup 10 minute, cnd termin,eralacdesudoare,ceeace,mcarteoretic,narfitrebuitsisentmple unuimaestrudegradul7.nsAgatadnEramulumit.ispusevesel: Felicitri!Poismergisiieiovestcuodungstrlucitoare. Hzgtamaigsiunstropdeputerecassebucure.Cndiacelstropse epuiz,realizcnuvenisenNoineapratpentruodungstrlucitoare.Voias tiedacdescoperireasaeraosteasauunpumndern. Aiajunslavreoconcluzieprivindnsemnrilemele?ntrebel. Agatadnnurspunseimediat.Dupctevamomente,vorbi: Suntpecalesajung,ntradevr,laoconcluzie. Acelntradevrnufceaafirmaiamaiadevrat. Pnatunci,terogceva Hzgtafcuochiimari.Erauluitorcaopersoansfoloseascaceast expresie adresnduise cuiva de rang inferior. n astfel de cazuri, cel rugat era aproapeobligatsndeplineasccerina. rminNoipentruncodungstrlucitoare! Hzgta se foi pe loc. Pur i simplu nu avea curajul si deschid percepiatemporal,casaflesubiectullucrriidecercetare. Dup cum cred c tii, ndrumtorul alege tema pe care trebuie s o cercetezediscipolul. Hzgtamimncuviinare.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Deoarece consider c ai unele capaciti deosebite, mam gndit la o lucraregeneral,nudeastronomie. InimaluiHzgtasestrnse. AmdiscutatcuBadgpiamhotrtscerceteziproblemacunoaterii timpului,mpreuncuLooure,carestudiaztiinadarurilor. Astronomulrnji: Aveiacelainume Ceticloie!Mntrebdactuaifostcuideeaastasauisaordonatiie, cine tie de cine! De ce mai mai adus aici, ca s m ngropi n prostia asta evident? Te neli dac i nchipui c am s stau ca prostul s mbtrnesc n bibliotec. Mcar pe cmp ce fceam avea sens. Sper s m reprimeasc regele, dacnu,osimulumesctoatviaa!Eora3i15,marescofal!Cuiipas?! Agatadnnuschinicioexpresie.Spuse: Pleac. Hzgtaseridicimediatiieirepededinncpere,frsnchidua. Acestgesteradeogrosolniedesvrit. iuasenchisenurmalui,frcanimenisoating.

Trdat.Trdat.Trdat. Dezamgit. nchis. Nesigur. DarLooure. ngropattoatviaa? Odungstrlucitoare. Sfiat. Frputere. Frsperan. Sfrit.Sfrit.Sfrit. itotui Triescnczeilornctriesc Amar.Negru.Vuiet.Rece. Trist.Aatrist. Jos.Maijos. Darnusingur Furie.Furie.Furie. Ur.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Buci. Nebunie. Srat.Rou.ipt.Fierbinte. Foc. Darmpreun? Chin. Durere. Chin.Chin.Chin. Nu!

Timp.Rah Nummaiintereseaz.Nummaiintereseaznimic.Numaiconteaz. Numaiconteaznimic. Dormimult. Cndsetrezi,sedusesocautepeLoourelabibliotec.Trecusefoarte puintimpdecndnumaivorbiser,darluiHzgtaisepreaovecie.Ogsica deobiceila1750,citindplictisit.Seapropincet.Habarnaveadacspartrist sauvesel.Sauplictisitiel.Ajunseitotnutiacesfac.Probabilartajalnic,cci Looure l privi lung, netiind nici ea cum s reacioneze. Hzgta se aez alturiisimicumtensiuneaidispare.Eaprucobservnsfritvestanou, surseimpinsecarteadinfaspreel. 3lunisescursernzadar,frcanimenisbagedeseam. ntrodiminea,Hzgtairidicochiidinfoi,ateptpuin,apoizise: Defapt,noicecutm? Unrspuns. Lacentrebare? Loouretcu. Tucunotitiinadarurilor.Euastronomia.Celegturavemcutimpul? Darcelegturauceilalioamenicutimpul? ntocmai! Uite, dac mi lrgesc percepia temporal, pot vedea viitorul, darnumaitiucteora.2darurisepotmanifestasimultan? Eaopticuovocenesigur: Cetotspui? Degeteleeitremurau. Nu,ngeneralnusepotmanifestasimultan. Atunci, ce ne mpiedic s considerm cunoatereatimpului undar?Un darpecarelautoioamenii?! Dareabsurd!Poatesconsidermivedereacadar!iauzul! Ba nu. De ce eti aa revoltat? Vzul i auzul au suport fizic. Darurile suntnsuiripurspirituale.GndetetelaAdcabk. Adcabk era un caz celebru al tiinei darurilor. Fusese un muncitor telekinetictoatviaa,frsrealizezenimicdeosebit,pnntrozi,cndcapuli
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


fuseseaproape zdrobit n urma unuiaccident nefericit. Era practic mort, cu toate acestea,reuismiteunbcucareszgriepepmntnumelesoieisale. izicicnmomentulmorii,numaitiaora,nu? Hzgtaseuitnpmnt,gndinduselaLooure.Arfitrebuitsfie ncntatcfusesepropusoipotez.Nuerafoarteimportantdaceracorectsau nu,dartrebuiadiscutat.idacarfifostcorect,cuattmaibinearfifostiea liber. Att de clar! Era invidioas. nsemna c ntradevr era o posibilitate serioas.Darnuiveniseeiideea.Nueravinaluins.Ceputeaface? Nuomaitia. Fusese o mic rutate. Looure se ridic imediat i plec furioas. Hzgta se ridic i el i se duse s joace mbof. n timp ce urmrea bilele i dduseamacrezolvareaproblemeierafoarteciudat.Eraorezolvare?Darurile eraurecunoscuteiacceptate.Niciundarnufuseseexplicatvreodattiinific.Era orezolvarefoarteconvenabil,astadacvafifostacceptatdeprofesori.Dardac toat aceast problem a timpului era doar o groap n care erau aruncate persoanele incomode? Looure se considera fr ndoial aa. De ce oare? Cei spuneau viziunile sale ndeprtate? De ce ar fi fost el nsui considerat astfel? Ce descoperise de fapt? Agatadn nui dduse nici pn acum un rspuns clar n legtur cu nsemnrile despre oameni i luni. De fapt, o descoperire att de original putea fi considerat un principiu nou, care trebuia prezentat n faa adunriinelepiloricareiarfidatdreptullaunmormnt.Arfifostinutminte pentrutotdeauna. Fr si dea seama, ieise din sala de jocuri i din ora i ajunsese pe o pajite de unde se puteau vedea versanii abrupi ai munilor urcnd spre cer la doarctevasutedepaidistan. Seculcnmareaalbastr,cuochiinsoareleumbritdenori. Se gndi apoi la Looure. Era foarte drgu, se apropiaser destul de mult n aceast perioad n care se chinuiser mpreun, ncepuse s o neleag, si recunoasc strile sufleteti suficient de puternice, dar nu tia mare lucru despreviaaei,despreea,ngeneral.Undesenscuse,ncelunsenscuse,cum ajunsesenNoi Aveauacelainume.Erausortiiunulaltuia? iridicmnancaleasoareluiiintinsecele4degetesprecer.Leprivi iizise: Cearfisadormicndmvoitrezisam5degete? Rmaseaamultvreme,suprapunndimagineaprezentpesteimaginea din viitorul apropiat. Nu mai tia cte este ora, dar norii se vedeau n poziii succesivecurioase,acoperindidescoperindsoarele.Degeteleluirmneaulafel iHzgtasesimiieitdintimp,simultannprezentiviitor,pncndochiii senchiser.Adormicupercepiatemporaldeschis.idduseamansomnde
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


umbracareseivialturiiidduseamadetrezire.Dormeaieratreaznacelai timpiateptcaviitorulslajungisladucdinnounrealitate. Teamcutatprintotoraul. Acummaigsit,spuseelfrsopriveasc. Am avut o premoniie team vzut aici. Nu tiu ns dac team vzut acumsaupestenutiuciani. Ridic ochii spre ea. Sttea cu capul exact n faa soarelui i pletele sale roiatice preau raze de lumin. Era mai frumoas ca oricnd. Hzgta zmbi larg. Looureseaezlngel. Vreausmiceriertare. Nusuntsupratpetine Eu sunt suprat pe tine! Mai ii minte ce iam spus odat despre descoperitori? Deobiceiunulsechinuieogrmaddevremeialtulvinedinurmcu ideea,dininspiraiesauintuiie,pentrucarenuamuncitdeloc. Maiinmintemipareru,namvrutsiiaudescoperirea. tiu,tiu.Deaceeavreausmiceriertare.midauseamacsoluiatae ceamaibunpentrutoi.Dardefaptamevitatrspunsul.Defapt,nejucmdea vestelevrstate. Aae.Daraa,maiavemoans.Dacstauimgndesc,sarputeas fieadevratictimpuledar. Poatevavaniozicnddarurilevorfiexplicate. Mntrebdacastanevaslbioarecredina. Nu cred Orict de puternic ar fi tiina, zeii vor rmne mereu deasupraei.Ecaicumamajungenloculcareeacumlaorizontiapoiamvedea zarea mai departe. Cu ct civilizaia e mai avansat, cu att religia devine mai abstract,pentrucnusemaipoatebazapeelementeconcrete,justificatetiinific. Creterea puterii de abstractizare e un semn de evoluie. Cnd darurile vor fi explicate,vomcredeovremecneamapropiatdezei,pnvomdescoperintro zialtlucrucarenevaaminticsuntemdoarfiredenisipndeert. Dac sar fi nscut cu 400 de ani mai trziu, poate ar fi descoperit cu adevratcauza.Poatechiareaarfiexplicatdarurile.nscinetiecareedrumulei naceastvia? Frsvrea,iaminti: Careedrumulsoareluiprintrestele?istelelesuntsori. Erabine. Agatadn se grbi sl cheme nuntru. Totui, Hzgta nu se simea prea confortabil. Nu putea uita cu ce ton de batjocur i vorbise atunci cnd se vzuser ultima oar. Nu mai avea despre astronom prerea excelent de la nceput.Acum,ielputeafimpotriv.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Agatadnlpofti cu un gest larg (bunvoin cine are nevoiede ea?) i apoiseaezielnfa.Mimntrebare,iarHzgtatrebuisseconcentrezen modspecialcasiadunegndurile. Aiajunslaoconcluzie?repetcellalt. Credcda.Credemctimpuledar.Darurilenaufostexplicate Surprinztor,astronomulrsuflcuputere,seridiciizbucnintrunrs nestpnit. Abia acum i ddu seama Hzgta de tensiunea reprimat a lui Agatadn.Nufuseseostil,erauurat.Dece? Multiamaitrebuit! Hzgtarmasecuguracscat. Desprecetotvorbeti? Bineciaidatseama,nsfrit! iatrebuit.iaidatseama.iLooureacercetat. ltrecuunfior.Eltrebuiasdescopere? ntradevr, asta e cea mai bun soluie pentru amnarea rspunsului. Dei Sentrerupsebrusc. Oricum,suntdatorsiexplicdeceiamdataceasttem.Timpulafost inclus n temele pentru 2 dungi acum 163 de ani, de un profesor dubios, care a fcutodescoperireinteresanti,dupceialuatvestastrlucitoare,nascrisnici ocarte.Nuiascrisnicimcarpropriateorie.Aliiauscrisonnumelesu.Dar, casrevin,vestabivrstatieranecesarcasipreziniadevratadescoperire. LuiHzgtaunfulgeriluminmintea.Astronomulaveamaredreptate. Cumarfipututnelepiislianseriospeunbietciupercar,inccuoipotez aparentaberant. iexprimrecunotinainelegerea. Darrmneaproblematimpului.Agatadnpreacseateptaselaaceast rezolvare.Dardactiarspunsul,decenulspusesechiarel?Eraotemvechei dificil. Oricui ar fi gsit o soluie iar fi crescut renumele. Ideea i strbtu contiena ntro clip, dar fu de ajuns ca astronomul s o prind i s zic brusc posomort: tiamcaismntrebiasta.Vino! Hzgtaseridicilurmprintroudinfundulcamerei,pomenindu senceeaceidduseamaceraodaiapersonalaluiAgatadn.Sesimidintr odatcopleitdeemoie.Cinsteacareisefceaeranemaintlnit. iamintiozincopilrie,cnderasinguracasi,mnatdecuriozitate, ptrunsesencamerelepersonalealeprinilorsi.Aflaseundeerauascunsecheile i profitase. Inima i btea la fel de tare acum ca i atunci. De fapt, totul fusese tentaia interzisului. Camerele nu aveau ceva ieit din comun cte un pat, o msu, un dulap Dei erau diferite ntre ele, camerele nu se deosebeau structural,ichiarsemnauntrunfelcupropriasaodaiepersonal.iamintide
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


asemeneadecameraluiGeviemi,carelinvitasensemndetergereasecretelor dintreei.Apoiivenirngndpropriilesalepersonaledinbarciledepecmpul de ciuperci i din zg, apoi venirea aici, unde constatase absena camerelor de primire.Loculacelastrmtundetrebuiasdoarmnuputeaficonsideratpublic. Deaceeasepedepseaintrareanaltcamerdectcearepartizatdreptviolarea uneiintimitielementare. iacumAgatadnlprimealael! Pe o mas erau chiar caietele sale de nsemnri, alturi de o mulime de hrtiiivreoctevacri,unelenoi,alteleruptedevreme.ntruncolseaflanso mainrie ciudat, un fel de minge nu prea mare ce ar fi trebuit s urmeze o traiectorieaproapecircular,imprimatnplacacareosusinea. Agatadnlinvitcuungestlargsseapropie. Uite de ce nu am fcut eu descoperirea! sta e un aparat de msurat timpul.Cumcrezicmsimtcndtiuctoatlumeaareacestdartoinafar demine!? Nucunotitimpul?!izbucniHzgtaiapoimimscuze. Nufusesesurprinsdehandicapulpropriuzis.Arfifostnefirescssemire c un orb era orb sau c un om nu avea o mn. Era uimit pentru c profesorul pruse perfect normal din acest punct de vedere. Nui ddea seama cum se descurcasenlips.Elsarfisimitpierdut.Cefceacndnuerancamer? Drept rspuns, astronomul i art inelul de la mna stng, pe care Hzgtanulremarcase,crezndcedoaropodoab.Seuitcuatenieivzu cpiatraeraoarecumasemntoarecumingeamainriei,doarcspredeosebire deaceasta,peeaerauncrustatenitesimbolurinecunoscute,nlocdecifre. Da,eacelaiprincipiu.Fiecruisimbolicorespundeocifrdefaptora curent.Acumdepild,trebuiesfie520. Era515. Da,ziseHzgta. ns inelul nu e prea exact. Dup cum tii, nceputul zilei este rsritul Soarelui, dar datorit nclinrii axei planetei fa de planul orbitei, momentul rsrituluidifernfunciedeanotimp.Pentrutine,nceputulzileieacelaimereu, diferdoarperioadactestelumin. iaminteacitisedespreacestparadoxncriledeastronomie.Astfelse explicavariaialungimiizilelorinopilorncursulunuian. Inelulmsoarfix10deore,aactrebuieslcorectezdupmainaasta. Seapropiaramndoi. Mingea simuleaz micarea Jmalaei n jurul Soarelui. Mam chinuit o mulimecasifacmecanismul.Vezictraiectorianueaproximatcerc,ciecan realitateeliptic.inacelaitimp,mingeasedipestecap,iaraculstaarat ora.Micrilederotaieirevoluiesuntcorelate,aacoraartatesteorapecare artrebuisotiituiceilali.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hzgtapriviiadmise. Dacstauimgndesc,oastfeldemainarputeafimultmaiprecisca unom. Fiecare copil era nvat s mpart n mod convenional senzaia permanent de durat, aa nct o zi s aib 10 de ore iar fiecare or 100 de minute. Dincolo de minut, doar cei cu capaciti speciale puteau ptrunde. Profesorulfusesepoateuncopilnefericit. Deocamdatnuenevoie,urmastronomul.Darcinetiedacnviitornu vortrebuiidiviziuniimperceptibile. Ctdureazexactsrituradepeomas?aproapeinstantaneu.Nici0,nici 1minut.Darlaceiarfolosicuivastieexactacestlucru? Poatechiartuartrebuisstudiezinumereleasteadivizionareciudate. Da, poate chiar eu Acum ns trebuie s pregtii prezentarea descoperirii.AmsvorbescicuBadgp,sstabilimziua. Nu le lu mult timp s scrie explicaiile. Hzgta tia c nu erau prea convingtoare, dei Looure se strdui s fac toate paralelele posibile ntre percepia timpului i celelalte daruri acceptate. Mai ales c avea acum i confirmareacorectitudiniiipotezeisaleAgatadn,excepiacedovedeactimpul nu era cunoscut de toi oamenii. Acum ar fi trebuit s caute i alte excepii, s piard ani i ani ca si demonstreze riguros teoria. Dar nu timpul era descoperirea lui, ci cunoaterea oamenilor, n funcie de perioada naterii. Si iroseascviaapentrualtcevaisepreaotrdare,olaitate.icredeaceaproape deatingereascopului. nprimazialunii,toiprofesoriidinNoiseadunarpecmpiadelng porile oraului, mpreun cu discipolii ce trebuiau si prezinte descoperirile. Totdeaunaacesttipdeadunareseineanmijloculnaturii,ntructseconsiderac fiecare descoperire era un pas nainte n dezvluirea secretelor acesteia i n regsirealoculuioameniloralturidezeiiunivers.Erafrig,darsenin,aacumse cdeasfietoatezilelencaresefceaupublicerezultatelecercetrilorpersonale. Cam 30 de nvcei rvneau vesta bivrstat. Problema timpului fusese consideratceamaiinteresanti,fiindcnuavealegturievidentecunicioalt descoperire,fuseselsatlaurm. Unpreotnhainevioleteieinfaasemicerculuiprofesoriloriiridic minilepentrubinecuvntare. Precumminiletaleacumiaici,lafelndrumareazeilornaltetimpurii locuri!mulumirceidinadunare. Apoi se ntoarse n direcia opus, ctre semicercul discipolilor, i binecuvntileprimimulumirile. Sunt Cobortorul Sorii, Braul mie trecutul, Mintea mie prezentul, Judecatamieviitorul. MrireTrimitorilor!zisertoi.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Loouretuiuor. Fiecazeiisnemaidesprindaziunfirdinlegturacenentunecochii, mai spuse preotul, lsnd braele jos i aeznduse n lateral fa de cele 2 semicercuri. Primul discipol veni n fa i i prezent descoperirea. Era ceva din domeniulchimiei,iHzgtancercsneleagctecevadinexplicaii,darnu reuinntregime.Concluziaeransinteresant.Profesoriimimaruniiaprobare, alii nencredere. Se privir cteva clipe, apoi civa i schimbar expresiile. Se privirdinnouiapoitoimimaraprobare.ndrumtorulpersonalaldiscipolului zmbiispuse: Felicitri!Poismergisiieiovestcu2dungistrlucitoare! Loouretuidinnou. Urmaldoilea.Pledoarialuinufuconvingtoare.Profesorulsuizise: Felicitri!Poismergisstudiezincontinuare! Loourenumaitui. Lafelsepetrecurlucrurilecutoiceilali.Urmauei2. Loourevorbiprimaincercsexpunctmaiconvingtorexplicaiile. Hzgta i deschise percepia temporal. nfrngere!!! Chiar Badgp nu se arta ncreztor. Dei muli dintre ceilali profesori aprobar la nceput, recunoscnd competena lui Badgp, i schimbar expresiiile. Mai erau 2 minutepncndtrebuiasiacuvntul.Cesspun?Srepeteceaspussauva spune tot el i s accepte batjocura lui Badgp? Dumanul lui personal, Badgp, care din pcate nu va muri n urmtoarele 4 minute. Cum sl conving?Darurilenuerauuniversale.Percepiatimpuluieraonsuirespiritual. Trebuia s mai vorbeasc despre excepii. Despre Agatadn?! Doar nu era nici o ruine s nu ai un anume dar. Nu nelegea complexul astronomului. Totui era deciziaacestuia.Eradefaptdescoperirealui.Darnacelaitimptrebuiasctige acum.isevaschimbaoareviitorul? ivenirndul.Adusevorbadeexcepii.NulprivipeAgatadn. tiu c o excepie exist chiar aici, n Noi, i aceasta near putea confirma ipoteza. i cine tie dac e cu adevrat o excepie. Poate sunt muli ali oameni carenu percep momentul temporal curent, dar care nicinu au nevoie de aceast informaie precis. Dac exist oameni care pot percepe diviziunile minutului,decenarexistaioamenicaresnuperceapnimic?!ioamenicanoi, camajoritatea,carepercepemtimpullaniveldeminut.Nuestemultmaisimplus considerm toate aceste manifestri drept fee ale aceluiai dar? Dup cum premoniia e darul viitorului i memoria darul trecutului, de ce s nu lum n considerareiundaralprezentului?Darurilenuaufostexplicate.Nutimdece cunoatemtimpul.Totcetimestecaceastaeonsuirespiritual,cuniioameni oposedicesteunpasnaintesoconsidermdar. Loouretuiuor.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Badgpspuse: Vorbeai de o excepie. Cine este? Dac aceasta confirm ce ai zis, vom puteacutaialtele. Hzgtanurspunse.OprivipeLooure.Osimicitremursufletul. Nutiadesprecevorbeteel,totuinulsanicioumbrdendoialsitulbure chipul.lncuraja,lsusineapnlacapt.Eraora210,dardreptateaeralafelde ndeprtat ca negura din ochii lui Agatadn. Hzgta spuse numele. Astronomul recunoscu. Profesorii rmaser mpietrii. Looure tui uor. Badgpformaprobare.iceilaliformaraprobare.Uncercsenchise.Avea2 dungistrlucitoare.iucisesencredereaunuialiat,unuiposibilprieten. PlecmpreuncuLooure.Eaerafericit.Eraovictorieimportant.Dar ceprepltise...i,dechiznduipercepiatemporal,rmasetrsnit:Loourel consolapentrunfrngere,pentruclefuseserespinsdescoperirea.Looureera i ea disperat, se gndea s plece din Noi. Se uit la Looure din stnga sa exuberant,privindviaanfa,cuoveststrlucitoarenochiiviitorului.Totui, fataobservrepedelividitatealuiHzgtaitremurulminilorisesperi: Ceicutine?Cesantmplat? Elabiareuisngaime: Numaipercepcorectviitorul... Seaezpejoslamargineadrumului. Vdaltceva...Vdcamfostrespini. Loourenuspusenimic.Erafoartengrijorat.Hzgtaipovesticese ntmplase. Ceamfcut?!Amschimbatviitorul?Zeilor,msimtattdepierdut!... Looureseliniti.Sebucuradentorsturapecareoluaserlucrurile.i era recunosctoare lui Hzgta. i prea ru c se chinuie, dar era fericit c scpaser din groapa cercetrii timpului. i cuprinse umerii cu mna dreapt i rmaser mult vreme acolo, unul lng cellalt, la poalele muntelui de piatr al Noiului,nbtaiavntuluicenuiuirece.isoareleeraattdedeparte!... ApoiHzgtasedusencamerasaimeditpnvenioradeculcare.n cealaltvariantdeprezent,fcealafel.Adouazidimineasentrebadacsse duc la Agatadn. Nu tia cum va putea s dea ochii cu acesta. Totui, era mai important s tie ce se va ntmpla de aici nainte cu el i cu adevrata sa descoperire. ns astronomul nu era nuntru sau nu dorea s primeasc pe nimeni. ncepusocautepeLooure.Sedusenbibliotec,darnueraacolo.Nutiaunde st,pentruciseprusenepoliticossontrebe.Decisedecismearglacldirea de distracie, cu toate c nu avea nici un chef s joace ceva. Era devreme, aa c ntlni foarte puin lume. Nu tia ce s fac. n cealalt variant, Agatadn i spunea s caute i alte excepii care nu aveau darul cunoaterii timpului. Totui, Hzgtanumaidoreascercetezeaceasttem.Cerucaieteleileprimi.Hotr
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


splecencapitalsncercesiprezintedirectteza,saudacnu,siiaadoua dungstrlucitoarenaltdomeniu,deexempluchimie.Darasteaerauvise;tiac nuvareuimarelucru. Casnuseplictiseasc,sedusesicumperenouavest,cubaniiprimii de la rege pentru ultima recolt. Agatadn ii dduse dup o lun, aa cum i promisese, ns Hzgta nu prea avusese ce s fac cu ei. Toate n Noi erau gratis, cu excepia vestelor, nsemnelor i celorlalte semne distinctive. De fapt, n afaracrilor,probabilacesteaerausingurelelucruricarecontaucuadevrat. AbianziuaurmtoareontlnipeLooure,careireprocnufusese degsitcuozinainte.Erancveselivestabivrstaticonfereaunanumitaer desuperioritate.nochiiluiHzgtapreaimaiatrgtoare. Se plimbar o vreme, Looure i mrturisi c avea de gnd s cerceteze conexiunile dintre tiina vindecrii i tiina darurilor, ca un prim pas poate n direciaexplicriicauzelordarurilor.Hzgtaispusecnureueteslgseasc pe Agatadn i c nu tiece sa mai ntmplat cucaietele sale.Ea i zise s nui fac griji, pentru c totul se va rezolva de acum. Auzindo, i Hzgta se simi mai ncreztor. Mai ales c n cealalt variant, se prea c Looure prsise Noiul,frsispunniciuncuvnt.Simindoacumlngel,Hzgtahotr si nchid percepia temporal definitiv. i pierduse darul, dar gsise nelegereacuivacuacelainume.


ntro zi, un nelept construi o main care tia tot ce era n lume. Cu bucuriensuflet,chemoameniiiindemnspunntrebri. Existzei?spunecineva. Nu,rspunsemaina. Atunci oamenii ncepur si arate ura i s se ucid. Numai neleptul rsefiindcdoarelnelesesecesentmplase. 6,7,10 exilul,salvarealuiLooure,publicareaprincipiilorastrologiei ntrunaltviitordectcelmenit floareaderevi cucepre?cuceconsecine? ...rndurilecarenuaufostscrise...
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1



ntro zi, un strin sosi pe Jmalaa. Cercet un timp formele de via i obiceiurile lor i hotr c oamenii erau cele mai inteligente fiine i totodat stpniiplanetei. Aaclulegturacuaceiadintreeicareiziceauconductori. Amundarpentruvoi.Jmalaavafideacumamea. Oameniisesperiarispuser: Tuceritotul,nudainimic. Voiapraplanetaivvoipstraechilibrul. Dardecefacitoateacestea? Pentrucemoduldeviaalspecieimele. Oameniisevorbir: Sevedenstelecaceastfiinnuestebunitrebuieucis. Pornir la rzboi, ncercnd toate armele cunoscute i mturnd totul n calealor.Darstrinuluinuisentmplnimic. Am observat, spuse el, c ai distrus o mulime de fiine n campania voastrdeamucide.Aceastaesteplanetameainupotacceptacaprimaspecie sidistrugcubuntiinechilibrul.Credcmamnelat. Culacriminsuflet,ucisetoioameniidepeJmalaa.istinsesoareleio mutlngaltstea. Noiconductoriseivirdintrevieuitoareistrinuliajutsidezvolte inteligenaistriascnpacefolosinduipeceilali. Peste un timp aflar de o alt specie de strini care distrugeau viaa n totalitate pe planetele pe care le aveau n vedere, pentru ca apoi si instaleze acolo propria civilizaie. Jmalaa era la rnd. i folosir i ei cele mai puternice unelte,nstaresprefacocmpiealbastrnprafcenuiu,darstpnulplanetei neutraliztoatencercrile. Amobservat,letransmiseel,caivrutsdistrugeiviaapeJmalaa. Nu neam gndit niciodat c pe alte planete pot exista specii mai puternice.Nimeninunisampotrivitpnacumpecaleanoastr. itrecurmaideparte. PaceaseinstaldinnoupeJmalaa.Pcatcoameniinumaierauacolo. (5septembrie1995;18.49)
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sarahwrote:CYMRU 1.Ctevaregulidepronunienlimbagalez:ch=h,dd=(thnthat),f=v,ff=f,ll=hl (dur),si=,th=(thnthink),u=i,w=u,y=isaua.Restulliterelorsepronunaproximativcan romn. 2. n 2011, vechea ortografie etimologic a limbii engleze a fost nlocuit cu una nou i a ntmpinat de la nceput proteste vehemente, chiar i n Marea Britanie. Celelalte ri anglofone au refuzat s adopte acest sistem datorit faptului c se baza pe pronunia britanic standard (Received Pronunciation).n2012,urmassesupunlavotrevenirealavecheaortografie,darnaprilieAngliaa fostcuceritinuamaicontat.Regulidepronunie:a=(edeschissprea),=a(lung),e=e,=, ee=i(lung),i=ai(diftong),=i(scurt),o=o,=usauou(diftong),oo=u(lung),ou=au,u=a (scurt),=iu(diftong),w=u,ch=(cnceapsauacid),j=(gngeantsaualergie),sh=,= (thnthink),(thnthat).

Crainicaspunea: Conform ultimelor informaii primite de la Comisia Electoral Central, nesuntconfirmatedateleprivindvictoriazdrobitoareacandidatuluiindependent Florin L., cu 93,4% din voturi, fa de numai 6,5% ale contracandidatului democrat.Eldevineastfelalcincileainacelaitimp,lacei35deaniaisi,celmai tnrpreedintealRomnieideduprevoluiadin1989.Nscutpe10... Florin opri televizorul i i ls capul pe spate, cu faa toat numai zmbet.nchiseochiiirepetngnd,mbtatdeglorie: Am ctigat! Am ctigat! E adevrat! Am fcut primul pas! Am urcat primatreapt! Ageniiledepresstrineanunarvesteapeuntoncircumspect,poatei dincauzcnusetiaupreamultedesprenoulpreedinte.Aprusepeneateptate n urm cu trei luni i de atunci fusese n continu ascensiune. Comentatorii nu nelegeaucumputusecucerisimpatiaunuintregpoporntruntimpattdescurt, cu un program neclar i nite discursuri mediocre. Discursuri care, inexplicabil, strneaudefiecaredatentuziasmulmulimilor.Darnimeninuinsistpreamult, fiindctoiateptausvadcesevantmplancontinuare. Pesteosptmn,Florindepusejurmntul,iarpestencuna,ianun inteniadeadesfiinaparlamentulideaseproclamamprat. Bineneles, peste hotare se declan scandalul. Preedintele organiz un referendumihotrreasafuaprobatde82,7%. Pe 1 decembrie 2012, Florin cuceri Ungaria. De data asta, toi simir c lucrurile se complic. Romnia fu exclus din Uniunea European, iar la ultimatumulSUA,mpratulrspunsenbtaiedejoc.Seinstituiembargoultotal iamericaniiseangajarsajuteprinoricemijloaceluptaeroicdeeliberaredus demaghiari.Lareferendumns,88,2%dintreacetiasprijinirunireacuRomnia.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Americanii, ca de altfel toat opinia public mondial, fur ocai. i ddurseamacnueralucrucuratiarobiectivulprincipalalCIAdeveniRomnia. ns,dupdouluni,toatenoutilenueraudectsupoziiisauspeculaii. nacestedouluni,UcrainaiBulgariaseunirnImperiulRomn. Vrjitoriiiastrologiiieiracumnprimplan.EraclarcFlorinfoloseao armparanormaldeosebitdeeficient. Ruii,siminduipoziianzondincencemaiinstabil,lansarunatac militar asupra Romniei, pe care lar fi catalogat apoi o regretabil eroare. Dintroregretabileroare,bombeledistruserMoscova. n Europa se declan mobilizarea general. Asta nui mpiedic ns pe srbi, bosniaci i croai s salute zmbind tricolorul romnesc. Urmar n ordine Muntenegru,MacedoniaiAlbania. EuropaiAmericahotrrcsaateptatdestuliproclamarsfritul etapeidefensiveinceputulceleiofensive. Frontulslovacfuundezastrutotal:100000dealiailuaiprizonieri,dup ceatacurileaerienerepetatenuavuseserniciunefect. ntreaga lume atepta ngrozit urmtoarea micare a mpratului. Iar europenii numrau clipele care le mai rmseser nainte de a dori integrarea n Imperiu. Slovenia,Slovacia,PoloniaiCehiantreisptmni. Civaoccidentalipreferarsinuciderea,omoartedemn,dectsajung nitesimplemarionetecontrolatenplanmental.Furdealtfelisingurelevictime alerzboiuluipanic,cumlnumirpoeiiiistoricii. Austria,Germania,Italia. Elveiaireafirmneutralitatea,darpestepuintimpstrzileBerneierau plinedeoameniceovaionauarmataromnipemprat. Americanii i francezii ncercar substane halucinogene, vibraii care s interferezecuundelecerebrale,darefectullorfuncelmaibuncazridicol. Direciadenaintareeraacumclar,aacTurciaatacprinsurprindere. CumajunserpeteritoriulImperiului,trupelerefuzarsmaiasculteordineleise predar.CuacestprilejfurcuceriteGreciaiTurciaeuropean. Contrar ateptrilor, nu urm Frana, ci Belarus i rile baltice. Apoi Beneluxul, cci Florin se gndi si mai fiarb puin. Acetia, probabil datorit tensiunii nervoase,ncercar un atac disperat cu arme chimice care, normal, eu lamentabil. Romnii unir Danemarca, Suedia, Norvegia i Finlanda. Apoi se ntoarser spre sud, cucerind Marea Britanie i Irlanda. Spaniolii i portughezii primircuentuziasmavioaneleimperiale,iarIslandapropuseuntratatdealian. DupvizitaluiFlorinlaReykjavk,alianasetransformnunirenecondiionat. nFranaavulocoloviturdestat,iarnouaputereproclamintegrarea.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mpratulsurselaaflareavetii.Planulsufuseseduslabunsfrit.Apoi ivenioideeiImperiulcuceriRusia. Americaniisentrebardacnucumvaurmauei,darFlorinsentoarsela BucuretiihotralegerigeneralepentruParlamentulimperial. Era lun plin iar globurile fluorescente mprtiau o lumin albastr, misterioas, pe aleile i printre copacii parcului pustiu. Era linite, i putea auzi inimabtnd.isegndicatmosferaerapotrivit.Seoprideodatiealprivi ntrebtor. tiacevaspuneel,iareltiaceivarspunde.Cutoateacestea,ierafric. ierafricdepasulcedespartecredinadecertitudine.Aveaointuiiebun,totui denenumrateorirenunasesifacpresupunerilecunoscute,deteamadeanu grei.iarfipututdovediastfelcintuiiasanueraattdebunprecumcrezuse? ispusecdeclaraianuarimpresionacuadevratntrolimbstrin,aaci drese glasul i se pregtis vorbeasc. Spaima nui permise s deschid gura. Se gndictrebuiesofac.Obligaiaeliminresponsabilitatea.Zisencet: Rydwindygarudi. Eazmbi,lmngiepeobrazispuse: Iluv,too. Zmbiiel,darobrazulieraacumdoaromascsurztoare,cucolurile guriimpietrite,ridicatentrungeststrindecesimea. Totultrebuiasfieperfect,inuera.Decenaibairspunsesenenglez? Crezuseceradinpartealuidoarunsemndeoriginalitateiirspunsesenfelul eitotoriginal?!Declaraiindoulimbideacum50deani? Porniiealurm. tiecnuecevanregul,ccieamanelesmaibinedecttoi.Darnuo spunedirectpentruciefric.iaaneamntorsdeundeamplecat. Casumplegolul,eavorbea.Lanceputelnufuatent,apoictevacuvinte lizbir: ...luminaastaesteromantic,darnuteaprdecriminali... Ce? Criminali? Ce mai subiect ia putut alege! i nc lumina asta albastrefoartefrumoas.Nicinudainpomi,darnicinutechiorte!Primarula avutielnsfritoideebun.Defapt,dacstauimgndescbine,modaastacu globuri albastre am luato tot de la romni. Ce chestie cu Imperiul! Europa n 6 luni!DardecenumaiEuropa?Euaficuceritlumeantreag.Saupoatecnavea senssmergitriumftorprindeertsaupeHimalaia.23aprilie. iamintisecveneledespreintrareampratuluinCaerdydd. imulimeaipacalaunconcertgar!inimeninutiecesantmplat cuadevrat.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Majoritatea tinerilor, mai ales studeni, ca i el, sprijinea Imperiul. Spre deosebire de generaia anterioar, care dorise independena, dar cu timpul se linitise. Poatenicinuovoiaucuadevrat,poatencercaudoarsdemonstrezec au i ei opiunea lor, c sunt mai inteligeni i mai patrioi dect prinii lor. i cereauindependenaproprie,pecarenuiocontestaudecteinii. Zmbi. Exagerez!ispuse.Darnmare,acelailucrusentmplicutiade azi. Elfceaopinieseparatdemajoritateacolegilorsi,susinndautonomia riiGalilor.Ceeaceeracamciudat,pentruunstudentlalimbaromn. MntrebcumofinrealitateRomnia. i ddu seama deodat c era privit. Pe faa ei era aceeai expresie ntrebtoare,dedataaceastasincer. Ateaptrspuns! Neateniaeraogreealgravntroconversaie. Cemaiconversaie! Seuitnpmnt,ruinat. Aiadormit?lntrebea. Nu. tii. Eraimportant? Astateaputeantrebaieu. Namidee. Ealfixdreptnochiiopti: Aispleci? Da. Cnd? Luni. Eltcuoclipizise: Aismatepi? Nu. tiam. Neamfipotrivit. Sembriarncetnluminaalbastr,plnserisufleteleliseunir. Adouazi,OwainsedusesicumperebiletdetrenpentruBucureti.Ar fipututfoarteuorsifacorezervareprincalculator,dareraunpretextpentru amaivedeancodatprivelitilebinecunoscuteicareerasigurcivorlipsi.Se aezlarnd.AgeniadinCaerdyddmaiaveancvnztoridebileteumaniiar elvislaovremecndsevaintroduceiaicisistemulcompletautomatizat,can
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


unele orae din centru. ns nu trebui s atepte prea mult, cci operaiunea mergeadestulderepede. Bucureti,pentrupoimine,zisescurt,ntinzndtotodatcasierieimicul dreptunghi cu fotografia i numele su, ce reprezenta n acelai timp act de identitateicartedecredit. Tocynunfforddneutocyndychwel?1 Replicangalezisuncaodojan.itotuiaceastaeraodovaddecuraj dinparteaei,fiindcunstrinoputeareclamacnufolosetelimbaoficial. Unffordd2,rspunseel. Femeiaintrodusecartelaidatelencomputer,apoiizise: 3750lew,iawn?3 Daiawn.4 iddunapoidreptunghiulibiletul. Diolch5,maispuseelisendeprt. Se duse la Universitate, ca s rezolve i ultimele formaliti. Secretarul l inform c toate cele necesare fuseser comunicate la Bucureti i c era ateptat pestetreizilencapital.istrnsemnacldurosiiursucces,asigurndulc fcusetotulctputusedebine. Owain mormi ceva n semn de recunotin, fcnduise pur i simplu grea. Pe un culoar se ntlni cu un profesor, care inu si aminteasc ce importanteraobursnRomnia,maialespentruunstudentsrguincioscael. nsui guvernatorul trimisese o scrisoare de felicitare i asta era totui de neles, ccinfiecareandoarosingurpersoandintroprovincieeratrimissstudieze laUniversitateaCentral.inacestanfusesetrimisel.Simindusereprezentant alriiGalilor,voiasfacofigurfrumoas,darhabarnaveacetrebuiasfac pentruasta. nfond,dacieseprost,nusuntvinovateu,ciaceiacaremauales...Hm. Mmintsingur. Se descotorosi i de profesor i prsi campusul. Mai rmnea un singur lucru:petrecereadeadioncinsteaplecriisale,duminicseara. nsfrit,scpaidemine,obinuiaelsspun. Deisegndeadoarlaviitor,fcuunefortireuisseidistreze.Muzica, indispensabil,eranengleziromn.Dupcdereadramaticdelanceputul mileniului, revenirea formaiilor anglofone constituia una din cele mai mari surprize.
Biletdussaudusntors?(gal.) Dus.(gal.) 33750delei,bine?(gal.) 4Foartebine.(gal.) 5Mersi.(gal.)
1 2

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Echiarcurioscumderomniinusauimpusinacestdomeniu. Eraora3iatmosferadevenisemaiintim.Uniidansau,uniivorbeau,unii rdeau. Owain se retrase ntrun col, urmrindui pe ceilali cu atenie i cu o oarecare curiozitate. Ar fi fost interesant s tie ce gndete fiecare i ncerc s ghiceascdupexpresiafeei.icunotea,pemajoritatea,saumaibinespus,credea ci cunoate. Ct de diferii i se preau acum! i se ntreba care fa era cea adevrat:ceadeacumsauceapecareotia,detoatezilele?Saupoateamndou? Lngelveniofat,probabilbeat,ilntreb: Nudansezi? Nu,ziseelpuinrstit,supratcafosttrezitdinvisare. Pcat,spuseeaisendeprt,cltinnduse. Owainicontinuobservaia. Ct de diferit e psihologia grupului fa de psihologia individului! i maialesnmomentecastapoisidaiseama.Petrecereaaudatopentrumine saupentruei?Toisedistreaz... Secorectzmbind: Toiparssedistrezeieustausingurimmnncntruncol!Cesi faci,fiecarefacecepoate...Cemuzicidioat! Boxeleurlau:skizstlbloo/Imnluvw! Nu pot s sufr tehnogeazul! I het teknojaz. Ursc tehnogeazul? Nul ursc, pur i simplu numi place. n englez ura pare superficial, n romn captprofunzime.Ur.Het.Casu. Oumbrsedesprinsensemintunericiseapropie.Erauncoleg,cucare senelegeabine.Owainobservcfumamarihuana.Nularficrezutnstare.Dar la ora aceasta totul era posibil. Faptul l dezamgi, dar n acelai timp ncercun sentimentdesuperioritate. Caprostulcerdecndvedepealtulmaiprostdectel. Umbraseaezalturiiintinseigara. Nu, mersi, zise Owain. Trebuie s m feresc de lucrurile ce miar putea creadependen. Cumcrezi.Daroapnaisrefuzi. Doarnamsstaucauntmpitpndiminea! Nu,namsrefuz. Seduseriiluarcteosticldepeomas.Alcoolulidducurajii venichefdevorb.Sealturarunuigrup,carefceaceamaimultglgie.Din glum n glum, din nghiitur n nghiitur, se amei bine de tot. Avea acum senzaia unei separri ntre creier i trup, cci meninereaechilibrului era totmai dificil, iar membrele i deveniser mai grele. Depunea mai mult efort ca si controlezecorpul,darsedescurcasatisfctor.inuiprearudelocdecefcuse, fiindcsedistraseifiindceraultimaluinoaptenoraulsu.Cuacestegnduri, adormifericitpenitescaune.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


l trezir a doua zi pe la ora 8. Mai nti se ntreb unde se afl, apoi i amintictrebuiasplecelaBucuretichiarndupamiazaaceea.Seridicameit, simindinceputurileuneidureridecap. Se despri de ceilali i se ndrept spre cas. Tatl su i deschise ii spusedinpriviri: Aifcutolat! Owain trecupe lng el i ceru unantinevralgic. iaplic micul ptrel adeziv pe gt, deasupra carotidei, i dup un minut, cnd hrtiua se desprinse, durereadecaperadoaruntrecutnefericit. Bagajelefuseserfcutedinziuaprecedentiarelnutrebuiadectsmai piard vreo cinci ore. Fcu un du, mnc fr chef cteva tartine pe care i le pregtise maicsa i refuz s se mai gndeasc la viitor. Se cert cu sorsa i totulpreacamainainte.Dartoitiaucnuera.Mormi: Doarnumduclamoarte. Darunanetotuidestuldemult. Amsmdescurc. Aveanevoiedencurajriinimeninuiadresaniciuncuvnt.Priveaun pmntdeparcarfifostsupraipeel. Spuneiceva! Etimpulsplecm,optitaicsu. SembrcariseurcarnAGM6.Ajunserlagarcuojumtatedeor nainte de plecare. Se ntlnir pe peron cu o cunotin care urma s ia acelai tren, doar c trebuia s coboare la Londra. Urmar mbririle, suspinele i n sfritreuisseurce. Trenulplecicunotinapropusesmeargnvagonulrestaurant,smai stea de vorba. Se aezar la o mas iar cellalt l ntreb, pe un ton care se voia prietenos: Vaszic,cemaifaci? Cemaifac?Centrebareidioat! Ura aceste trei cuvinte. Cum se putea rspunde? Bine, mersi, ca toi protii.Puteancercasfieoriginal,lundonsenspropriu:mnnc,merg,cnt. Sau un rspuns mai puin ateptat: Ru, m doaren cot! Ce fcea? Nu fcea nimic.Mplictisesc.Staulamas.Tevdpetine.MerglaBucureti.Miegrea detoate. Bine. Mbucur.Nuteammaivzutdejumtatedean. icedac? Amfostocupat.Facultatea,iacumbursaasta...


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


A,da,desigur.SaanunatilaHV7,stii. Fcuopauz,ateptndreplicaluiOwain. Ceaputeaspune? Poateacumnuidaiseama,darastaeorealizarefoarteimportant. Misamaispus.imidauseama. Aaeste. CndajungilaBucureti? Minediminea,la8. Ei,maiaicevademers! Rsesingur.Owainzmbi. EumduclaLondra.tii,afacerile... minchipui! Pesteoorijumtatescapidemine. Sper! Dar nu era aa. Faptul c vorbea cu un cunoscut l linitea. Mai ales c acestasechinuiaslnveseleasc. icefaceilaLondra? CellaltncepusiexpliceiarOwaingndi: Ce prostie i pluralul asta de politee din romn! O singur form de persoanaadouacreeazparcunsentimentdeapropierentreoameni,deundei adresareapenumelemic. ...iapoi,dacamnoroc,mntlnesccuguvernatorulAngliei. Guvernatorulesteenglez,nu? Da,nfiecareprovincieenumitunlocalnic,deinuexistniciolegecu privirelaasta. mpratul numete personal guvernatorii provinciilor. Articolul 17. Sau 19? Credclucrulstaedestulderiscant.Dacarfiguvernatoriromnipeste tot,anelege. Deceriscant? Dac unul, din patriotism local, declar independena provinciei i se proclampreedinte?Arpreferaoameniisrmnntrunimperiustrindects aibproprialorar? Cellaltzmbi: Aparent inexplicabil, nici un guvernator nu a fcut nc aa ceva. Dimpotriv,aputeaspune,icredem,amexperien. Owainridicsprncenelentrebtor. tiidedemonstraiiledinanii30? Amauzit.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


AmfostieulaAberystwythn31.Eraupepuinjumtatedemilionde oameni.VenisertineridintoatCymruideclarasermoraulnafaraImperiului Romn.Atunciavenitguvernatorulssteadevorbacuodelegaiei,ceofivorbit cuei,corganizatoriiaufcutslujiauziscmitingulnumaiavearost.Noiam nceput s fluierm i am rmas n strad. Guvernatorul a venit la tribun i a nceput s ne povesteasc despre unire, nelegere i iubire. Ciudat, numi mai amintescnimicdinceaspus.Darvorbeleluineaumicatichiarmiafostruine cvenisemsfacscandal.Demonstraiaaluatsfrit.Uniisetemeauderepresalii, dar nimeni nu a pit nimic. Nici mcar organizatorii, cci adunarea era, bineneles, ilegal. De atunci au mai fost numeroase proteste, dar nu cred c printreceideacolosemaiaflavreunulcareparticipaselaAberystwyth. Povestea l impresion pe Owain. i totodat l simi pe cellalt mai aproape. Totui,vorbielncet,eutotmaicredcgaleziiartrebuisaibaralor. Hm,tineriideazisuntmaidegrabfavorabiliImperiului! Aae. Dareusuntoriginal. Apoi i aminti zicala: Dac eti original, nu eti original: au fost alii originalinainteata. i mai e ceva. Muli au nvat atunci limba galez i sau apropiat de tradiii.Neamspuscdactotvomfimpreuncualii,mcarsfimdiferiideei. i totui Imperiul respect identitatea naional a fiecrei provincii. Istorie,limbmaterna...Alturideromn,firete. Privi pe fereastr. i plcea s mearg cu vitez. Se uit la ceas: peste jumtatedeorajungeaulaLondra.DomnulWilliams,stulielprobabildeatta politic,schimbsubiectul: Mie mi se face ru, dar tu de ce nai luat avionul? Ai fi ajuns mult mai repede. Mameiierafricdeunaccident.iaaamieuprilejulsvdEuropa peviu. Pn la Londra discutar despre peisaje, clim, diferene de fus orar. La sfrit,cellaltispuse: Ei, deacum trebuie s cobor. Succes i toate cele bune! i m bucur c nuimaiestefric. Luatprinsurprindere,Owainreplic: Cefric? Williamszmbiizise: Cndneamurcatntrenitremurauminile.Acumiatrecut. Dreptrspuns,minilesemicarinvoluntar.Izbucniramndoinrs,i strnserminileiWilliamscobor.Owainsedusencompartimentulsu.Seuit pegeam,citiocarteilaurmlcuprinsesomnul.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


i vis. Era ntro pia mare iar AGMurile zburau pe lng el. Ceilali oameni se plimbau linitii, nednd importan faptului. ti c ar putea fi lovit, dar nu se sinchisi nici el prea mult. Deodat, cineva i puse mna pe umr. Se ntoarse brusc i vzu c era Florin I, primul mprat. Nu spuse nimic, atept. Cellaltizise: Al9leaarenumrul999. Dece? Enecesar. Eltie? Eleste. Owain gndi c ar trebui s in minte aceast informaie, dar totodat simi o zguduitur i se trezi. Era n compartimentul su, n pat, dar vagonul se lsaprimejdiosdemultntroparte.Apsunbutondelngmnasadreaptai fereastradevenitransparent.Trenulluaocurbpericuloas,nclinndusespreo valeabrupt.Fricaiinvadtrupul.Deodat,vagonulsecltiniserostogolin hu.DarOwainnusimidurerecndpereiilizbir,cidoarteroare.Aveatrupul despaim.Vagonulajunsejosielsemircmaiestenvia.Stndnpicioarepe ceeacenaintefuseseplafonul,FlorinIlprivealinitit. iaminteti? Owain i ddu seama c uitase. Fcu un efort i mesajul i se limpezi n minte.Totodat,iapruclarfaptulcncviseaz.idorissetrezeasc,darnu reui.Cellaltlpriveacalmncontinuare. Era acas, era n clasa a noua i era n vacan. Se uita la holovizor n sufragerie.Deodat,ntoarsecapulilvzupeFlorinInu.Seridicnpicioare. Decetotfugi? Owainezit.Poatenuivoiarul. Trebuiesiimintetotul. Dininstinct,serepezilapoart.Darpoartanusedeschidea.Nuavearost s priveasc n urm, pentru c l simea pe cellalt apropiinduse. Sri gardul i porningoanpestrad. Era ntrun loc ciudat. n jurul su se ridicau numai blocuri. nalte. Se ntoarse i vzu pe unde ajunsese aici: o alee ngust, dincolo de care se putea vedeastradaprincipal.CueleraiMyfanwy,abiaacumobserv. Vreisispunopoveste? Vreau. Eraozicanicular... Ctcostoareziarulsta?lntrerupsefata. Owainsesimijignitinurspunse.Ateptsfierugatscontinue. Spunemaideparte,zisengnduratMyfanwy. Eraozicanicularipestraderaoaglomeraiengrozitoare.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Acumeraelnsuipestrada,nghesuinduseprintreceilali.Nutiaexact unde merge, dar tia c nu trebuie s se opreasc. De la o vreme, observ c oamenii se mpuinau. Era mai bine aa. Dar numrul lor scdea vertiginos, iar Owain nui ddea seama unde intrau sau unde dispreau. Strzile devenir pustii. O lu pe o alee ngust i ajunse ntrun loc ciudat, complet nconjurat de blocurinalte.Mersectevazecidemetri,apoiseoprindreptuluneiuiiintr. Trebuiasajungsus.Vzuliftul,cuuannegritdevremeitencuialaczutn jur.Alturiseaflaunbrbatnecunoscut,carevoiaielsurce,darnuputea.i pierdusesperana.Owainapspebuton,darliftulnuveni.lcuprinseostarede moleeal,probabilidincauzacldurii.ncercsurcepescri,dardupprima treaptobosiiddunapoisseodihneasc.Atept,nicielnutiabinect,pn cnd n bloc intr un btrn, mergnd ncet, cu greutate. Liftul tot nu venea iar Owainnicinulmaiatepta.Btrnulncepusurcescrilecugrij.Dupuntimp, ncercielacelailucru.Dedataaceasta,reui.Ajunsenfaaunuiapartamenti ncercua.Eradeschis.Myfanwylcondusensufragerie,undeeraumaimuli oameniadunainjurulmesei,carelpriveaupoate,dareliinuochiinpmnt. Era transpirat i obosit. Le ntoarse spatele i se duse s se spele pe faa. Apa i fcearu,aveaimpresiacsevaneca,clichidulincoloriintrannasmpotriva voineisale,simeanepturingat.nciudasenzaieineplcute,fcuuneforti reuistermine. Setreziifuconvinscvisaseopovestirepecareocitisesauoauzise,apoi idduseamacapartamentulacelaeraproprialuicas.Sespericumplit. Deschise ochii, auzindui inima btnd nebunete. Simi furnicturi pe cap i se ntreb dac nu cumva ia albit prul datorita spaimei. Apoi se mai dezmetici i ncepu si aminteasc despre cltoria cu trenul, de bursa la Bucureti... Cumpottisiguracumdacdormsausunttreaz? Erasigurcetreaz. Cediferenestentrevisirealitate,attatimpctvisulpareadevrati realitateaparecteodatimposibil? Meditctevaclipeiapoirspunse: Cuvntulcheienafirmaiaastaestepare.itotuirealitateaecaunvis. Unviscarearenscontinuitate. ntinsemnaiaprinselumina.ipriviceasul,constatndcera7:24,ora Bucuretiului.Sentinseirealizcvaajungenmaipuindejumtatedeor.Fu cuprinsiardeemoie.Maiapsunntreruptorifereastrantunecatselimpezi, devenind transparent. Avu un sentiment ciudat, c toate acestea i se mai ntmplaserodat. Darvzusoarelerocat,ridicatabiacuopalmdeasupraorizontuluiise apropie de geam fascinat. Zri n deprtare munii acoperii de zpad i l strbtuunfior.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cefrumusee! Obiectele maiapropiate abiase puteau distingedatorit vitezei,dar totul era alb, lucind n lumina dimineii. Din cnd n cnd l fulgerau sclipiri att de scurte nct nici nui ddea bine seama dac erau reale sau se gseau numai n nchipuireasa. Difraciarazelorsolarenpereiibarajuluideprotecie... Pentru a preveni eventualele accidente, dat fiind viteza medie de 300 km/hatrenurilorantigravitice,liniileerauprotejatenadevratetuneledeplastic extradur,transparent,numitebarajedeprotecie. Observ c munii se ndeprtau, treptattreptat, dealurile fcnd loc cmpiei.Privinjosivzuliniiledeghidajramificnduse,semnctrenultrecea printro staie important. Nu avu timp s priveasc cldirea grii, cci liniile se contopirdinnounceledousensuriprincipale. Soarele parc se mai nlase pe cer i era acum prea strlucitor pentru a putea fi privit direct. Cmpiile, un amestec de alb i negru, la viteza aceasta apreauntonurigriciudate. Deodat,dindifuzorrsununiuit,dupcareovoceplcutanun: n 10 minute vom ajunge n Bucureti. Sperm c ai avut o cltorie frumoasicveiapelaulteriorlaserviciilenoastre.Vdorimozibun! Owainnuschiniciungest,privindncontinuarepeisajul.Dupuntimp aprurscnteintunecatedecldiriivitezancepusscad.Cndtrenulseopri, ipriviceasul:7:47.Ajunsese. i deodat i veni ru. Inima voia parc si sparg pieptul, se sufoca, ameea i se simea cuprins de o spaim paralizant. Totul nu inu dect cteva clipeidisprulafeldebruscprecumapruse.Doarostaregeneraldeoboseal stteamartorcelorntmplate. Cenaibaafostasta?sentrebaOwain.Numaipiseaacevaniciodat. ns hotr c nu era momentul si fac griji i se grbi s coboare. Un reprezentantalUniversitiitrebuiaslatepteislconduclahotel.Ateptpe peron ca mulimea noucobort s se mprtie, apoi i roti ochii, cutnd vreo inscripie care si aminteasc numele. Nu gsi nimic, i dup cinci minute se pregti dezamgit s prseasc gara. Deodat privirea i czu pe holoscrinul biroului de informaii: literele roii, rotinduse n jurul axei verticale, formau un singurcuvnt:CROESO8. Izbucninrs: Vaszicnumauuitat! Seapropieivorbinmicrofon: SuntOwainL. Dreptrspuns,ovocedrguispuse:


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Introduceicarteladeidentificare! Secutneglijentprinbuzunare,nsnuogsi. ArficulmeasofiuitatnCaerdydd!iziseel. Cutdinnouidegeteleintlnirosuprafadreptunghiularneted. Abia acum i ddu seama ce speriat fusese. nchise ochii un moment ii inu respiraia,repetndui: Trebuie s m linitesc. Dac mi fac snge ru din orice, unde o s ajung? Vrcartelanfant,mainriaocitiiionapoie. Vmulumescpentrunelegere.Aveiunpachet. O u se deschise n stnga sa. Owain intr. Cteva sgei luminoase i indicaudrumul.Ajunsentroncpereplinadedulapuriautomateaezatelng perei.Numrulseifului2304clipea,invitndul.Introdusedinnoucartelaiuia se deschise. nuntru vzu un aparat care aducea la prima vedere cu un miniholovizor.Deasupraluieraunbilet: Bun!Hartatevaconduce.Succes! Nueradelocceseateptase.Eraobositinuiardeadejoac.Luhartai o aprinse. Pe ecran era indicat poziia sa actual, n gar, precum i locul unde trebuia s ajung, totul suprapus peste un plan al Bucuretiului. Mri suprafaa destinaie,memorstradaigndi: Doarnucredeaicosmergpejos.Ceiasta?Orientareturistic? Iei repede din ncpere i apoi din gar, se urc ntrun taxi ii zise oferuluiadresa.Acestaomarcncomputeruldebordiporni.CndAGMulse ridicdelapmntpentruasenscrientrafic,luiOwainisentunecprivireai lumea ncepu s se roteasc n jurul su. Se sufoca, i era grea, dar mai ales groaz.Ogroazanimalic,frunobiectprecis.Urlfrvoie,isimicoardele vocalevibrnd,darnuauzinimic.Spaimaintunericullcopleeau.Dupanide agonie,ceaaneagrserisipiincetulcuncetul,totulrevenilanormal. Ridicochiiilvzupeoferntorspestescaun,privindulcumilsaucu repulsie. Nar trebui s mai faci acte dn astea d eroism. Unii chiar au murit, credem,tiucespun.Nuinicioruinesfiiparautist,astae,naiceiface.Dar amauzitcsuntnitemedicamente,casdiminueziefectele.Narstricasncerci itu! Acesteafiindspuse,oferulrevenicufaasprepupitruiapsunbuton, deschiznd portiera din dreapta tnrului, care cobor nucit i ddu trei pai napoi,privindngol.Dinneatenie,eractpecesscapeiharta,daroapucn ultimulmoment. Nuinicioruinesfiiparautist. Deacord,numaicelnueraaaceva.Parautismerauntermenargotic pentruantigravitofobie.nvasedespreaceastboala.Aproapetoatemijloacele
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


de transport foloseau suspensia gravitic i majoritatea oamenilor cltorea fr probleme. Dar antigravitonii puteau afecta sistemul nervos al persoanelor cu o sensibilitate ridicat, care erau astfel condamnate s foloseasc doar mijloace de transport tradiionale, foarte greu de gsit, avnd n vedere numrul restrns al parautitilor. Chiar i o banal biciclet folosea un mecanism gravitic pentru meninereaechilibrului. DarOwainnusegndealaacestgendeprobleme.Nuputearealizacum plecase din Caerdydd perfect sntos vizita medicala o dovedea i se mbolnvisesubitlaBucureti.iamintideataculdintrenisentrebceanumel provocase. Trenulsaopritiapoimaapucat.Dacsarfintmplatlaplecare,mai nelegeam,daraa? Rspunsulivenibrusc: Miavenitrucndsaopritsuspensia!Darnaresens!Nimicnaresens! Undenaibamaflu? i dori s viseze toate acestea, dar ti c era adevrat. Porni cu harta ntromnicugeantancealalt,ocolindstrziciudate,mergndmecanic,fr niciungnd. Ajunselngocldirecupatruetaje,cuinscripiaCminB7. ieumateptamlahotel. lcuprinseostaredefurieaproapenecontrolat,ivenistrnteascharta issentoarcacascuprimulavion. Darnumaipotsmergcuavionul!Suntnchisnoraulstablestemat! Nuiveniscreadcsepoatentmplaaaceva.Cisepoatentmpla. Simea nevoia s vorbeasc cu cineva. Se apropie de u: era nchis. Introduse ntro fant cartela i intr. n dreapta vzu un holoscrin cu planul cldirii i mesajul: Avei camera 9. Era la etajul 2. Se uita de jur mprejur dup lift nici pomeneal.Pornipescri. Deacumntmpleseorice! Deodat i aminti visul. Urcase pe scri i Myfanwy i deschisese. Ar fi vrutsfieieaaici.Seoprinfaauiiiapoiintrcuajutorulcartelei.ncamer erau cinci paturii cinci birouri. La dou dintre acesteastteaudoi tineri cam de vrstalui,cunasulnparbrizelecomputerelor. Doarnuseputeasstausingurncamer. Unuldineilobserviifcusemnceluilalt: Uite,deacumseadun! Owain arunc harta i geanta pe un pat i le strnse minile, prezentnduse.PeceidoiichemaDaniGicu. Doiromni.Perfect.Mailipseteuncutremur. iscoasepaltonulipantofiiisetrntipeunpat.iurmareapeceidoi, carejucauah.GicuintinseocapcanluiDan,iaracestanuobserv.Caurmare,
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


i pierdu regina i se recunoscu nvins. Owain avu impresia c nu era nc totul pierdut.SeapropiedeeiimormindirecialuiDan: Azicecmaipoiscoateremiz. Acestaseridicadepescaun,invitndul: Da?Cum? Se aez i continuar partida. Fcur fiecare cte ase mutri, iar Owain credea c relansase situaia. Peste nc dou mutri, Gicu i ddu ah mat. Nu se ateptaselaaaceva. Amczutncurs! Gicu l ndemn s revad poziiile anterioare, explicndui ce i cnd greise. Dinpoziiainiialputeaichiarsmbai.Daraici... Acinceamutare. ...teamprins. Gicu riscasenebunete,iar Owain nuobservase nimic. Dacarfi fcuto, iarfidatmatntreimutri. Aae,recunoscugalezulizmbi. Ceidoizmbiriei. ntotdeaunajociaapericulos? Cinenuriscnuctig. naceaclipa,uaseddulaoparteiaprualpatrulea.Seholb,numr paturileitraseconcluzia: Casdenebuni. i arunc bagajele pe jos i ntoarse capul spre ceilali, care l priveau amuzai. Cicsuntemcolegidecamer!sezburliel. Nimeninuspusenimic,continuauszmbeasc. Naveigur?EusuntTom.Englez. Owainiputusedaseamadupaccent. Gicu.Romn. Dan.Lafel. Owain.Galez. Galez?Atuncisuntemvecini.miparebine.Spersnenelegem. Da. Tomsefcucomodipovestidespreavionulcarentrziaseitaxiulcare se prbuise. ntradevr, Owain observ dou zgrieturi mici n partea stng a frunii.Simiunimboldputernicdealevorbidespreceisentmplaselui,darse abinu. Vdcsuntcincipaturi,adaugapoienglezul.Cinemaitrebuiesvin? Ridicardinumeri.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Urm o plictiseal teribil pentru Owain: toi ncepur si aminteasc despre locurile de unde erau, de prieteni i de pasiuni: sportul, jocurile pe calculator...IarTomzmbiinsinuant: Doarnuaveinumaiprieteni! DaniGicuizbucnirnrs,maidegrabunrsforat,iarapoiistorisir feldefeldeaventuri,maimultsaumaipuincredibile.ivenirndulluiOwain, carepovestidesprearaGalilor,deMyfanwyidespreAGF9. Dupexpresiafeelor,idduseamacnuecrezutdectpejumtate. Totatatdemultctiamcrezutieupeei.Suspiciunedeprotecie.Cine spunetotdeaunaadevrulnuetotdeaunacrezut. Ajunserssecunoascamaibine.ipelaora2,nmijloculdiscuiei,sosii ultimul. l chema Branko i era din Macedonia. Spre deosebire de ceilali, el se art mai rezervat i nu pru prea interesat de eventuale confesiuni. Dar fu acceptat,pentrucnuaveaudeales. Pe la ora 6, dup ce mncar la restaurantul cldirii, primir un mesaj computerizatdelaadministraie,princareleeraaduslacunotinregulamentul interioralcminuluiimodulcumputeauajungelaUniversitate. Owainntreb: Metroulfoloseteielsuspensiagravitic,nu? Normal,rspunseGicu. Atuncicumosmergeuacolo? Tointoarsercapulsprednsul,privindulatent.Eraoproblem. Tomspuse: Defapt,ceeboalaasta? Nicieunutiuprecis.ivinerucndintrincontactcuantigravitonii. Practic,nupoiclatori. Seuitlafiecarenparte.Nunelegeaucompletcensemnaasta.Niciel nunelegea,dealtfel. Brankovorbi: Miam amintit c am acas o biciclet veche, cu care m trgeam cnd erammic.Mrog,nuchiarmic...Maitrebuieridicateauaighidonul,darcredc teaidescurca. Darnuauibicicletelesistemedeechilibru?ziseTom. Sentoarsesprecellalt.Deacestrspunsputeadepindeviitorulsu. Bada,darstaeunmodelclasic. Cenoroc! Owainrmasefrgrai,nemaiavndputereanicimcarsmulumeasc. Brankocontinu,adresnduisededataaceastagalezului:


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Eu am venit cu AGMul. Dac vrei, m pot duce acas smbt, s io aduc. Dacvreau?Bineneles!Cemafifcutfrtine? Tominterveni: Totui,artrebuisteducilaundoctor! Am s m duc. Dar pn sptmna viitoare ce fac? Merg pe jos? Trei staiidemetrou? Rspunsul nu putea fi dect afirmativ. i cu asta, trecur la lucruri mai importante. Englezul propuse o mic plimbare, ca s vad locurile. Toi acceptar, n afara de Branko, care se duse s se uite la holovizor. Abia acum Owain observ cele do ui, parc nadins mascate n perete. Una ddea spre sufragerie i una spre baie. I se pru ciudat c intrarea era prin dormitor, dar nvasesnusemaimiredenimic. ntimpulplimbrii,ncercsseimpunnfaacelorlali,darTomerao concuren puternic. Galezul era adeptul principiului Nici o btlie nu e pierdutdinainte.OdatceplecasedinCaerdydd,pentruelncepuseaproapeo vianou.Trebuiadecisfacoprimimpresiectmaibun.i,nparte,reui. Sentoarserpelamiezulnopii,obosiidarveseliiseculcar,englezul remarcndcemairudectnpucriileamericane. Owainerantrostaredesemicontien,nudormeadarnicinueratreaz. nstiacviseazcndapruFlorinI.Dedataaceastapreatristispuse,frs iseadresezedirect,frnicimcarslpriveasc: Mamnelat?Nusepoate? Aceste cuvinte l micar pentru c tia c dezamgise, c spulberase speranele puse n el. Plnse, i apoi vzu locul dintre blocuri, scrile i pe Myfanwy.Darceafostnainte?TomspuneaFugideaici!,pentrucnulcredea. Darmpratullntrebadecefuge.Deamintire.Care?Eleste.Eltie?Enecesar. Dece?Al9leaarenumrul999. Owainsetrezibrusc. Censeamnasta?Cereprezintnumrul9? Meditlasemnificaiaacestuia,darnuajunselanicioconcluzie.Deodat idduseamacnuimaierasomn,cnumaiputeaadormi.Seuitlaceasulde la mn: cifrele fosforescente artau ora 2. Se enerv. Voia s se liniteasc, se ntoarsepespate,apoidinnoupeburtincercsnusemaigndeasclanimic. Cuvinte i idei disparate i treceau prin minte, dar nu le ddu atenie. Nu vis nimic. Alarma l trezi la 6, pentru c la 8 trebuia s fie la Universitate. Aprinse luminaivzuctoipatrusefoirnervoi,mormind.Zmbi,simindooarecare satisfaciecisculasecuoormaidevreme.Sespl,sembrcisepregtis plece. Nevedemlafacultate!urelbinedispusiarceilaligemurexasperai.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cearfisiesfrsstinglumina?iziseiiimagincamceefectar aveaaaofaptsadic. Ddu un pumn n ntreruptor i iei rznd. Apoi i aminti ceva, se ntoarseiluhartacomputerizat,privinduicumsechinuie. Viermilor! Holul era pustiu, strzile erau pustii iar soarele rsrea. Universitatea prea pe hart destul de departe, dar Owain nu se grbea. Mergea ncet, uitnduse la cldiri, la holofirme i la AGMurile care treceau din timp n timp. Mesajele luminoase aparineau unor societi imperiale, dar i unora strine japoneze, coreene sau americane. Relaiile Imperiului cu celelalte ri fuseser restabilite n totalitate abia n urm cu treizeci de ani, dar firmele acestora reprezentauoconcurenserioaspentruceleautohtone. Galezulnsnusegndealaintrigilepoliticesaueconomice,cieracucerit defrumuseeastrinalocurilor.iddeaseamacncepeultimulandestudiu, darcontrarateptrilor,numaiavuemoii.Sesimeancreztorpentrucsoarele strluceaicerulerasenininimicrunuputeassemaintmple. Suntfericit,suntnorocos,suntliber! Peicipecolo,urmedezpadsetopeauvzndcuochiisubrazeledince ncemaicalde. Ajunsela7ijumtate.Pesteunsfertdeorsosiricolegiisidecamer. La8,rectorulidecanulinurcteundiscurs,caredeabiasenelegeadincauza zgomotului de fond. Situaia putea fi descris printrun singur cuvnt: mbulzeal. Cnd terminar de vorbit, toi ncepur s aplaude frenetic i s fluiere,deinuauziseraproapenimic. Furapoimpriingrupeiceicinciaflarcnueraunumaicolegide camer. Fcur cunotin i cu ceilali zece, tot din provincii diferite: nc doi romni,unalbanez,oislandez,unneam,oitalianc... Toiseprezentar,darOwainnusechinuislereinnumele,pentruc oricum avea s le nvee pe parcurs. Tom propuse s mearg s serbeze evenimentul i aa fcur. Se strnser n jurul unei mese mai lungi, pus acolo parcspecialpentruei. Camnghesuii,darmerge. Englezulspuse: Euvamchemat,euvambt! i comand cte o bere pentru fiecare. Apoi ncepu seria poantelor iar Owainrsempreuncuceilali.Aduseielctevacompletriiiprimiporiade rsete. Se prea c totul decurgea bine, dar spre sfrit, cnd bieii mai luaser cte o ap, ca s arate ce viteji sunt, Andreas, olandezul, scoase un pachet de Marihaiiservi.Tom,caresttealngel,ludouigrideodatilebgn gur. Conform ateptrilor, toi nechezar satisfcui. Pachetul trecu din mn n mn,darcndajunselaOwain,acestalpasfrsiavreoigar.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hai,iaitu,ziseLucian,unromndelastngagalezului. Nu,mulumesc.Nuvreausfumez. Haib,ia,cnainicipedracu.Ia! Owaineranshotrt,nimicnuiarfipututschimbadecizia.ijurases nupunniciodatvreoigarngurinueraaceastaosituaiecareslfacsi calce cuvntul. Atepta rbdtor s se termine cu rugminile. n definitiv, de ce attainsisten?Trebuiasseconformezeielgrupului? Haib,nuvezicifeteleauluat?Parcnaiaveavnntine.Scumpetea mamiinuvrea!lmaimuriromnul. Owain zmbi i ls privirea n jos. Insulta trecu prin el fr si pricinuiascniciunru.Eraoncercarejosnicicuattmaiinutil. nsLuciannupreassepotoleasciarTominterveniferm: Laslnpace!Nuvrea,nuvrea.Etreabalui. Romnultcuumilit,probabilnjurnduingndpetoi. Dupacestactdeostilitate,fumarnlinite,nimeninendrznindsmai zicceva.Owainiprivipefiecarenparte,darnimeninuaveacurajulsseuiten ochiilui,fixndinvariabilsticladeberedinfa. Credceusuntsingurulcarenusasuprat!gndigalezul. Terminardefumatinumaitiurcesfac.Preautoimaidestinii mai vistori i Owain nu tia dac drogul ncepuse si fac deja efectul sau era numaioimpresieasa. Italianca, Gina, spuse, mai mult n direcia lui Tom, recunoscut oarecum dreptef: HaisvedemParculUnirii! Era ceva ce trebuia neaprat vzutnBucureti. Toi aprobar,poate mai multdindorinadeascpadinsituaiajenant. Andrei era din capital i le explic modul cum puteau ajunge. Se ndreptarngrupsprestaiademetrouaUniversitii. OwainuitasedeAGF,prnduisedoarunepisoddintrunvisurt.Dar cnd metroul trecu pe lng el n staie, ncerc o nelinite ciudat, care sar fi transformat foarte uor n groaz. i privi cum se urc, uile se nchiser i el rmasesingurpeperon,cuhartaelectronicnmnadreapt. Deodatauziovocenspate: Discuimaibinecndsuntmaipuini. Accentslav! Sentoarse:eraBranko. Cumdenuteaiduscuei? Numi place aglomeraia i apoi mam gndit c tu nu poi merge cu metroul. DarnaivenitcuAGMul? Nu.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Dece? Brankoridicdinumeri: Aa. Avrutsmeargcuceilali. Ieirdinstaieiseplimbar,vizitndmagazineleicomparndpreurile cuaceleadeacas. Pe la ora 2, nfometai, se ntoarser la cmin i mncar la restaurant. Apoiurcarncamera9. Owainvorbicupriniiprincomputer,apoiitransferfiierelepersonale nbancadedateaUniversitii,pentruaaveaaccesmairapid.nconvorbireacuai sinumenionnimicdeAGF,doardecondiiiledecazareicolegi. Cnd termin, Branko era preocupat s realizeze un program. Galezul l ntrebceface. Virui.Pnacumtoiaufostanihilaidecomputerulmeupersonal.Doar 3auscpat,astaacas,nMacedonia,dariaterminatcontrolerulcartieruluiiam maiipltitamenda5000deleipentrufiecare.Darntroziamsreuescstrimit unulpnlaunnivelsuperioriatuncisteii. Vorbea cu ndrjire i n tot acest timp degetele i zburau pe tastatur. Prea c terminase, fcu o copie de siguran sub un alt nume i apoi rul programul. n holoscrin aprur litere roii clipind: ACEST PROGRAM ESTE PERICULOSPENTRUSIGURANASISTEMULUI. Brankoapsscrbitotasticomputerulzise: ProgramulDivizorafostters. Haisiartochestie!spusemacedoneanul.Acumetindirectoruldela Universitate? Suntndirectorulmeu. Darnuceldeacas,celdeaici,nu? Da. Imaginea tridimensional prezenta n prim plan pe un fond albastru deschis un paralelipiped galben, pe care scria cu negru OWAIN. Se apropi, folosindsgeiletastaturii.Cutiuasedeschiseielczunoceanulglbui.Deodat coninutulholoscrinuluiseschimb:fondulredevenialbastruiputeavedeaacum dispusenspaiualtezecesubdirectoare. Cumtecheam?ntrebBranko. Owain!rspunseacestamirat. imaicum? Llyn.LLYN.Adiclac. Zmbiramndoi. Monitorul celuilalt prezenta un meniu ciudat, bidimensional, probabil al unuiprogrampropriu.Introdusenumeleiapoidiferitecomenzinmacedonean. Aprurctevavariante,dincareBrankooalesepeprima.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Acumsteii! Poateareuntic. AinumrulROM.BUC.UNI.239. Aae!Darlamaflatabiaazi.ieraieldefa,deciputeaslvad. iparola...nivnavge?Cenaibaiasta? nciudapronunieistlcite,aveadreptate. Astanuamaivzuto! Gwanwym,adicprimvar,scrisinvers. Am remarcat un lucru: majoritatea oamenilor aleg parolele n limba matern, dei n mod normal folosesc romna. Aa... i acum pot sti intru n director... Owain, fr s ating nici o tast, privi cum perspectiva se modific, plonjndnPERSONAL. Holoscrinul era plin de cutiue albe, reprezentnd fiierele. Deodat i fcuapariiaunaroz,protejat.Imagineaseapropideeaipestectevamomente galezul putea citi mesajul albclipitor, ce se rotea n jurul axului orizontal: SALUTRIDELABRANKO! intoarsecapulnmrmurit.Nuvzusenviaaluiaaodemonstraiede for.Macedoneanul l privea, abiaabinnduse snu rd. Owain voisspun ceva,dartoategndurileisenvlmeauncap.ntruntrziu,vorbi: Purisimplununelegdecenuteaifcutinformatician! tiicareescopulmeu?SspargarhivelesecretealeImperiului! Galezultreceadinocnoc.Declaraiaarfipututficonsideratoglum bun,dareradeajunsspriveascfigurahotrtaceluilaltisalutuldepeecran. imispuiaa,nfa. Decenu?Aismdenuni? Binenelescnu!Darpoiaveancredere? Ceaidacnaincredere? Tcuramndoictevaclipe. Tot nu neleg de ce ai ales limba romn! Trebuia s intri n poliie, armat...Cred! Banu.Mamgnditserios!tiicumeorganizatsistemulinformatic? nmare. Bun. Dar tiai c arhivele sunt doar la nivelul Romniei, fr controler suplimentar? Deundestiuasta? Dacalegeamaltceva,continuBranko,afiavutansemarisrmnn Macedonia. Atunci a fi fost nevoit s trec i de controlerul provinciei, cel mai puternic,pelngcelelalte.PracticBucuretiulenvrfulpiramideiiedeajunss vii aici ca s ai acces mai uor la informaiile secrete, pentru c de cartier i de sector nu e imposibil s scapi. Numi dau seama cum au trecut cu vederea aa
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ceva.BancadedateaServiciuluiSecretepeacelaiplancuaceeaaUniversitii. M rog, cu tot felul de subprotecii idioate. S revin la ntrebare. Studenii la romnsunttrimiilaBucureti,deasta! Darcumputeaistiisigurdacveifiprintreei?Doarnai... Owainsengrozi.Brankoizbucnintrunhohotders: ...modificatnotele?Sigurcnu!Nutiivorba:Agreieomenete,darca sncurcicompletlucrurileainevoiedeuncalculator?Ceaispunedacaajunge efdepromoie? Galezulzmbi.ieracomplice?ieratovar?ieraprieten? icuceteajutdacintrinarhive? Dumanultrebuiecuceritdininterior! LuiOwainacestecuvintenuisunarbine.Deivoiaautonomiaprovinciei sale, nu se gndise niciodat la Imperiu ca la un duman. Aproape nimeni nu folosea denumirea complet de Imperiu Romn, aa c fiecare i nchipuia c este i Imperiul su, indiferent de originea etnic. Toi aveau cetenie imperial, dei n cartela de identificare erau menionate i naionalitatea sau provincia de reziden. M rog, asta mai trziu, zise Branko. Acum, c tot suntem n domeniu, siartomecheriepentrucareaputeaficurat. O persoan ce dovedea antisociabilitate era supus unor edine de hipnoz pentru a fi adus pe calea cea bun. n cazul macedoneanului, i sar fi recomandat s uite cum se folosete un calculator n scopuri necomerciale. Apoi sarfintorsfericitlaUniversitatesstudiezelimbaromn. DmiCI10ultu! Owainbgmnanbuzunariiontinse.Brankooluiointrodusen computerulsu.Galezulsesperi: Cenaibavreisfaci? Ateapt. Macedoneanul era tot n directorul su, dar acum impunea o micare ascendent,deoarece se ndrepta spre nivelurile superioare. Iei deci pe rnd din PERSONAL, OWAIN, ROMN i UNIV. n holoscrin erau n acest momentnumaidoucutiue:unaaUniversitiiiunaintitulatGENERALE. Dacamaveadrepturi,leamvedeaipecelelalte. Intrncutiadinstnga,apoinCONTROL. Toatefiiereleerauroz:nuseputeauterge,fiinddeuzgeneral.Brankose ndreptspreIdentif. Computerulciticartelaipemonitoraprurfotografiabidimensionala lui Owain, amprentele, data naterii, adresa i contul, alturi de fel de fel de parametriciudai.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ceteholbeziaa? Eprimaoarcndvdasta. Brankontoarsecapulilprivicapeunanalfabet. Artrebuisfiimaicurios!iacum...vreisifacunCIfals?Cuunmilion ncont? Astaepreadetot. Chiarterog. M ntreb ce gndetiacum. Sl las pe prost s ncerce, c tot degeaba ncearcsaustaenstaredeorice?Daceprimavariant,adicncercio iaunochi,stiicacumsuntnsistemsubnumeletu. PeOwainltrecuunfior. Darlas,csuntbiatdetreab. Cu un gest brusc i reset calculatorul i apoi intr sub nume propriu. Imagineadinfaagalezuluirmaseneschimbat. NupoimodificadirectCIul,darpoicopiainformaiilepeoaltcartel, iaicileschimbidupplac.incceva:funciilecalculatoruluinuauefectnacest caz,asactrebuieslnelimainticeodischetobinuit. Rulunprogramdeallui,introdusencomputeronoucarteliapso tast. Pe ecran apru: ACEST PROGRAM ESTE PERICULOS PENTRU SIGURANA SISTEMULUI. Branko rmase cu gura cscat, nevenindui s cread.Apoiizbicupumnulntastatur,njurndprintredini. ProgramulBRCI13afostters. Macedoneanullprivinochi. Suntuntmpit.Trebuieslfacmaibun. Galezul nu se ndoia o clip c va reui. Cellalt ntinse mna stng, scondceledoucarteleiioaruncpeaceeacufotografie. Scuzm, poate par penibil, dar de ce miai artat toate astea? Tocmai mie. Pentrucsuntnebun. IarOwainnuiputudaseamadacvorbiselapropriusaulafigurat. Peste doua ore se ntoarseri ceilali3. Gicu ntreb vesel, frsi pese derspuns: Decenaivenitivoi?Afostverdedetot! Brankonicinullunseamiargalezulntoarsecapulscrbit. ipnselssearanusemaintmplnimicdeosebit.DarDanpropuse sseuitelaholovizor,nsufragerie.Sepregtirsialocncele5fotoliidinfaa paralelipipeduluimat,darTomzise: Ow,asteasuntscaunegravitice! Pentru ai demonstra afirmaia, el se trnti n cel din mijloc, iar partea superioarafotoliuluiselsbruscnjos,revenindapoincetlanormal. icevreisfac?gndigalezul.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Emisiunile HV erau transmise prin reeaua global de date i puteau fi urmriteipecalculator,nsholovizoarelededicateaveauocalitatemaibunde redare. Sedusendormitor,cugndulsiiaunscaundelabirou,darobservc acesta nu se mica dect pe orizontal, orice ncercare de al ridica de pe podea soldndusecuuneec. Owainrenunilprivilung,imaginnduilachiue. Iatcumozinceputbineseterminprost. Nuimairmneaudectdousoluii:sseculcesaussteapeduumea. Lapicioarelelor! Darnuierasomn,aacoalesepeceadinurm. Cepeisajminunat!Unscaunliberieupejos. n afar de poziia incomod, galezul era cuprins i de un sentiment de inferioritate,pentrucnivelullapropriualcelorlalieramairidicat. Urmrir un film american, cu adevrat mizerabil dup prerea lui, dar ceilalinupreaupreaafectai. Unactor,ccinuputeafinumitpersonaj,fcuopoantiarTomizbucnin rs. Chicotir apoi Gicu, Dan i Branko. Galezului i se fcu pur i simplu grea, pentru c ideea lui de glum era cu totul diferit de ceea ce se ntmpla n holoscrin. Totui nu se ridic, pentru c nu voia s se separe att de repede de ceilali. Filmulseterminiseculcarcutoii,darOwainreflectuntimpasupra ultimelorevenimente.Ajunselaconcluziacexagerase,nsaceeatotnuputeafi consideratanecdot.Deodat,sensulisedeschisenminteiarelizbucninrs,de unulsingur.Danlntrebprinntunericceeste,ielrspunsecnimic.Avuunele mustrridecontiin,darnfinalselinitiiadormi. Adouazi,alarmaltrezidevreme.Oopriisentoarsepeparteacealalt. itiacolegiidegrupiorarul,decipnsptmnaviitoarenumaitrebuias deapelafacultate. Azimducladoctor!ispuseiinimancepusibatmairepede. nsuiconceptuldemedicinlfceassesimtru.Defapt,mairu.Dar nuaveancotro.Doreastiemcardespreceeravorba. nchiseochiiiiimpusesseculcelaloc,fiindncdevreme.i,contrar ateptrilorsale,reui. Se detept din nou pe la 10. Se ridic n capul oaselor i observ c era singurncamer.Descopericaveaunmesajpecomputer:Amplecatnora. Amplecat.Eusaunoi?idaceu,atuncicine? Nusemaincurcnproblemelingvistice,pentruceradejaindispus.Se mbrc,luhartaiiei.Decumajunsenstradidduseamaceramultmai frigdectnziuaprecedentiarcerulerannorat.Sendreptrepedesprecelmai apropiatcabinetmedical.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nuntru era mai cald. n anticamer ateptau nc ase persoane, dar ambianaeraplcut. Binecnauiaiciscaunegravitice! Se nscrise pe agend, apoi se aez i ncepu s priveasc la holovizorul din col, care prezenta un program muzical tehnogeaz. Notele i mai diminuau emoia,poatechiarfric.Deicrezusecvamaistaacoloncmulttimp,setrezi deodatstrigat:urmtorulerael. Doctorul avea n jur de 40 de ani, brbos, nu inspira team, dar nici ncredere.lpoftisialoclabirou,nfaalui. Deci,ceisantmplat? CredcamAGF. Ochiinegrilpriviroclipcuinteressaucumil. Cndaifcutultimulconsult? Acumosutdeani. Namfcutniciodat. Doctorulicoborpuinochelariicaslvaddirect. Ce gndete oare: e incontient sau i bate joc? De ce toi doctorii au ochelari?Decenupoartlentiledecontact? Vruparcsspunceva,darapoimormi: Mrog...SvedemdacestechiarAGF.Cndiaidatseama? Owainipovesti. Dup prerea mea, e ceva ciudat. Toi ceilali sau nscut bolnavi. Se presupunecarfigenetic.Etisigurcnueautosugestie? Nu,cumaputeafisigur? Bun,atuncisfacemuntest. Se ridic de la birou il pofti pe galez s se ntind pe un pat. i leg la mini,pepieptipecapcivaelectrozi,apoicitipeunecrandatele: Tensiunenormal,pulsridicat,EEG...Aiemoii? Da. Nuvezi?Credcsuntalblafa.Saugalben. Doctorulseapropideunpupitru,aproapedefereastr,cuuncomputer. ncepusbatntaste,idupceholoscrinulsefcualbastru,cutotfeluldecifre, zise: Vei fi supus cteva clipe unui cmp antigravitaional, ca s vedem efectele.Etigata? Owainrespiradnc. Gata. CellaltapsteatralpeENTERigalezulseateptscoboaredinnoun iad. Dar nu se ntmpl absolut nimic. Deschise ochii i sperana i fcu loc n sufletulsu.Sesimicompletdestins,detaatdedurereidelume. Astaafosttot!rsencurajatormediculimaiapsodat.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Tavanul i czu n cap, ntunecndul, strivindul, ngrozindul. Dei simptomeleerauaceleai,nuputeasnuobservecarfipututfimultmairu.i pstrase n parte luciditatea iar suferina fizic era suportabil. Doar spaima se meninea constant, fcndul s tremure. i toate luar sfrit la fel de brusc precumncepuser. Doctorul nu mai zmbea. l privea de pe scaun, ateptnd s se dezmeticeasc. Eadevrat,ziseelncet.AveiAGF. PentruOwain,acestecuvinteeraudeprisos. Cepotsfac? Vpotprescrieuncalmant. Avei AGF. V pot prescrie. La nceput mi vorbea la singular. Boala ia impusrespect.Saupoatenueraconvinscsuntserios.Acumeste. ...trebuie s v ateptai la mare lucru. Nici noi nu tim precis cum acioneaz antigravitonii i nu se pot combate efectele fr a se cunoate cauza. Aveiunmijlocdetransportneconvenional? Osam. Da. Atunciebine.Mrog,bineeunfeldeaspune. Mulumesc pentru ncurajare. Numai de mil nam acum nevoie. i imagineazcearsimieldacarfinloculmeu. MediculseridicdepescauniOwaindepepat.Sendreptarsprebirou. Amsvdauadresaunuibioenergetician.ncazuldefa,trebuiesv puneimaimultesperaneneldectnmine. Mulumi i plec. Era departe, dar avea timp. Merse o or. ncepuse s ning.nanticamernueranimeni.Btulauiintr.Laomsusimplsttea ofemeie. Osalutieairspunse.Sentoarsespreelilpriviptrunztor. Oedincost10lei. Galezulsegndisipunlancercareprobitateamoral: Nuamcartelalamine.ieurgent! Femeia se ridic i l lu de mn. Owain simi furnicturi n tot corpul, dardeodatiddudrumul. AGF,spuseea. Da. Atept s continue, ns femeia tcea, uitnduse parc prin el. Atunci Owainvorbicuteam: Mputei...vindeca? Dupunminut,aceastaizise,cuounddesimpatieiregret: nmodnormalcredcaputea.Saucelpuinancerca.Nutiucumsi spun,ncazultu...numiepermis.Nuteainscutaainuveimuriaa,darnc
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nuasosittimpul.incunlucru:trebuiestevindecisingur. Darpot? Trebuiespoi. Accentulnuczusepeprimul,cipealtreileacuvnt. Eraodiscuiedelaegallaegalieaeradepartealui.Sesimeadejamai bine.itrecuprinmintecmaisuntialibioenergeticieni,carearfibucuroisl trateze,darfemeia,citinduigndurile,ipuseomnpeumr: Nuteamgi. Mnaiddeacuraj. Credcamsplec. Ealls: Noroc. Mulumesc.imulumesccuadevrat. Femeiazmbi.Dupcesentoarsecasiasdincabinet,eaistrig: Owain! Galezulroticapul,surprinscnuerasurprins. CIultuenbuzunar. Bineneles. Plti. ndrumsprecassebucurdefulgiirecicarecdeaunumaipentruel, ccinimenialtcinevanupreasiianseam. Tom i romnii sosir la timp pentru masa de la ora dou, urmai de Branko, la dou i un sfert. Englezul se mndri cu noua sa achiziie un sintetizator.Le destinuic mai aveaunulacas, dar cuitase sl ia i cacesta eramaibunidincapital. Dupprnzseadunarncamerslasculte.Tomlpusenpriziluo poziiecomodpepat,cuminuneanbrae. Owainsedduinstinctivlaoparte,pentrucierafricdesintetizatoare. Aacumaltoraleerafricadelifturi,cutremuresauntuneric. Englezul pur i simplu fcu senzaie. Cnt o or, fr pauz, o gam ntreagdemelodii,delagarlarix11idelaNitrogenlaBach. La sfrit, Dan l rug sl nvee i pe el ceva mai uor, dar Tom ncepu dinnousdelirezepeclapeiarromnulselspguba. Vineri fu o vreme groaznic i nimeni nu iei din cmin. Gsir doar dimineaunmesajdelaBranko,princareianunacaplecatacasnMacedonia isentoarceduminicsearacubicicletapentruOwain. Privir literele albastre, apoi privir pe fereastr i Tom concluzion melancolic: Emainebundectpare...


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Expresiaserioasafeei,deparcarfirecitatLuceafrul,ifcupetois izbucneascnrs. Totui ziua prea terminat: se uitar la holozizor, cntar, se jucar pe calculatoriseplictisirteribil. Pe la cinci i jumtate se duser la restaurant. Dup mas, ceilali trei se rentoarserncameriarOwainrmasespriveascgnditorpegeam. Soareleprobabilapusese,erannorat,darfurtunaseoprise.iprivelitea prea acum albastr. Pomii erau schelete ieind din zpad, care nici mcar nu strlucea.Seimagincu50deanimaibtrn,contemplndncozitrecut,nco viapierdut. Va fi o clip cnd am smi aduc aminte cu bucurie i invidie de momentulsta. Caprinvisauziovocefemininitresri,ntorcndcapul.Erambrcat cuoflanearoieiizmbea.Faaisepreacunoscut. Potsstauieu? Aveaunaccentgermanicdestuldepronunat. neleg de ce se pune atta pre pe nvarea corect a romnei. Altfel fiecarearvorbiromnasa,poatearapreachiardialecteregionale. Elvorbeaaproapefraccentieramndrudeasta. Da,chiarterog. Ealulocnfaasa,continundssurd. Tuetigalezul,nu?O...Owain? Precumspui!senveseliiel. tiicinesunteu? Taiemicapul. Vigdis.DinIslanda. Aae!Aidreptate. Arficulmeasnam. Owainlsochiinfaademas,zmbind. Cefceaiaici?Nuteammaivzutdemiercuri. idacmvedeai,ceifolosea? Nimicdeosebit.Muitampegeam.miplacecndtotulenverzitafar. Dupoclip,avuoscnteiere: nverzitdefrig! ChicotiramndoiiVigdiszise: Chiarvreaustentreb:cetemperamentai? Owainridicdinumeri.Puteafiunrspunsdestuldebun.idduseama c i era fric de o eventual precizare. Era sigur c 80% din cunoscui ar fi interpretatgestulcapeonecunoatereatipurilordetemperament. NuiVigdis: Ei?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Totuinunelesese.Darnicirspunsulnueracomplet. Am trsturi din toate. Mai mult melancolic i sangvinic. Introvertit i extrovertit.Extremele. Fatalascultasecuatenieiateptasspunmaideparte. Suntmpritndou. Doarnuetipete!?izbucniea,aproapebucuroas. Owainoprivisurprins: Cumiaidatseama? Eraacumbucuroaspedeplin. Nuteintereseazastrologia? Nuprea,rspunseel,puinvinovat. Pcat.Dacvrei,amstemainv.Eusuntbalan. iintinsemna.Eraungestcamteatral,darOwainputeasideaialt semnificaie: nu fcuser cunotin cu adevrat pn nui aflase zodia. Pentru islandez, acesta era un lucru la fel de important ca i numele. Poate chiar mai important. i strnse mna. Delicat, catifelat, frumoas. Vigdis era simpatic. i atuncicreieruliintrnregimdenebunie,determinndulsfaclucruripecare altfelnulearfifcutnicinosutdeani.Aplecmultcapulspredreaptaivzu cfatapurtaofustverdeibocancipestrii,lamod. istbinenrou/verde. Earidicdinsprncene,uimitdeizbucnirealui,darncntat. Observlegturacuastrologia,darmersioricum. ncetncet, creierul i revenea n regim normal i vru s o ntrebe dac i plcea s i se fac complimente, ns se rzgndi. Rspunsul n orice caz era evident,chiardaceaarfirecunoscutsaunu. Cefaciuichendulsta? Maruncpefereastr. Maruncpefereastr. Perfect.idupaia? Motrvesc.Etiperseverent,arspuneea.Suntunprost,aspuneeu. Nimicdeosebit.Haismergemundeva. Unde? Lafilm,nparc...eutiu? midaintlnire?surseVigdis. Oficializarea l speri. Ca de obicei. Dac nar fi fost regimul de nebunie, poatechiararfidatnapoi. Cumszic?Ceszic? Vrei? Fatamijiochii,alintnduse. Vrea.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Vreau.Dmidetire! Cenumrai? Vigdis tcu un moment i privirea i se fix n peretele din spatele galezului. ROM.BUC.UNI.329. Ha! Ce? Almeue239! Da,ntradevr. Acumspunemiiparola!continuaOwainserios. Aivreatu! Nuenicioproblem. Pentru Branko sigur nar fi fost. Dar, oricum, dac iar fi umblat prin fiieresarfisimitunticlos. Atuncinevedemmine. Mine. Seridicarisedesprir.ncamer,Tomeranplinconcert. A doua zi, ninse fr ntrerupere. Owain ncepu dimineaa o carte i o terminlaase.Dupcecitiultimafraziridicochiinceoaiiobservceasul. Pnatuncinucrezusecpoatesuiteontlnire. VorbicuVigdisprincalculator,sembrciiei. Oareiaimaginatvreunmomentcnamsvin?idacda,cuprerede ru? Vruscread,darsetemusnuseamgeasc. FatanufcuniciuncomentariucuprivirelaastaiOwainoaprecieimai mult.Saupoatecarfiapreciatoindiferentcearfispus. Se duser la cinema i sala era pe jumtate goal. Cnd filmul ncepu, galezul fu surprins o clip de imaginile bidimensionale. n ciuda dezvoltrii tehnice,cinematografelefoloseauncelmaibuncazochelaristereoscopicipentrua simula spaialitatea. Un holoscrinuria era destul de greu de construiti n acest cazarfifostmodificatnsuiprincipiuldebaz,proiecia. Audiena acestui tip de spectacole se meninea totui la un nivel mediu, dinmotivelesnedeneles.Doumotiveerauchiarei. nmodnormal,filmuleraslbu,iarceidoiarfiminitcleplcusefoarte mult,poateidincauzclvzusermpreun. Dedataaceasta,filmulerabun.Sentrebdacnucumvadoarmnadin dreaptaluilfceaaa.Probabilcrspunsuleranegativ. nsfinaluleratrasdepr.Owainobservontoarcerelamodaanilor30, cndbinelectigadepindsituaiiabsolutimposibile. Dececriminalultrebuiesiavertizezevictima,sidestinuiemotivele? Eosatisfacieieftin,slvadpecellaltnvins.Doarcrimanusehotrtepeloc.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sau,celpuin,nuartrebui.Plnuietitotulacas,apoiviiitragi,fruncuvnt. Aa era realist. Dar s ceri realism modei 30 era ca i cum iai cere criminaluluisucidcusngerece.Defapt,eraacelailucru. DarVigdiserafericit,ccimutantuluiisetiasecapulcuorazlaserise fcusedreptate.Dargalezuluiieramildeel,pentrucaciunilesaleavusesero motivaiepecareonelegea,chiardacnuoaproba. Afar era noapte i ningea. Lumina sferelor fluorescente (de data aceasta alb)creaoatmosferaproapeireal.Globurileerausoriiarfulgiistele. iiamintiopoezieaprimuluimprat. Lunaardennalturi Pestemunideceiivreme, Steleningdincerulnegru Pesteaapelor... Care putea fi ultimul cuvnt? Cu toate eforturile, acesta nui venea n minte,deilaprimavedereeradestuldesimplu,ccitrebuiasrimezecuvreme. Segndisontrebepeislandeza,darsetemusnuparridicol.Duposcurt ezitare,revenilaprimulimpuls.Rupsetcerea: Auzi... Vigdis privea vrjit. i ntoarse capul spre el, parc deteptnduse deodat. Da. Hm...tiiPatru?PoeziaPatru? Da,ziseea,rspunzndntrebrii. Apoi,nelegndsemnificaia,asemnarea,opti: Da. Spunemiimie,cumsetermin?Careeultimulcuvnt:Pesteaapelor... ce? ...noiene. Vorbisernacelaitimp.Rspunsulintrebareafuseserconcomitente. Noiene.Parcaa. Noapteaastaarmeritauntablou,spusefata. Pictezi? Cndamtimp.Darngeneralmifactimp. Pecalculatorsaupehrtie? Pe hrtie, bineneles. Pecalculator sefac desene, nu tablouri.Sunt cifre, nuart. Owainnusesimeacompletdeacord,darnicimpotriv.Eraunpunctde vedereinteresantimeritasmeditezeasupralui. ncetncet,ajunserlacmin.Vigdissttealaetajulunu.Ocondusepn ndreptuluii.Eaizise,zmbind: Miafcutplcere.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Galezul nui ddu seama dacspunea adevrul sau nu. Oricum, cear fi pututspune?Cafostmizerabil?Nu,mizerabilnufusese,decinclinspreprima variant. imie. i strnser minile, cu degetul mare n sus. Acesta devenise salutul studenesc. Noaptebun. Nosda. Fataneleseisursuliselrgi. Gantt! ApoiintroduseCIulnidentificatoriintr,nchiznduorua. Duminic, spre sear, se ntoarse Branko. Intr, abia dac salut i i se adresgalezului: iamadusbiciclet.Dacvrei,vinopnjossvezi. Coborscrilecuinimabtnduideemoie.Odatcuelveniriceilali trei,spriveascminunea. Afarerafrigiarpecerulseninseputeauzriprimelestele.Owainncepu stremureiistrnseminilepecorp.Aapreactdectsuportabil. Macedoneanul deschise portbagajul AGMului, ridicnd o vechitur de bicicletdepecarevopseauasescorojise. Pareundeeu,darsepoatefoartebinemergecuea. Vorbeleirsuflareasetransformaunaburi. Nuvreisfaciotur? Dacmnvei... Elafelcaunagravitic.Mrog,aproapelafel... Owain avusese i el una cnd fusese mic. Dispozitivul antigravitaional echilibragreutiledeoparteidealtaaaxeiverticaleformatededireciaroilor, mpiedicndastfeleventualeleaccidente. Se urc pe biciclet. Minile i tremurau i dinii i clnneau de frig i fric.ncercspedaleze,darduptreimetrisedezechilibrifunevoitspun piciorulstngpepmnt,casnucad. Maincearc,rseTom. Aafcu.Reuiastfelssedescurcebiniornliniedreapt.Curbeleimai ridicauuneleprobleme,maialescpejoserazpadiputeaaluneca. Ceilali se duser n camer, la cldur, dar galezul continu exerciiile. Reinerile i dispruser i nevoia de joac i luase locul. Era un joc nou i era frumos.Trebuiadecislnvee.Experienadincopilrielajut,ccireflexele,dei atenuate datorit nlesnirilor moderne, i se trezir din nou. Dup o or de antrenament,urcielncamer,mulumitdesine.Avunsosurpriz:CIulsu era n buzunarul de la palton, aa c fu nevoit s bat la u, ca un golan. i deschise Branko, cu o expresie de mirare pe chip. Owain i ceru scuze,
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


explicndule,iareiseamuzar,decifuiertat. De luni ncepu coala cu adevrat i totul deveni din ce n ce mai mult rutin.Totodat,semprietenicuBrankoisendeprtdeTomideceilali. Pe17octombriefuziualuiVigdis,careorganizomicpetrecere,invitai fiindcolegiidegrupicolegeleeidecamer. Tomcaptateniacusintetizatorul,cci,iOwainnuputeacontesta,cnta excelent. Decedanseazlumea?sentrebgalezul.Nuseputeagndidectlatrei variante:Casfievzui,ncazctiuntradevrsdanseze,casiconsume energia,saucasnufiesinguri,casfiecuceilali,casnuseplictiseasc. Ultima,firete,ldefineaacumpeel.Seretrasentruncoliduppuin timpsosiisrbtorita. Cefaciaici? Nuerauntonpeiorativ,cinelegtor. Vreausstaudevorb! Fataseaezlngel. Desprece? Despreorice. Nuiveneanminteabsolutniciunsubiect.Vigdislntreb: iplacecumcntTom? Unfiordeinvidielstrbtu. Da,cntfoartebine.iplace. n acel moment, englezul fcu o greeal, dar nimeni nu pru si dea seama. Santmplatceva? Hm...nimic. Roaglstenveeipeinevreuncntecdou.Smicniserenade... Priveavistoare.Dupexpresiafeei,nueraoglum,chiarsperacntro ziaacevaseputeantmpla. Dareutiuscnt... Ah,scuzm,numiaispus... ...numaicnuofac,pentrucmiefric! Vigdisseuitcircumspect. Emoiilesuntfireti,nslatinemiseparececevamaimult. Mda.Eramnclasaanouaiaveamunsintetizator. nceputperfect! ntro zi eram singur acas. Era ntro vineri ca azi, de fapt, ca ieri! Cntam ceva nou i ritmul nu mergea prea bine. Vorbesc de ritmul bateriei, cel programat.Atuncimamgnditslschimbiamapsatctevabutoane.Parteade deasupra era metalizat iar cnd am atinso, mam curentat. n mod normal ar fi trebuitsfieizolat.Mamsimitdeparcafifoststrnsntromenghiniapoi
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


azvrlitlapmnt.Miampierdutcunotinactevaclipe,dar,dinfericire,astaa fost tot. Miam revenit, ns de atunci mie fric s m apropii de vreun sintetizator, darmite sl mai i ating. Pe al meu lam vndut sptmna urmtoare.ieculmeacdacmrelaxez,minchipuichiarcaputeacntadin nou,nscndvdvreunulmapuciarispaimaisetermintotul. inaincercatnimic?Eutiu,hipnoz?... Nu,nicinamvrutsauddeaaceva. Dece? M gndesc c n timpul strii de hipnoz mia pierde voina, personalitatea,ifiecarearputeafaceoricedinmine. Credcedeprisossispuncdoctoriiauieicontiin... Da,ntradevr,edeprisos. Fiecarearefixurilelui...Iartm,namvrutstejignesc.Suntobositi miagurapedinainte. Fatavorbisengeneraliarfifostoprostiessesupere,maialescfusese isincer. Numaijignitdeloc.ieugndesclafel.Chiarsuntcurioscefixuriaitu? Vigdiszmbiicoborprivirea. Laprimavedere,nupreaam.Maimult,cred,pentrucnumiplacesm gndesclaasta.Suntsuperstiioasimiefricdecomare... Observndindispoziiaei,Owainnumaiinsist.Sentrebnscearalege dac ar fi ntro situaie de genul: nsntoire n urma unei boli incurabile n schimbulunuicomarnfiecarenoapte. Deceviicubicicletalafacultate?schimbeasubiectul. Maibinespus,ncerc.Frsvrea,senvrteancerc. AmAGF,rspunseelscurt. Acum o nelegea. Totui, n general, rul nu dispare dac nui mai dai atenie. Ceiaia?ziseislandezamirat. Parautism. Fatasttuunmomentncumpn,cntrinduispusele. AtuncicumaivenitdinaraGalilor?Pebiciclet? Owainizbucninrs,urmatapoicureineredeVigdis. Egreudeexplicat.Defapt,einexplicabil.Mammbolnvitcndamsosit aici,laBucureti.imisaspuscosmvindec.Probabilcndosplec. Ultimideeiveniseinstantaneu,surprinzndulipeel.Totuinuideea nsineluimise,citranspunereaeincuvinte. Oideenunseamnnimic.Uncuvntnseamntotul. Dar acest principiu nu putea fi aplicat comunicrii interumane, n care cuvintele nu reprezint dect o mic parte a schimbului de informaii, restul constituindulgesturile,expresiilefeeisauintonaia.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Vigdis pruse necjit, dar ultima propoziie i adusese i ei puin optimism. iplaceaici?lntrebfata. PetrecereasauBucuretiul? Rspunsurilearfifostcontrarii. Da. imie.Ideeacaocapitalsfiecelmaimareoraaluneirimisepare idioat! icndmgndesccnprimaziaficomandatbucurosunatacatomic! Vigdislprivioclipnelmurita,apoifculegturacuboalaizmbi. Tom se opri din cntat i scoase sintetizatorul din priz. Era transpirat i ceru de but. Toi ncepur s aplaude i englezul fcu o plecciune. Apoi lu o sticldevindeunlitruiogolipejumtate. Ofatnecunoscut,probabilocolegdecameraluiVigdis,programun computersdifuzezemelodiinmodaleatoriu,apoistinseluminile.Eratrziui lucirilegloburiloralbedinstradptrundeauprinferestre,desenndformebizare peperei.Afarncepuseiarsningiarnuntrueracaldibine.Toateacesteai indusergalezuluiostaredeconfortisiguran.Vigdisseghemuilngelielo cuprinsenbrae. Armaifivrutsontrebedincerieraucolegeleeidecamer,darise prutotalnepotrivit.tiac2erauromnceirestulde3strine,caincelelalte apartamente. Oarecesemnificaiearputeaaveaaceastmprire?Romnisunt2,iar3 dinprovinciidiferite. Deci,indirect,liseddeadenelescineerauadevraiistpni,nciuda aaziseiegalitiatuturornaiunilor.Totui,pertotal,eieraunminoritate.Aveau unavantaj,caredefaptaproapenuconta.Lafelcanrealitate.Dece5?5oameni eraudestuldepuinipentruareprezentaounitate,dardestuldemulipentruase dividensubgrupuri,pentruadanaterelasimpatiiiantipatii. Avea impresia, din ce n ce mai puternic, a reprezentrii n miniatur a Imperiuluisubformaunuicminstudenescnevinovat.Pregtireapentruviaera deci mai complex dect sar fi ateptat, nu era numai una colar, ci mai ales uman.Astadaceracuadevratopregtire.Dacnu,atunciceera?ifufrics segndeasc.ifufricstraducncuvinteideeacareivenise,iideeaseduse. napoi?nainte?Memorianupoatedepozitaidei,ciideimaterializatencuvinte. Aa cred eu, dar de unde s tiu ce se ntmpl cu alii? Ce tiu eu de alii?Cetiualiidespremine? Ritmul de rix l trezi pentru un moment din reverie. Umbre opiau entuziasmate.Vigdisabiarespira,cuochiinchiiifaasenin.Totuleradinnou unvisfrumosncarearfivrutsrmnpentrutotdeaunaidincareldetepta fiecarecliptrecut.ioimaginpeislandezfcndunlucrudetestabil,defapt
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


nui imagin acest lucru n mod concret, ci doar ca principiu. Se vzu apoi gustndplcereacrudaasuferinei,apoiiertndo,pentrucnuputeasnuierte. Se ntreb ce e iertarea. Ce e uitarea. Poi s uii fr s ieri? Poi s ieri fr s uii? A ierta nseamn a uita, n primul rnd suferina. Dup depirea ei, ntmplarea ar aprea doar ca un fapt divers, o experien din care ai tras unele nvminte,poate.Deexemplu,snumaiaincrederenoameni.Ceaidacnai ncredere? spusese Branko. i Owain era complet de acord. A ierta complet nseamndefaptauitacomplet. Dacnuuii,atuncitrecidoardelaouractivlaunapasiv. O privi pe Vigdis, care prea c doarme. ns galezul tia c nu era adevrat,cdoarviseaz.Laclipancarelvaierta?Astadacovaface. Sttu apoi fr gnduri mult vreme, respirnd fiecare secund, fiindc eraustropidefericire. Luminaseaprinsebruscisetermin. De a doua zi viaa ncepu iar s se scurg monoton, cu mici pauze sau ocoliuri. ntro joi, Vigdis i spuse de un anun publicitar, de care dduse ntmpltor citind infotirile. Owain lu legtura cu autorul su, aflnd c acesta era dispus s vnd la un pre rezonabil un electroscuter. Suspensia nu era antigravitaionaliperformaneleoricumsuperioareuneibiciclete. Aacseduse,chiarnaceeaisear,laadresaindicat,mpreuncuTom iGicu,ilcumpr. Brankoaruncbicicletaigestulacestaldurupegalez,ccieareprezenta nprimulrndodovaddeprietenie. Acum totul devenise mai simplu, dar farmecul greutilor de la nceput fusesenlturat. Facultatea, colegii, Vigdis i activiti fr importan n fiecare sear i sfritdesptmn. Era smbt dimineaa cnd Branko reui s falsifice prima cartel de identificare.Eraaadesurescitat,nctczudepescauniseblbi,ncercnds le explice i celorlali ce realizase. Accentul slav puternic datorat emoiei fcea aproapeimposibilnelegereacuvintelorsale. Dan i ddu seama primul i sri de pe pat, urlnd la ceilali trei. Se adunar toi lng computerul su, iar macedoneanul le fcu o demonstraie: introdusedoucartele,unaoficial,cufotografiasaicealaltnounou. Rul programul su, apoi Identif, care prezenta aceleai informaii pentru amndou. ComputereleoficialeausistemespecificedescriereaCIurilor,pentruc suntprotejatelascriere,darsepoatecopierealoriapoimodificareaceleilalte! Brankovorbeancdestuldeincoerent,darmcaracumputeafineles. Dupexecuiaunuinouprogram,cartelapiratartancont500000delei.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Rmasercugurilecscate. TomsedezmeticiprimulisegrbisiaducCIulsau.iBrankolfcu bogat.Dan,OwainiGicuurmar. Stteauacumntinipepturi,nevenindulescreadnoroculcedduse peste ei. Owain nchise ochii. Era bucuros, dar nu era fericit. Putea acum si cumperepracticorice.Darcesicumpere?UnAGMnuavearost,sintetizator nu, holovizor ct sttea la cmin nui trebuia iar acas mai avea dou, cri puteasiiaicusumareal,mncare,mbrcmintenupuneapreamarepre peele,deieraunecesare,strimitacasarfitrezitntrebri,sfinanezeceva arfitrezitbnuieli.Ajunselaconcluziacarfimainimeritsipunlapstrare, pentrucndvaaveacuadevratnevoiedeei. DanlntrebpeBranko: Eunupreampricep,darteaiasiguratcumva?Snuainecazuri! Ce grij subit pentru soarta lui! Trebuia s spun S nu avem necazuri! Fiifrgrij.Amfostatent. Tomsttusepnatuncitcutingndurat.Cndsehotrsvorbeasc, aveanglasoinflexiunedeconductorpreocupatdesoartasupuilor: Auzii,deacumncoloniciuncuvntdespreasta,nimnui!Suntemtoila feldevinovaicaBranko,aacnucumvasoptiicevalaPI12... iprivi,pefiecarenparte. ...deinucredcseaflvreunpiigoiprintrenoi. Aprobarcutoiintcere. i m gndeam... ca s nu fie nici un fel de probleme... Apropo, avei conturinbanc? Aveau. Bun.Cartelelenupotfidetectate,nuiaa? Vaiconvinssinguri,rspunsemacedoneanul.Attatimpctnuobserv cinevalipsafotografieiinumelui. Englezulddudincapsatisfcut. Atunci ar trebui s mergem la Banc, s depunem cei 500000 n cont i apoisiretragemdinnoupeCIurileadevrate.Aadevinetotullegal. Era o idee foarte bun, cci acest tip de transfer se fcea exclusiv computerizat.Owainnunelegeacumdeexistauatteabreensistemulimperial, astfelnctcincistudeni,ncilaromn,iputeaufacedecap.Dardacsttea s se gndeasc mai bine, meritul principal era al lui Branko, restul fiind completrideordintehnic.nfinal,elesedovedeaunslafeldeimportanteca ifalsificareapropriuzis.Lacebuncfuriunmiliondacetiprinsimediat?! Se duser chiarn dupamiaza aceleiaizile. Intrar fiecarentro cabin


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


deschimb. Owaintiacearedefcut.Introdusenfantacomputeruluicartelafalsi spusenumruldecontiparola.Dupceiseidentificarvoceaiamprentele,ise stabili accesul i vzu n holoscrin suma total, comand transferul i atept cu inimastrnsdeclanareaalarmei,blocareauiiiapoiarestarea.Nusentmpl nimic.Auzi: 500000 de lei depui n cont. V mulumim c ai apelat la serviciile noastre. Luminiaverde,carereprezentaateniacalculatoruluisestinse.Galezul repetnumruldecontiparola.VrCIuladevratispecificsuma. 5000deleiretraidincont.Vmulumimcaiapelatlaserviciilenoastre. Avea acum n banc 503260 de lei. Iei din cabin puin ameit, dar i uurat,ntrunfel.Sesimeaoarecumvinovat,darsegndictdeuorerasfuri. Dac CIurile aveau alt format dect cartelele obinuite, Branko nu mai fceanimic. Sentlnirafardincldire,iarTomlespusesnucheltuiascfoartemult timpdeosptmn,casnuaibcumvagreuti. Dupacestinterval,englezuliceidoiromniicumprarcteunAGM ultimultip.Tomreaciondurfadeironiileiinsinurilecolegilordegrup,iar acetiaselinitir,celpuinfi. Dan i lu i el sintetizator. Dei nu prea avea talent, nv de la englez ctevacntece.Eidoi,mpreuncuMaria,portugheza,caretiascntelavris13, nfiinar formaia facultii de romn Angrrs. nsui numele era un protest, maialesceranenglez,iOwainaprecieiniiativaluiTom. n ziua urmtoare, Vigdis nu pierdu prilejul sl ntrebe cum de se mbogiserceitreipestenoapte. Deundestiueu?rspunsegalezul,totcuontrebare. Mgndeamcaivreoideevag,maialescetiaproapedesurs! Vag?Cefaarfacedaciaspune! mipareru. Contrarateptrilor,fatanurenun: icumiexpliciciaucumprattoiAGMuri?nacelaitimp. Numidauseama.Poateaupuspariu!
Vrisulerauninstrumentaproapeindispensabilmuziciirixigar.Eradefaptocutiuptratcu 132 de compartimente adncite, dispuse pe 11 linii i 12 coloane, colorate asemntor clapelor unui sintetizator: notele principale cu galben iar celelalte cu albastru. Pentru a cnta trebuia doar s vri degetelenspaiilerespective.nfiecareloca,ntrunperetedespritorexistaundispozitivceemiteao razlaser,receptatdeoceluldinpereteleopus.Cnddegetulntrerupeaacestcircuit,seemiteaun sunet,corespunztornoteialese.Diferenafadesintetizatorconstanfaptulcsunetulprodusnuera continuu, ci intermitent. Astfel, efectul semna cu un bzit, n funcie de frecven, gustat ns de publicdatoritstriiaproapehipnoticepecareoinducea,binenelesdaceraamplificatcorespunztor.

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Seabinucugreusnuzmbeasc. Ceprostiipotsdebitez! Vigdisclatindincap,lsndprivireanjos.Probabilrealizasecibtea joc,corinutia,orinuvoiasispun. SoinvitsmeargcuminesmiiauunAGM.Saleageaculoarea. ...cugurapnlaurechi? Tresri: Poftim? Cteodatavreastiucegndeti,cndstaiaainuscoiovorb. imiemiarplacescunoscgndurileoamenilor.Gndurilenupotmini. Defapt,eposibil,daredestuldegreusteminipetinensui.Celpuinaazic eu. Cu toate astea, m ntreb dac ar mai exista conflicte dac am comunica telepatic... Islandezamormicevaneinteligibil.Owainsentoarsebruscspreea: Tucecrezi?Uite,deexemplu,cecrezidespremine?Sincer! Vigdislprivisperiatunmoment,apoireplic: Darceteaapucataa,deodat? ntradevr,fuseseoreaciesurprinztoarepentrucaracterulsuobinuit. Totui,ncontextuldiscuiei,eaarfipututsirspund.Decinuvoise.Oarede ce?Dacarfiavutoprerebun,iarfispus.Aaarfifostnormal.Aveaoprere proast?Darnaveasens.Nimicdincomportamentuleinuodovedea.i,norice caz,puteasmint. Probabil fusese prea uimit de izbucnirea lui. Voia s cread ultima variant,ipnlaurmocrezu. Cetrebuiasmaispun?Scuzm,amavutozigrea?Binenelescnu. Greealafuseseaei.AteptasvorbeascVigdis,dareatceaprivindnpmnt. Linitea devenise apstoare. Myfanwy ar fi schimbat subiectul, ar fi ncercat s revigoreze conversaia. Era ciudat c tocmai acum i amintise de ea. Se ntrist. ApoisegndidacMyfanwyeraaacumiaminteael.Nuiputeadaseaman modcontient,dartiacnu. Timpulnetezete.Memoriareinedoarcenisepareimportant.Dardup un interval mai lung, imaginea iniial se altereaz i ajungem s ne amintim un lucrunucumafostnrealitate,ciaacumneamtemutsauamfidoritnoisfie. Participilacampionatuldeah?ontrebel. Gicu fusese cu ideea, i toi o aprobaser. Aa c lipiser hrtii prin tot cminul.Pnnacelmomentsenscrisesernsdoarvreo25. Nutiu,numamgnditpnacum. Dece? Fetelenuvor.Probabilcnutiusjoace. Sereferiselacolegeleeidecamer. Dartutii?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Puin.Ctsmutpiesele,ziseeairse. Oricumnaicepierde.minchipuicvafidistractiv. Ei,atunci...cemcost? Doilei.Cheltuielideorganizare. Vigdislprivimiratiamuzat. Doar nu credeai c facem un campionat pe computer. nchiriem o sal. Campionatntoatregula. ictigtorulcectig? Respect.iosticldeap. Fie. Tetrecpelista? Da. nseamncdatorezidoileicomitetuluideorganizare. Islandezarseiidduprieteneteopalmpestetmpl. Pestedouzileeraunscriiexact32deconcureni.TomiDanprocedar latragerealasori,apelndlaopungilabileele,ccivoiausfactotulnmod clasic. nprimultur,OwainurmasjoacecuBranko.Galezulnutialacetrebuia sseatepte,aactratmeciulcutoatseriozitateainvinse. La campionat participar doar patru fete. Trei fur eliminate. Conform loteriei,Owaintrebuiasontlneascpeceavictorioas.PeVigdis. Easpusesecabiamutapiesele,darseputeabazapeasta,attatimpct nvinseseodat?Sarfisimitrudacarfipierdut.Nularfiafectatnfrngerea propriuzis,cieventualeleironii:Teabtutporumbia,scumpule? Jucdestuldebine,darpierdu.Privintceretabladeah,netiindexact cegreise.Purisimplufusesemaibun.Speradintoatinimasajungnfinal, sau mcar s nu fie el singura victim. De fapt, deja nu era singura. Se uit la islandez,carestteacuminilencruciatepemas.Nuzmbea,dareradeajuns sivadochiicasideaseamacerabucuroas.Poatesesimeastnjenit.Ce putea face? Si rd n nas? i prea ru de el, dar se gndea ce va face mai departe. Lui Owain nui rmnea dect alternativa de spectator. Astfel, n ziua urmtoare, Vigdis l nvinse pe Dan i se calific n semifinale, unde trebuia s joacecuGicu.ncellaltmeci,TomlntlneapeKarl,dinGermania. Era curios c, dei mai mult de jumtate din participani erau aproape necunoscui,npoziiilefruntaeseclasasermajoritateadingrupasa.Cuexcepia lui.Astamulumitislandezei. CtigarTomiGicu.Galezulnuputeaspunedacipreabinesauru. i prea bine c Vigdis fusese btut i i prea ru c simea asta. Ct despre victorialuiTom,puteaspunecseateptaselaaaceva,ccienglezuluiimergeau toatedinplin.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Finalafuonfruntarepeviaipemoarte;Gicuapliciarjoculpericulos, dar Tom i ddu seama i l nvinse. Owain trebui s recunoasc faptul c ar fi pierdutcusiguran. Campionatul se terminase, dar ecourile lui erau departe de a se stinge. Tomfunevoitsbeasticladeap,astfelnctdupojumtatedeorabiasemai ineapepicioare.Dannuselasmaiprejosiiurmexemplul,ajungndssrute picioarelescaunelor. IateuitcedeplecciunifaceDancelDur!exclamVigdis. Owainrse.Darrsedecutotulaltceva.Danydrngaleznsemna sub ap, expresie care avea i sensul de beat. Dan cel Dur era o porecl perfectpotrivitsituaiei. Acesta fu ultimul eveniment notabil nainte de vacana de iarn. Toi se pregteausmeargacas,iAGFrevenipeordineadezi.ichempriniiprin computer.Rspunsetatlsu.Owainsentrebcearfacedaciarspunedeboal. Ar veni cu primul avion i sar zbate si gseasc un remediu care nu exista. Momentan.Aacminicsesimteexcelentcucolegiisiicplnuiescpentru vacan excursii, plimbri, c nu pleac nimeni i c nu vrea nici el s fac altfel. Tatlsulprivinochiiel,pentruoclip,nuidduseamaceputeansemna aceasta.Apoiselumin:purisimplunulcredea.Darnuziceanimicpentrucnu voiaslfacssesimtprost.lntrebdacarenevoiedebani.LuiOwainiveni s rd. Dar ce ar crede taicsu dac ar rspunde negativ? Cine tie ce afaceri nvrte! Miarprindebine. Sminicasparinormal! Cellaltispusecoricumaveatreabnoraicvatrecepelabancsi depunosumncont.Apoiiur: Sperstedistrezibine! Era ca i cum iai zice unui om n treang Sper s ne vedem la anul! De fapt,teoreticeraposibil,darnueradelocprobabil. Mersi. ntrerupse legtura. Apoi realiz c tatl su va vedea banii din cont. Ar rmnecatrsnitncap,apoiarcutadiferiteexplicaii:Vaszic,javraebogat imimaiicerebani!Uitepecineamcrescut.Amtiutdelanceputcbursaastaecu ghinion.Probabilvindedroguriilegalepestrzi.Cumsispunnevestei? Setrezizmbind.ApoincepusseuitedupCI,gndindceranormals nulgseasc, odat ce segrbea. Dup un minut,i ddu seama c era chiarn faalui.Sembrcifugipeu. Ajunse la banc destul de repede cu electroscuterul. Intr ntro cabin, sperndcatatlsusnufiajunsmairepede. Oricum,arfitrebuitsmideschiduncontsecret,decarestiunumai euilacaresamdreptnumaieu.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


iscoasebaniipeCI,lsndnmodsimbolic6leii75debani,casse vadctdenpstuitdesoartera. Apoi i deschiseun noucont. I se comunic numrul ii se ceru parola. Primulimpulsfusdeauncuvntgalez,apoiiamintideBranko. Uncuvntromnesc,deci.Ochestielacaresnusegndeascnimeni. Amprenteledigitale i vocale confereau destul siguran; parola era mai degraboproteciepsihologic. E greu de crezut c cineva care trecede amprente va renuna din cauza uneinenorocitedeparole. obolan. Repetaiparola. obolan. Transfertoibaniidinprimulcontnaldoilea:57deleii25debani.11. Dacarmaifintrziatdouminute,taicsuarfiavutosurpriz.Avusesenoroc coperaiilebancarenuseputeaufacedeacas.Apoirealizcdacacestlucruar fifostposibil,nuarfifostnicionenorocire.Larfiscutitdeundrum.nelesesede la macedonean c CIurile erau protejate la scriere i doar calculatoarele oficiale puteaundeprtatemporarprotecia,prinmijloacemecanice. Lasfrit,depuseicei500000ianulprimulcont. Ajuns la cmin, fcu o cerere la administraie s i se permit ederea n continuare, pe timpul vacanei. Rspunsul fu: de acord, dar contra cost. Owain accept. ivacantancepuitrecupenesimite. Faptul c sttea n camer, ateptndui pe ceilali s soseasc, i aminti toatentmplrileciudatedecareavuseseparte.Nicimcarnuncercasledeao explicaie.Erasingur.isetemeasnusesimtimaisinguratuncicndvaveni restul. Deci iei pe strzi i rtci fr s tie unde se duce i de ce. Avea un sentiment ciudat de pierdere a timpului. Nu doar nostalgia cauzat de trecerea fireasc,ciaproapesuprareivinovaiecnufaceceartrebui. Censeamn999? i era clar c nu putea deduce semnificaia n mod logic. Era necesar o revelaie.Dacnuisentmplasens,nsemnacnusosisenctimpul.Sentreb dacvasosivreodat.Probabilcda. Sentoarselacmin.Seadunasertoi.Lucrurileintraunnormal. Exameneleseapropiar,apoincepurssendeprteze. nmartieveniziualui.iluarunholovizorportabilultimultip. PoatecBrankoafalsificatocartelspecialpentruocaziaasta. De fapt, aceast presupunere era singurul lucru care ddea valoare cadoului.Unefortexclusivpentruel. Tresfacicinste,cneamzbtutattapentrutine,iziseDan.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Trebuia,astaeraiprerealui. Venitoatgrupa,bachiaripersoanepecarenulevzuseniciodat.Sau levzuse,darnuleremarcase.Dan,firete,celDur.Dedataaceastans,ncepus secertecuLucian.Motivuliniialsepierdurepede,iamndoitrecurlainvective detotfelul. Owain era iel puinameit. i imagin c seluau la btaie, c el ialii sreau si despart, dar c, odat ajuns n spatele lui Lucian, i ddea o lovitur scurtnrinichi.iamintisedentmplareacuigrile. Artrebuisivrnnasigri,ssesature! Cumceidoinupreaudelocssecalmeze,galezulivorbi(maimultdin datorie dect din convingere) lui Tom, care sttea pierdut, cu ochii aintii n perete: Sioprimpnnusencaier! Englezul mormi, fr sl priveasc, un amestec de sunete ce nsemnau probabilunndemnderenunareinjurtur: Leevemthel... Nul mai vzuse niciodat pe Tom ntro dispoziie ca aceasta. La ce se gndeaoarenacelemomente? Deodatsetrezialturicuunnecunoscut,carelapucpedupumericuo mna,ntrungestcesarfivrutprietenesc.Owainseeliberncet,cnucumvas fienvinuitdeviolen. Lamuliani,Owain!urcellalt.Eutecunosc,rmnesmcunotiitu: Stjepan. Deobicei,celpuindincteobservasepnacum,oameniiispuneauatt numele,ctiprovinciadeundeerau.Iatoexcepie. ncepusivorbeascdespreomulimedenimicuri,repetnduiaproape obsesivprenumele. Oreacieinstinctivmpotrivaneateniei?noricecaz,cenaibancearc sfac? Setrezideodatcurspunsul: Smictigencrederea. Da,aae,cumspui. Ma bucur c i tu gndeti ca mine, Owain. Acum te las, s nu spun ceilalicsuntegoist.Nemaivedem,da? Sigur. Sentoarseisedeprt. Ciudatchestie. SechinuisiaminteascceiziseseStjepan,darnureui.Aveaosenzaie ciudat:parcnicinufuseseadevrat. Seuitnjur:DaniLucianerauacumceimaibuniprieteniiarVigdisse apropiasurztoare.Eratotuiunpunctdesprijin.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Aivzutcucineamdiscutat?ointerpelgalezul. Da,eraStjepan,dinCroaia. Numele,provincia.Aaeobiceiul. Nulammaivzut.lcunoti? EngrupacuIrina.Dece? Ecevaputred. Voiamstiu,attatot.Nimicimportant. Mda...Maistaipeaici? Darpeundesstau? Haiafar. Eraopropuneretentant,cciielvoiassemaidezmoreasc. Hai. Ieir n noapte. Era senin, vntul abia adia, stelele licreau departe, era frig i era frumos. Merser mult vreme fr o vorb, respirnd ntunericul albastru.PeOwain,parculacestadinapropiereacminuluilduceacugnduln modciudatlaodespriredeseptembrie,attdendeprtatnctnumaitiacee imaginaieiceeamintire.Sentreb,privindopeislandez,cenoaptengheati evoca oare acest tablou ce revedere, ce desprire, ce bucurie, ce durere, ce zmbet,celacrim. Ctdemicisuntem!icevisemariavemcutoii!Fiecareomaresteaua sa.Cine,saumaibinezis,ceemaiimportant:unomsauostea?Eadevratco singur via e mai nsemnat dect ntreg universul? Dar dac o stea reprezint viaa pentru alte 7 miliarde, undeva unde probabil nu vom ajunge niciodat? Se gndescoarelanoi?Poatecfiecaredineiareostea.Alcuiesoarelenostru?Care estesteauamea? i aminti de imnul imperial, Stea curat de argint, al crui text fusese modificatdupmoarteaprimuluimprat,pentruasunatotuiaimn.Semirc, aproapedefiecaredat,nnopicaacestea,reveneacugndullapoeziileluiFlorin I. Avusese ocazia s studieze originalul i versurile oficiale, despre steaua ce patroneaz victoria, unirea i nelegerea, i se preau seci i ridicole. Primul text aveaociudatnotdemisteriromantism. Vzutamsteauantroclipire Pierindnvalulcenuiu iundadeschimbatfire Mprefcuncevreamsfiu. Poate o stea s influeneze o via? sta e domeniul lui Vigdis, dar nu existntoateunstropdeadevr?Viaantreagsuferimdoarinfluene,nscile recunosc?Ciorecunosc? Realizdeodatcfataerasinguracareputeaslajute. Censeamn999? Vigdistresri:
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Poftim? Artrebuisteobinuieticuieiridegenulsta. Amavutunvisncareapreaacestnumrimntrebamcesemnificaie poatesaib.Petineteintereseazchestiileastea... Ls propoziia n suspensie, fr s mai adauge o ntrebare sau o rugminte. Dacvorbimdinpunctdevederesimbolic,999nuedectorepetarealui 9,pentruaiconferimaimultputere.Dupctetiueu,9reprezintnemurirea, purificarea,aspiraiactresalvarespiritual. Dece? Celedoucuvinteluimiripeel,cciniserinvoluntar. Primele 10 numere formeaz Decada divin, n care 1 este simbolul lui Dumnezeu,Unicul,iar10alcunoateriiintegrale.9tindespre10,seapropiede perfeciune...Aacred! Aacrezi!Nuetisigur.Decenuetisigur? Aadar,numrulaveaosemnificaiepozitiv. Al9leaarenumrul999.Dece?Enecesar.Eltie?Eleste. Aparent, toate puteau s se potriveasc. Rmnea sl gseasc pe al noulea.iapoi?Probabilsnveecevadelael,odatcepremoniiaildesemna cafavorabil.Totui,isepreacevasuspect. Eltie?Eleste. Adicestefrstie. Decearenumrul999?Enecesar. Suna precum: Nu e vina lui. Aa trebuie. Dar vina, chiar i absena ei, sugera ceva ru. n contrast cu salvarea i purificarea afirmate de Vigdis. n definitiv,deceAatrebuie?Erauntestlacareerasupus?Eraoncercare?Sau purisimplusoarta? iplacenoaptea?ntrebea. Nu sunt singurul. Poate eu ar trebui s m obinuiesc. Cine tie? O fi vreuntransferdepersonalitate.Oareceamluateudelaea? Da,murmurel. i mie. Mai ales cnd e lun plin. Cteodat m nchipui singur, n mijloculuneicmpiinesfrite,ngheate,subolunplin,neobinuitdemarei strlucitoare.Avreasmnaliszborpedeasupraei,caunliliac. Caofantom. Eoimaginefrumoas. Fatalprivideparciarfizis:Dutelauncontrol. Ceamspus?Cetrebuiasspun? Ceamspus? Ah,scuzm.Mgndesccefatrebuiesfifcut.Attadoarcpentru minenueosimplimaginefrumoas.ncearcsinchipuiitu!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Acum? ncearc! Etotnoapte,darlunaeattdeputernicnctfacestelelespleasc.Din zarenzarecmpiadeghealucetecaargintul.ieusuntsingur. i desfcu aripile i zbur spre lun. Discul strlucitor cretea i cnd i cuprinse orizontul, trecu prin el, ncepnd s scad n urm. n faa lui era Pmntuloimenscmpiengheat.CoborncetiovzupeVigdisnmijlocul ei. Dar fata nu pru fericit de ntlnire. i zmbi rece i se ndeprt, zicndui: Pmntulemare. Reveni n realitate. Islandeza l privea curioas. Owain nui putea da seamadaciimaginasedoarsaufuseseohalucinaiesauviziune. Amncercat... i? Ezitunmoment,apoivorbi: Nupotdescrie! Vigdisprusatisfcut.Cualtecuvinte:Vezi?Aaenormal.Nuimagine frumoas! nsgalezulnuerasigurcerostavusesertoateastea.Poatenuavuseser niciunul,eradoarunsubiectcamultealteleposibile. ndrumsprecminsegndicmeritasesndureziuaaceastaticloas, numitaalui,doarpentruplimbareaceacumsetermina. Cumarfidacoameniiartridoarnoaptea?ntunericuldoimpresiede vulnerabilitate,careartrebuisiapropie. iamintiosecvendintrunfilm,relevantdupprerealui:unbrbati o femeie, singuri noaptea ntrun cimitir. Mie fric! optise ea. i mie! rspunsese el. Strngem n brae! l ndemnase ea. i astfel, spiritele nu le putuserfaceniciunru,fiindcnulemaierateam. Dac2oamenisuntcuprinidespaim,eipotformaunsingurtot,cares depeascaceaststare.iastfel,fiecaredineiovadepi.Darctedegreus formezeaceltot! Privindinscripiadedeasuprauii,gndicdeadouazivorfiiaribieii studeni dintotdeauna, pn cnd o nou noapte de primvar poate i va face pentruscurttimpstpnipelumeadegheaipelunadeflcriargintii. ntradevr,dinsptmnaurmtoarencepusianseriostezafinal,de diplom, i hotr c va scrie despre accentele i diferenele regionale ale limbii romne n provinciile Imperiului. Cu ajutorul computerului select materialul necesar,aacmaitrebuiaslciteascisredactezelucrarea. n acelai timp, observ c Stjepan i tot ddea trcoale. Era o expresie neelegant,darexprimaperfectceeacefceacroatul.PeOwainlenervamaiales cialegeadreptsubiectedediscuienumaibanaliti,lucrurideduzin,complet neeseniale. De altfel, nu se ndoia c la sfrit i va cere n mod sigur o favoare,
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ccintregcomportamentulsudovedeauninteres,deocamdatascuns. Odat,exasperat,lntrebasedirect: Tepotajutacumva? IarStjepanprusechiarrevoltat: Nu,bineneles!Nuvreismncmceva,Owain?Faceucinste! ntrodupamiazns,cndOwainsttealaomasnrestaurant,singur, privind absent ceasul de pe perete, apru croatul, ddu mna cu el i se aez alturi: Lacetegndeti? Decevortoisafleasta? Lanimic. Atunciamsidaueuunsubiectdemeditaie:ieiconvinecfaciparte dinImperiulRomn? Hopa! Secunoteadelaopotcaceastaeradiscuiapentrucarelpregtise Stjepan. Era o problem serioas i tocmai de aceea nici nui mai repeta numele. Prinurmare,aveasaflecevanou.iinteresant,probabil. Dei nelesese c se refer la organizarea statului i la o posibil independen,deteamsnuspunvreoprostie,galezulntreb: ncesens? Etiituintegraionist? Tonulceluilalttrdaourmdedezamgire. Nu,rspunseelipriviscnteiadebucuriedinochiicroatului. IatcumpoifericipecinevaizmbiOwain. Decentrebi? Trebuiestiicnuetisingur.Eufacpartedintroorganizaiesecretce militeaz pentru autonomia sau chiar independena provinciilor. A vrea s ni te alturi! Cediscursmizerabil! n primul rnd, observase tonul i nflcrarea aproape infantile, apoi cuvinte ce dezvluiau nehotrrea: autonomia sau chiar independenta i un servilismimpropriuuneiorganizaiiserioase:Avrea. Cisuntei? 8,dinUniversitate. Galezulizbucninrs,apoiidduseamaceraungestnepoliticosise abinu,cernduiscuze.Stjepanlprivea,nenelegndcesepetrece: Purisimplunumiexplicieireaastaata.Amvorbitfoarteserios! Deodatsebtucupalmapestecap,ifrsateptereplicaluiOwain,i zise: Nu iam spus ce era mai important! Nu noi opt suntem organizaia. OrganizaiaesteANS!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Galezului i nghe zmbetul pe buze. Armata Naiunilor Supuse era o coaliieinternaionalsemiterorist,cumembridintoateprovinciileimperiale,pe ct de secret ca organizare intern, pe att de cunoscut prin efecte. Susinuse, mai ales n trecut, numeroase demonstraii violente, dar acum prea c se mai potolise, rspndind ocazional virui informatici i manifeste, ameninnd guvernul,conductoriiinstituiilorpubliceichiarpemprat. Poismirspunzisincerlaontrebare? Stjepanncuviin. Tudeceteainscris? CroaiaafostprintreprimelericuceritedeImperiuanouai... Galezul nu mai asculta. Avusese o revelaie. Iat cine era al 9lea! Bineneles, acum totul era simplu. Ce reper mai bun putea si dea primul mprat, dect cuceririle fcute! Era totui curios c Florin I i cerea s fac parte dintro organizaie antiimperial, dar nu se ndoia c i acest lucru avea o explicaie,pecaredoarnuocunoteanc.ndefinitiv,Vigdissepricepea. Croatul tcea, ateptnd decizia lui. Remarc faptul c nui dduse un timpdegndire,nicimcarozi.Hotrreatrebuialuatpeloc.Ochiipreausi spun:Amavutncrederentine.Ateptacumacelailucru. Suntdeacord,rostifermgalezuliapoiidreseglasul,auzindsunetele ridicolderguitepecarelearticulase. Situaiapenibilanuseopriaici,ccisenecincepustueascvitejete. Stjepan l urmrea serios, dar Owain ghicea zmbetul dispreuitor din spatele ochilorcprui. AmsidaudetiresviilaIniiere!ispusecndtermin. Aasfaci! Pieu...attaamavutdespus.Nemaivedem! Galezul strnse mna ntins cu degetul mare n sus, apoi rmase iari singur. Sedusencamer.lgsipeBrankolucrndlacalculator,careispusec englezuliromniiplecasercunutiucetreabnora. Owain nu simea neaprat nevoia s se descarce, dar era curios s afle i prerea macedoneanului. i povesti pe scurt, fr nici o introducere, cele ntmplate.Spremirareasa,Brankonufusurprinsicontinusbatntastatur. imrturisicipeelncercaseslcooptezeStjepan,ireuise. AmmerslaIniiereacumvreosptmn... Miaspustoateasteafrsiridiceochiidinholoscrin! SentrebdacaveavreunrostsfacpartedinANS.Macedoneanulnu preasdeafaptuluioimportandeosebit. nsearaurmtoare,croatullchemprincomputer.Owainnusemirci cunotea numrul. i propuse o plimbare prin parc, mai ales c erau de fa i colegiidecamer.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sentlnirnfaacminului. Undemergemacum?Edeparte? Ghici!tiihotelulMuntenia? ErapestedrumdesediulPI. Adicenbtaiedejoc,nu?Nuenimicilegal.Amneles. Nainelesnimic.ANSeinterzisoficial. Atuncicefacem?Nepredm? Suntdouvariantederspuns:pedeoparte,nimeninunevaobserva.i imaginezipoliitiiprivindcubinoclulpegeamnhotelulvecin?Pedealtparte, folosimprincipiileascunderii. A!fcugalezul,deparceracevasimplucabunziua.Etotulclaracum! Snelegcnuletii? Camaa. Bine,amsileexplic,dariafirecunosctordacaiterminacutonul stademecher! Owainlasprivireanpmnt: Scuzm! Sunt trei principii: principiul proximitii sau simplitii, ca n cazul nostru, cndai dea face cu oameni inteligeni careseateaptla ceva complicat, principiulcomplexitiisaunvluirii,pentruoamenipecareiconsideriinferiori icarenuivorputeaurmriraionamentuli...iaghicetecareealtreilea? Galezulifrmntmintea,darnugsinimiciserecunoscunfrnt. Principiul imaginaiei. Aici intr orice metod nou, de fapt, orice principiunou.Decieoclasificarecomplet. icineadescoperit...principiile? IngvarKnutsson,acumacumvreo15ani. Namauzitnviaameadesta. Darnumaicoment,pentrucoricumnutianimicdespresubiect. Ajunserlahotel,apoiurcarlaetajul3iintrarntrocamer.Decumse nchise ua, Owain se simi desprit brusc de universul real. Ferestrele erau opacizate i doar cteva lumnri ddeau o slab umbr de lumin. n ncpere maierau5persoane,carestteaualiniatenfaalor.Ovocedefemeieseauzi: 7suntem.Putemncepe. Unbrbatrosti: Cinelnsoete? Stjepan Pion de Hrvatska sunt. ndrumtor i vinovat alturi m leg s fiu,ifrate. Prea bine, spuse femeia. Primete Potirul Nesupunerii i mbatte din sngelelibertii! Incantaiileiatmosferaapstoareiddeauouoarstaredeameeal.O mnintinsecevacarelaprimavederepreaunpaharcupicior,dardupcel
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


apuc, realiz c era fcut din metal, probabil argint, dar nu putea fi sigur din cauzaluminiipreaslabe. lduselaguriavuomicsurpriz:lasuprafasimiunfeldegelatin, carens,cndnclinpotirulcasbea,selipidebuzasuperioar,ngduinduis guste lichidul. Se temu pentru o clip c arfintradevr sngele libertii, dar apoiseliniti,ccibuturaeraaromatiidduostarederelaxarebinevenit. ntinse mna nainte i paharul i fu luat. Se simea vesel, fr griji, iar decorulcarelanceputiseprusesumbruiplindemisteracumiaprearidicol i nesemnificativ. Voi s le spun s termine cu ritualuri de astea de coal primar,dar,cugreu,sestpniiseconcentrsvadcesevamaintmpla. Abut!zisebrbatuligalezuluiiseprucdeslueteonotdesurpriz itotodatdebucurienglasulsu. Iaaminte!vorbifemeia,ipentruOwainvoceaeidevenintregulunivers. EtiparteaArmateiNaiunilorSupuseiniciofaptnuedestuldemreainici un sacrificiu prea mare pentru cauza noastr. ANS e viaa ta i viaa ta e viaa noastr. Galezulsimicutotsufletulcuvinteleacestea,lerepetcuinimailentri cumintea.Eransfritfericitcnumaierasingur,caveauneliaveaprieteni, frai,pentrucareelcontalafeldemultcapropriilepersoane. Vino,izisefemeiaifcuunpasnainte,deschizndbraele. Owain se ndrept spre ea. l mbri i l srut uor pe gur, spunnduiapoi: SuntAnneReginadeFrance.IartuetiacumOwainPiondeCymru. EuvreausfiuTurn! Rostise aceasta pentru c nu mai putea gndi n mod independent, gndurile i se transformau fr voie n cuvinte. Vorbele sale produser rumoare. DarRegina,inndulncontinuaredemini,lntreb: DecenuvreisfiiRege? Oaredece?CaTurnaputeaajutamaibineANS,caRegenuamaiajuta, aconduce. ntro zi vei fi Turn, i spuse ea cu buntate i galezul se simi ncurajat. tiacarecinevancrederencapacitilelui,ciestealturi. Reginasedesprinsedeel,revenindnrndulcelor5: 7amfost.Ceerascrissamplinitprinminilenoastre. Toisenclinar,iarStjepaniatinsebraulcudegetele,fcnduisemnsl urmeze.Ieirdincamer,apoidinhotel,darOwainaproapecnuidduseama, ntratteradeexaltat. Abiaadouazi,dupunsomnadncifrvise,reuissetrezeascdin stareaaceeaciudat.Reflectndelungasupraevenimentelor,darnupututrageo concluziedefinitiv. Spresear,atmosferasencinse,cciavealocunmeciamicaldepregtire
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


pentruCampionatulEuropeandeFotbal,dinvar,ntreAngliaiaraGalilor.Era curioscmajoritateacompetiiilorsportivesedesfurauaproapecanurmcu50 de ani, cu schimbri fireti de regulament. i mai ciudat era faptul c numele campionatuluinufuseseschimbatnImperial. Aadar, ambele formaii se calificaser i urmau s joace n acea zi. Dar Holoviziunea Central nu transmitea meciul, aa c Tom i Owain trebuir si conving pe ceilali s dea pe alt post. Mai era o problem: ce post? Englez sau galez? Prima variant se impuse i Owain urmri amuzat un comentator ce se entuziasma cnd echipa advers ataca i se lamenta cnd echipa lui amenina poartaenglez. Laurm, ara Galilor ctig cu 32 iTom ncepusnjure nemulumit. Ceilali trei, care priviser i ei partida (cci comentariul fusese n romnete), recunoscurtotuicrezultatuleracorect. Rydyn ni wedi ennill!14 izbucni Owain, mai mult ca si fac n necaz englezului. nsacestanuspusenimic. Pe 1 aprilie fu ziua lui. Galezul considera c era destul de ciudat s te fi nscut ntroasemeneazi.i imaginascena dela maternitate: Jon, avem biat! Las,Mar,nufitrist,tiameucndoctoriitianupoiaveancredere.Osi spunemJl.Saumaitrziu:Azieziuamea!Ha,bun!Erasmprinzi! Probabil de aceea Tom se gndi s fac ceva mai deosebit. nchirie cu ajutorul macedoneanului o caban la munte pentru sfritul de sptmn i merse din camer n camer pe la colegii de grup i nu numai, invitndui. Transportul urma s fie asigurat de AGMurile lui Tom, Gicu, Dan i Branko. Practic,ntotacesttimp,englezulnuiadresluiOwainniciuncuvnt. nsearaplecrii,vineri,pe2aprilie,galezulsedusenrestaurantirmase laomas,pierzndirultimpului. Deodatauziunglasbinecunoscut. Atepipecineva?spuseVigdis. Ridic mirat privirea. Fata nu tia dac si zmbeasc sau s rmn serioas,aacaleseinvoluntarultimavariant.Galezularfipututrspundeceva degenulPetinesauUnsufletbun,nszisencet: Nu,numaiateptpenimeni. Islandeza bnui c se ntmplase ceva grav, aa c lua loc lng el i se pregtislntrebeceanume,darOwainvorbinainte: Dartunuteaiduscuei? Defapt,mautrimisstecaut... Decepetine? Rspunsuleraevident.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


...iteamgsit.Neateaptjos.Numergi? Nu. Dece? Vigdiserasinceruimit. Namfostinvitat. Alesese special diateza pasiv, pentru ca mesajul s sune ct mai impersonal. Cumaa?Tomainvitatpetoatlumea. Mienumiaspusnimic. Darmautrimisduptine.Astanuetotoinvitaie? Bada,daroinvitaiedecategoriaadoua. Rostiseacestecuvintefrssegndeascpreamultiacumsetemeas nofijignitcumvapefat.Doareafusesebineintenionatitoattevaturaasta,s selaserugat,ncepeasloboseasc.Ziserepede,frsopriveasc: nfine,smergem! Seridicdelamas,darobservcVigdisrmaseaezatpescaun. Amspusoprostie,nuiaa? Nu, acum ncep s vd i eu lucrurile din punctul tu de vedere. i, n definitiv,cumaismergi?NupoiurcanAGM! Cuelectroscuterultu.Amsmtrscnurmalor! Fusese mai patetic dect inteniona, dar islandeza nu ddu importan. Rmasetcutctevaclipe,apoiizbucni: Erevolttor! Continucuuntonmailinitit: Darlas,treceiasta. Namnevoiedecomptimire! Decestainpicioare? Mesajuleraclar,nsOwainzisectmairece: Etiateptat! Doarnucrezicmmaiduccuei.Rmnieucutine. Namnevoiedemil! Oprivi.Erafrumoas.Erabun. Eungestnobil. Artrebuislespunemilor.Snumaisteadegeaba. DacarrspundeLeevemthel? Mda,aprobfata. Coborrnfaacminului,darnuvzurpenimeni.Stradaerapustie. Javredezgusttoare!mormielfurios. i era ciud mai ales pentru Vigdis. Era primul act de ostilitate colectiv fi.Fatamormiieadjfulsinshelvti!,probabilonjurturislandez.Eratiut efectulcuvintelordeacestfeldecalmareidiminuareatensiunii.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Haisnedistrminoi,cedracu! Auzindovorbindastfel,Owainizbucninrs: Aidreptate! Prin preajma erau o mulime de stabilimente potrivite scopului lor. Alesernceledinurmorixotec,cuholofirmaverderotitoare.nuntruiizbin primulrndaerulncrcatdefum,abiarespirabil. Muzicpentrumaniaci! Laastaseadugaunstroboscoppeunuldinperei,carepulsalaintervale egaledetimpcuoluminalborbitoare.ipestetoate,btaiaritmuluiizumzetul asurzitordevris.Atmosferinfernal. Perfect. Ateptarsseterminecnteculnceput,apoielntreba,cuunrnjetsadic intenionat: Dansezi? Vigdisnrspunserguit,cuoexpresieslbatic,asemntoare: inccum! Mn n mn se ndreptar spre centrul slii. Rixul era cel mai obositor stildedans.Celdeosebeansnmoddecisivdecelelalteerafaptulcnucereao ndemnareextraordinarsauoeventualexperien,cisebazaaproapecomplet pecondiiafizic,figurilefiindrelativuordereinut. Cntecul porni cu 5 bti. Owain i Vigdis ridicar minile, cu palma la nivelulcapului,cudosurilepalmelorlipiteidegetelentreptrunse.Astfel,fcur 5 salturi n sus. Era necesar o oarecare coordonare a gesturilor, pentru c era ilegaldesprindereadegetelor. Apoi ncepu melodia propriuzis. Se numea Frenezie i fusese un succes ncdelalansare.Fiecareipusemnadreaptpetmplapartenerei/partenerului i urm o nvrtire n acelai sens astfel nct s fie efectuate 5 rotaii complete. Scopulerabinenelespierdereaechilibrului. n continuare trebuiau s execute nc 3 srituri, pocnindui palmele de aleceluilalt.Apoi,cupodurilepalmelorifrunilelipite,tropirde3ori.Galezul iimagincicalcanpicioarepeticloi,pejavreledezgusttoare. Urmfiguraceamaigrea:cudegetelentreptrunse,dedataaceastans lipitefiindpodurilepalmelor,icupicioruldreptridicatsusinlnuitcudreptul celuilalt,trebuiaussenvrteasc,nsensinversfaadeprimul,executndnc5 cercuri complete. Apoi, ca la nceput, fcur 5 salturi cu degetele ntreptrunse invers. Totacestritualserepetade3oripeparcursuluneipiese,astfelnctdup ultimelebtisesimeauamndoiepuizai.Analiznduse,Owainconstatcmai dispunea de unele resurse, aa c propuse nc o reprezentaie. Vigdis accept, rzndfericit. Nu tia cum se numea cntecul urmtor, dar fata i zise c se intitula
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Wakefulness i formatiaautoare era din Statele Unite. Apoi nu mai vorbi, cci pierdeapreamultenergie. Lasfriterautranspiraiicdeaudinpicioaredeoboseal.Darislandeza maigsiofrmdenebunieiispuse: Haincunul!Cezici?Scdempejos! Scdem!fudeacordgalezul,fericit. Contrar ateptrilor, aceasta nu se ntmpl, cci ura putea fi o rezerv important,nebnuit.Deci,dupatreiapies,genstgen,semaimicauncpe picioare, totodat calmai, mpcai cu toat lumea. n sal nu erau bnci sau scaune,aanctieirncutareaunuilocundesseaeze.Mergeaumbriai, susinnduseunulpealtul,siminddinplinaerulrececare,deiarfitrebuitsi trezeascdinreverie,leproduceaunefectcontrar. Hoinrir toat noaptea, mai umblnd, mai odihninduse, i ajunser la cminnzori,moridesomnifrnideoboseal. nsOwainstatumulttimpnpat,nereuindsadoarmirememornd totceisentmplase,abiaabinndusesnuizbucneascnrsdebucurie.Dar nu reui prea mult timp aceast performan i hohoti ndelung,gndindusect denorocosputeaficteodat.Apoiselinitiisomnullcuprinse. UnsfritdesptmnpetrecutnntregimecuVigdis,liberisfaccele treceaprincap,distrndusemultmaibinedectdacsarfiduscuTom... Dar ce e frumos trece i luni veni negndit de repede, aducnd totodat amintirea nedreptii, din care nu mai rmsese ura, ci o amrciune surd i adnc, de care tia c nu va scpa foarte uor, ci doar atunci cnd i va putea nelegepeTomiceilali,cndlevanelegemotiveleiraionamentul,cndseva putea chiar identifica cu ei. Asta va fi posibil n timp, cci acum nu avea tria necesarsncercemcar. Nici nu aduser vorba despre excursie, i Owain cu att mai puin. Doar Brankoseapropiedeelntrunmomentcnderasinguriizisecregretfoarte multincidentul.iateptaserunsfertdeoriapoicinevatrseseconcluziacnu vorsmaivin. Arfivrutstiecineeraacelcineva,daridduseamacastanarfi ajutatplanuluideiertare.Arfitransformatdoarvinoviacolectivntrorfuial personal. Eramaibinesnusemaigndeasc,snuimaiaminteasc.Suiteis ierte. Continuredactareatezeifinale,dincarescriseseaproapejumtate. ntrozi,dupterminareacursurilorlafacultate,sepregteausmeargla cmin,cndsetrezirfanfacudoibrbainuniformedepoliie.Unuldinei iceruluiTomCIul,pecareapoilintrodusentrunminiidentificator. SuntetiTomL.? Da,rspunseacestasurprins.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Amdorisneurmaipentruefectuareaunuihipnotest. Ce?sesperieenglezul.Suntarestat? Testulvadecide. Vreaustiuacuzaiile! Ceidoipoliitiseprivir,apoiunuldineispuse: Cumnusunteisinguricumacuzaianuafostdovedit,acestlucruar dunaimaginiidumneavoastr. Ha! izbucni Tom. Se gndesc la imaginea mea, v dai seama? le zise el colegilor,carepriveaularndullorcuteamscena. Avei dreptul s refuzai hipnotestul, dar, dat fiind faptul c nu facei acest lucru din motive medicale, gestul dumneavoastr va fi considerat o recunoatereimplicitavinoviei. Daniopti: Maibinefnaibiitestullablestemat!... Englezul ntoarse capul, s afle i prerile altora. Owain, Andrei i Gina aprobarntcere. Bine,mormielapoi. V rugm s ne urmai, zise un poliist i l conduser la un AGM albastru,careplecimediat. Se desprir ocai, unii ndreptnduse spre metrou, alii spre antigravitomobileigalezulspreelectroscuter. Ajunincamer,Danncepusvocifereze: StiiclauprinscuCIurilefalse.Acuinevineinourndul.icnd tegndeticeulamndemnatsfactestul! ns nimeni nu lu n seama lamentrile sale, reflectnd care ar putea fi adevrataacuzaie. Dup trei ore intr pe ua Tom, cu un aer meditativ. Toi srir cu ntrebri. Mau ntrebat dac am ptruns n arhivele secrete ale Imperiului. Am rspuns c nu tiu nimic despre aa ceva. Atta mi amintesc. Dup hipnotest miauspuscaintratcinevanarhiveutilizndnumelemeu,darceclarceunu amcunotinelenecesarenmateriedecomputere.Miaudatdrumulimiauzis cdacaflucevanou,sledaudetire. Apoi se uit la fiecare n parte ptrunztor i se btu deodat cu palma pestefrunte. Cumnumamgndit?!Tutrebuiesfifost!vorbielamenintor,cuochii spreBranko. Acestaisusinuprivireaispuse: Eadevrat! Toisecutremurar. Darpotsiexplic!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ha!Astaibun!rseforatTom.Chiarsuntcurioscumaismiexplicic voiaismbagilacurat! Setrntipeunpat,cufaalamacedonean. Am descoperit accesul ieri. ntradevr, am intrat n sistem sub numele tu,pentructiamfoartebinectunutepreapricepiinaispoifiacuzat.Nu vamspuspentrucamateptatsifiefcuttestulluiTom,casnufiudescoperit nicieu. Darnafizis...ncepuenglezul,nsBrankolntrerupse: Cumnaifizis?Lahipnotest? Tomdduncetdincap,nsemnderecunoatere. Nu poi fi obligat s faci un test de dou ori pentru aceeai acuzaie, iar contravoastrnuaudovezi. Privinpmnt. Ei, acum vam mrturisit totul. Sper s nu mergei la poliie din proprie iniiativ... Selslinitea.Nimeninucutezasmaivorbeascdupceleaflate.Dup oateptarechinuitoare,Tomndrzni: Las,binecaifostsincer,mcaracum.Nucredcvaopticinevaceva... Darcedracuiatrebuitsintrinarhive? mi doream de mult asta. Mi se prea culmea pe care o poate atinge un piratinformatic. Auzi, pirat informatic!... n fine... Obiectivul urmtor care e? Capul mpratului? Brankonurspunse,privindtristnjos. Tare a mai vrea si dau un pumn n nas, dar te iert, ca s vezi ce generossunt. ntradevr,erageneros. Maigeneroscamine!gndiOwain,privindulruinat.nacelmoment, amrciuneadisprucomplet. Pestedouzile,Stjepanlcutimerseriarncameraaceeadelahotelul Muntenia.Atmosferaeraneschimbat,deparcsarfintorsntimp. 7suntem.Putemncepe,spuseiariRegina. De data aceasta, nu mai ntrebar de nsoitor i nui mai ddur s bea PotirulNesupunerii.Femeiavenidirectlael,lmbri,lsrutiizise: EtiOwainTurndeCymru. Dinnoulcuprinseostaredebeatitudine. Iatcsegndesccuadevratlamine! Fiidemndecinsteaaceasta! Voi fi, Regin! Cci ANS este viaa mea i nici un sacrificiu nu e prea mare! nclincapul,nchipdemulumire.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


ApoiReginasendeprt. 7amfost.Ceerascrissamplinitprinminilenoastre. CeremoniaaceastafusesemultmaiscurtdectIniierea,observgalezul. Darnuipsa,pentrucsegndealaonoareainoroculdeafinumitTurn.Simea crndpernd,toateisemplinesc.Acumnulmaiinteresaprereacelorlali,ci doarpropriasaprere. n camer, la cmin, era agitaie: administraia anunase comiterea infraciuniiiindemnapestudenisseprezintedebunvoielasediulPI,pentru efectuarea hipnotestului. Tom prea firete cel mai calm, totui Owain putea s observe tensiunea din spatele fiecrui gest. Branko sttea ntins pe pat, cu o expresiesugestiv:Totuldepindedevoi. Englezulncercsiliniteasc: NuvduceilaPoliie,cuniciunchip!Nuveifinniciuncazsingurii, pentrucmuliaucteopatneagr,carenuvorsfiedescoperit! Pentrugalez,acestesfaturieraudeprisos,pentrucnicinuconcepeasse ducsitrdezeprietenul. Previziunile lui Tom se adeverir. Abia jumtate din studeni acceptar testul,iafacereapreadejauitat. Era 1 iunie, o zi de care avea si aminteasc mult vreme. nc de diminea, cnd se pregtea s plece la Facultate, Stjepan l acost pe strad, optindui c a doua zi urma s aib prima misiune pentru ANS, i c detalii va afla atunci, pe loc. Owain se simi bucuros c poate s ajute Cauza i nclec electroscuterulzmbind. Profesorii i ndemnar s predea tezele pentru o verificare preliminar naintedeexamenigalezulconstatceraprintreprimiicareoterminaser. DelaUniversitatenusentoarsedirectacas,cimersefrniciunscop prinBucureti,parcntristatcvatrebuisplecenmaipuindeolun,astadac va putea, i i va sfri nc un episod din via. Un episod cruia nui dduse niciodat adevrata valoare, care simea ci va lipsi din ce n ce mai mult, pn ntro zi cnd alte bucurii vor lua locul ntristrii, cnd ali oameni vor lua locul celordeazi. Voi uita i voi fi uitat. M voi uita ntro zi n oglind, apoi voi privi o hologramvechede50deaniinuvoimaigsinicioasemnarentreceledou persoane. i m voi ntreba cnd am fost cu adevrat eu nsumi: atunci, cu experiena, sau acum, cu speranele i visurile. Poate voi fi un ratat, carei va aminti cu invidie, sau dimpotriv, bine realizat, amintindui cu ngduin. Voi ajungeoaresmursc?Mvoischimbavreodatntratt? O pal de vnt l fcu s se nfioare. Cerul era acoperit de nori negri i soarele abia se vedea ca un disc glbui n spatele lor. Era aproape ntuneric i se anunaoploaiegrozav. Se ndrept spre cmin, fr s se grbeasc ns, curios dac va ajunge
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


uscatsauudpnlapiele.Cndpipeu,primultunetcutremurpmntuli primiistropiizbiruscciunea. Delafereastrprivindelungfurtuna.Fulgerelepreaufocuridedincolo destelencercndzadarnicstaiecerulpentruaajungelael.Totodat,sesimea protejat,cciniciploaia,nicitrsnetelenulputeauatinge. Dar ncetncet, toate se domolir i, dei continua s picure, soarele se art dintro margine de nor. Deschise fereastra, primind recunosctor aerul schimbatdefoc,simindmirosulapeicenvinsesepmntul. Penesimite,gndullpurtdinnoulasensulvisuluiiidduseamac eraacummaiaproapedectoricnddedezlegareatainei. DeiluasenseriosceeaceiziseseVigdis,nuerapedeplinconvinscera i adevrat. Se ntreb de ce i dduse incontient o semnificaie negativ. Cut dincencemaiadncideodatdescoperiiselumin:lasociasecu666!Totui, 999eraun666ntors,ceeacentreaspuselefetei.Acumtiadecesimiseaa,mai rmneadevzutcareeraadevrul. 9tindespre10,seapropiedeperfeciune. Darnuoatinge!nbaza7,666estedespritde1000deosingurunitate. Lafelca999,nbaza10.Attdeaproape,darcutoateasteaimperfect! Iat cum dou numere puteau fi n acelai timp opuse i egale. Dar egalitatea simbolic era mai puternic dect opoziia. Imperfeciunea, n contrast cu desvrirea. Simea cu toat fiina c aceasta era explicaia. Primul mprat l avertizase! n acea clip, o veche senzaie de groaz fr margini reveni din ntunericul subcontientului. Amei i czu, fr s simt altceva dect fric. i deodat o senzaie de infinit libertate i lumin alung spaima i se nl nuntrulsu. irevenipepodea,cuodureresurdngenunchi,dariveneaszboare debucurie,fiindctiacboalaseduseseitoateneplcerileluasersfrit. Seridic,fuginsufragerieisetrntifrgrijntrunfotoliugravitic. Ce senzaie plcut! Ce senzaie uitat! Rmase aa mult timp, pn cnd se ntoarsercolegiisidecinetieunde. Tom, vznd ua dat la o parte, intr i holb ochii, nevenindui s cread. Le fcu semn cu mna celorlali, fr s poat deschide gura, i toi se adunarnjurulgalezului. Cesantmplat?opticugreuGicu. Owainauziglasulcadelamaredeprtare,abiaptrunzndprinscutulde fericire.Deschiseochiiiiprivizmbind. Suntvindecat!nsfrit,suntvindecat! Insistar, ns galezul nu le rspunse, aa c renunar pentru moment. Apoiseridicdintrodatiiei,hotrtsicumpereunAGM. Se ntoarse la cmin spre sear, ntrun antigravitomobil rou. Nu era cel
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


maiscumpmodelpecarelgsise,ciunulcareiprusedelanceputdrgu. Apoilearunccelorlalioexplicaiesumar,ceranormalssevindecela feldebruscprecumsembolnvise,isedusesseuitelaholovizor.Lafelispuse iluiVigdis,cndontlnilaUniversitate.Contrarateptrilor,eanuinsist. A doua zi, pe la ora 17, fu chemat de Stjepan, care i aminti de misiune. Owain se simi imediat mgulit de importana ce i se acorda, i n acelai timp curios. Croatul l atepta jos, plimbnduse nervos de pe un picior pe altul. De cumlvzu,lndemnsintrentromain,fcndtotodatielacelailucru. Stjepanseaezpeloculoferului,iarOwainpebanchetadinspate. tiicamavutAGF? Cellaltntoarsecapul,derutatdeafirmaialatrecut. Abiaacummamnsntoit.tiai? Deundestiueu?Suntdoarunpionnenorocit.insoitorultu. Invidie! Sesimeafoartebineiacumaveaiunmotivnplus,ccilcitiseatt deuor. Croatul i ntinse o casc transparent i l ndemn s io fixeze pe cap. Galezul vzuse i n filme aparate de acest gen: puteau mpiedica nregistrrile holograficealefeei,printrunsistemingeniosdedevierearazelorlaser.Totodat, la nevoie devenea opac privit din exterior, astfel nct purttorul s nu fie identificatnicinmodnormal. Stjepanseechipasemntoriispusesactivezeielambeleprotecii. Vzndul c nu tie ce s fac, ntinse mna i atinse dou taste aflate n zona urechii drepte, neobservate de Owain. Apoi croatul se ntoarse i program computerulspreodestinaienecunoscut. Undemergem?ncercagalezul. LauncentrualServiciuluiSecret. Problemadeveneaserioas.Owaintianmodsigurcfceaunlucruru, darvoiasajute,sductotullabunsfrit,sinvingfricaisdemonstrezec sepoatecontapeel.Maimultdectorice,setemeasnudezamgeasc. Careemisiunea? Repliciscurte,precise.Cenaiba,mcredntrunfilmpoliist?! IeriafostarestatunCalalANS.Trebuieslelibermnaintesisefac hipnotestul. Decenuilaufcutieri,cndlauprins,caluiTom?! Seabinusntrebe,ccieranmisiune,nulacoal. Avemarme? Nutiaceivenisedeodat. Stjepanclatindincapiizisedur: Dacinchipuicceeacefacemnoiacumeoglum,trebuiasfirmas
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


acas.Nuemomentulsibaijoc. Atuncicumleliberm? Nuleliberm,leliberezi! Galezulsimiunfior.Darnuavearostsfacscene. Cum? Intriispui:VreausmiopredaipeCristinaL.,arestatieri. Owain fu de trei ori uimit: c Stjepan i putea pretinde o asemenea absurditate,cpersoanamisterioascuranguldeCaleraofemeiei,nunultimul rnd,caceastaeraromnc,celpuindupnume.Nuiputeadaseamadeceun romn ar face parte dintro organizaie antistatal. n definitiv, Imperiul era Romn. Darnosmianseam. Astamisaordonatsitransmit. Cerece! Abia acum realiz impresia de irealitate. Era att de puternic nct no observase n mod contient mai devreme. Totul era ca ntrun vis i deci orice se puteantmpla. Ajunsermairepededectsarfiateptat.CndAGMulseopri,Stjepan, frslpriveasc,ispusescurt: Dute. Owaincobor.nacestlocnumaifuseseniciodat,darierarelativuors se orienteze, n primul rnd datorit holofirmelor. Intr n filiala 5 a SS15, o cldire care nu atrgea prin nimic atenia. Era la fel de frumoas sau urt ca oricarealta.Launbirou,cuunintercomputer16nfa,segseaunbrbatmbrcat nuniformaspecific:albcumnecinegre. Galezului i veni n minte c albul ar putea semnifica scopurile iar mnecilemijloacele.Spertotuicadeduciasnuseadevereasctocmaincazul su. Pentru un moment, realiz c uitase ce trebuia s spun. Brbatul l privea ntrebtor.Banu,suspicios!Apoiiaminti,darnuavucurajulsdeschidgura. Doar ANS mau apreciat. Le datorez asta, chiar dac voi fi nchis i eu. Niciunsacrificiunuepreamare. Vorbipeuntonrstit,lacarenusarfiateptatniciel: VreausmiopredaipeCristinaL.,arestatieri! CellaltnlemniiOwainivzuprivireangrozit.Reuisngaimeceva degenulImediat,apoincepuscomandeintercomputerului.Dupaproximativ 30 desecunde, ou se deschise iapru unsoldat, tot nalb/negru, escortnd o femeie. Chiarmaascultat!Cenaibasentmpl?
15 16

ServiciulSecret intercomputerulnuaveatastatur,comenzilefiindexclusivverbale

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Predio! zise scurt brbatul de la birou, probabil superiorul lui, dei galezulnuiputeadaseamacegradavea. Uite,niciodatnumauinteresatchestiileasteaiacumnutiudacsi spunMulumesc,colonelesauMulumesc,generale. Amneles,domnulecpitan,irspunsesoldatul. Owainoapucdebraisegrbisias,nunaintedealeordona: Nuraportainimic,nudaialarmainuneurmrii! ApoisentoarserifugirspremainaluiStjepan,deinumaieraniciun pericol. De cum urcar n AGM, acesta porni, cci croatul fixase destinaia ntre timp.Nimeninuscoteauncuvntigalezulstteacapeace.Curiozitateacretea n el cu fiecare clip i noi ntrebri i veneau n gnd, dar se strdui s se controleze. Realiz c mai avea nc pe cap cascaminune i se chinui s io scoat. Aveacelpuincevadefcut.Ceilalipreauncontinuarelinitii. Numaieumagitcaprostul! Conversatiaeinterzis?ntrebel. Intenionase un ton ct mai nevinovat (M scuzai, nu e treaba mea, totui...?)nsvoceairsunsarcasticiarogant.DoarCristinantoarsecapul spreel,dezaprobndulidispreuindul(Ce,dacetiTurn,crezicnoisuntem gunoaie?). Owainavuunprimimpulssicoboareochiinpmntsauspriveasc aiureapefereastr.Darapoirealizcnufcusenimicru. Nucefaceunomesteimportant,cicegndetecndfaceunlucru. Aacoprividreptnochi,iareanuisusinuprivirea. Cinelesusineprivireaomului,lupulnu. Continusoobserve:aveanjurde40deaniiera,poate,ncdrgu. Miarputeafimam!descoperigalezulizmbi. Eciudatcumpoateunsursstrasformeofa. ncerc s io nchipuie fericit, dar nu reui, aa c se plictisi i privi afar.Spresurprinderealui,ieeaudinBucureti. Undemergem? Stjepan,cucapulncomingeopac,nucatadixisirspund. Curiozitateaibunadispoziieisetransformarniritareilehamite. Duceivladracuamndoi! Intrar pe autostrad i viteza ncepu s creasc vertiginos. Aproape i doreasfirmasparautistdectsiapartelachestiaasta.Erancmndruc ajutase Organizaia, dar regretele se nmulir i ajunser dominante. Fcuse un lucruilegal,dardeastaipasamaipuin.Fcusensunlucruru,asupracruia fuseseavertizat,ipedeasupranimeninuimulumea,nuirecunoteameritele,de parcarfifostobligatseliberezeunarestatalSS. Saupoatecamfostobligat,frsmidauseama!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Revelaialzdrobi. Am crezut c sunt liber i ajut din proprie iniiativ, cnd de fapt eram foratincontientdejurmntulacela,probabilsubhipnoz. De ce nu se gndise mai devreme? Nui fusese ngduit? n 2 zile i schimbaseradicalprereadespreANS.OdatcuncetareaAGF.Cesentmplase nrealitate? Parc mia fost ntunecat mintea! S fi avut mai mult dect AGF? Sau poatemamvindecatdemaimultdectdeAGF?! Simeactotcegndeaeraadevrat.icrescuseputereaintuiiei.Dece? Cum am pututo elibera pe femeia asta? Paznicii pur i simplu mau ascultat. ivenioideeizmbi. Oprete!serstiel. Conform (sau contrar?) ateptrilor, viteza sczu i AGMul se ndrept sprebenzilelaterale,apoiseopri.Stjepannuvorbi. Ateapturmtorulordin?!Decemofiascultat?FiindcsuntTurnsau amdarulsta? Senfior. Deceteaioprit? Aaaiporuncit. Rimeaz. Dardeceteaisupus? Croatultcuoclip,apoispuse,peaceeaivocedemain: Nutiu. FiindcsuntTurn? Nu. Aha! Cineiazisdeaciuneadeazi? nsoitorulmeu. Seopunedintoateputerile. Cineestensoitorultu? GeorgePiondeRomnia. Namauzitnviaameadeel. Trebuiasschimbepista. Cumiexplicicameliberato? Dupopauz,cellaltrspunse: Nutiu. Probabilsecerceteazdincencemaiadnc,casmmulumeasc.i cndajungelafundNutiu. SentoarsespreCristina: Tucumiexplici?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Einuiamordonatdirect! Rspunde! Expresiafeeiisemodificvizibil.Erasperiatitotodatlinitit. Aiputerea. Firete! Ceeputerea? Nutiu. Owainschiungestdeexasperare,apoisecalm. tiaictevoielibera? Da. Deunde?Povestetetotcetii! Sesturasestotscoatcucletelerspunsuri. nsoitorulmeu,IoanCaldeRomniamiaspussmpredaupentruc voifieliberat. Decifuseseunexperiment.OwainCobaideCymru. i veni deodat o scrb imens de toate i nu se mai simi n stare s continueinterogatoriul. Uitaiamndoitotcevamntrebat!Stjepan,pornete! Fruncuvnt,acestaapsbutonuldereluareacursului. Merser o jumtate de or, apoi AGMul opri ntro pia dintrun ora necunoscutifemeiacobor.Galezulnicimcarnuseuitlahartadebord,pentru aaflaundeseafla,darauziofrnturdedialogntredoitrectori.Vocalelenchise iconsoanelemuiateledificar:nuputeafidectnMoldova. Nudegeabaamfcuttezadespreaccente! Portierarmasedeschisdoarctevaclipe,apoipornirdinnou,probabil napoi.iapruoposibilitate:svizitezeoraulacesta,nsieralenesdeschid dinnougura,casiordoneluiStjepan.Nueranumailene,ciimil.Eratotuiun om,nuomarionet.Unomcarearfipututpoatesifieprieten. De cum ieir din ora, croatul i scoase casca. Prea ci venise chef de vorb: nelegcafostprimatamisiune,darnutrebuiasteambaleziatt! ntradevr,uitaseceeramaiimportantiserefereadoarlatentativelelui euatedeadestindeatmosfera. iapoi,nutrebuiasiscoicasca.Daceprinsiariteddegol? Chiar i pas de mine? Sau, indirect, i e fric pentru el? E vinovat alturi. Apropo,ceoraafostasta? Cellaltlprivicuuimire: Nu teai uitat pe indicatoare? Iai se cheam, al doilea c mrime n Romnia. ialosutdoileanImperiu.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


icetreabavea...CristinanIai? Nutiu,aamisaspus:dupceoeliberm,mergemnIai,easedjos, apoinentoarcem. LuiOwainnuiscpfaptulcuoeliberm. Darfie,treacdelamine... Revenilaoideemaiveche: Nu pot smi dau seama de ce sar nrola un romn ntro organizaie antiimperialiimplicitantiromneasc! Croatulridicdinumeri:Nebunigsetipestetot. Rspunsulnueraacceptabil.Numaiastziaflasedetreiastefeldemembri, icusiguranmaierauialii.Nuputeaufitoinebuni.Darcescopurmreau? PreluareaputeriintroRomnieindependent?Posibil.Cutoateastea,nuiputea prividectcatrdtori.Mcareleradintroprovinciecarenuavusesemainimic dempritcuRomnianaintedeImperiu.Erafirescsidoreasclibertatea.Dar arfifostcuadevratlibertate?Unireaaveaiprileeibune.nitdbeendstrongr us.17 Cine naiba spusese asta? Fusese oricum dup cucerirea Angliei. De fapt, i acestecuvinteputeaufiinterpretatedrepttrdare. Ct de relative sunt aceste noiuni: trdare, dreptate... Totul depinde de pe ce parte a baricadei priveti. Florin I a cucerit Europa i afcut un lucru bun, pentrucareuit.Dacnureuea,arfifostprivitideromnidreptundezaxat care a dus ara la pierzanie. Totui, cum a reuit? Totul era practic mpotriva lui. Totulerampotrivamea,pnacumctvatimp.Ceeoareasta?Nevoiademodel? Paranoia? Cndsosirnfaacminuluieraaproapentuneric.SedesprideStjepan iurcgrbitncamer.CeilaliinchipuirprobabilcseplimbasecuVigdisi galezul nu fcu nici o ncercare s le schimbe prerea. Venise la timp pentru a prindetirile.Prima:atentatulteroristdelaIai.ntrunmagazin,cudoaroorn urm,explodaseobomb,careomorsepatrupersoaneirnisealtezece,printre care o feti de 6 ani. Urmau imaginile de la spital, cu fetia bandajat urlnd n primplan. Sepresupunecatentatulncnerevendicataparineorganizaieiteroriste ANS. Owainsimicutotsufletulceraominciunsfruntat,deitoatedovezile artaucontrariul.Nuiputeanchipuicumcinevaiaromorpropriiconaionali, nnumeleuneigrupristrine.EratotuisecolulXXI.Apoincercareajosnicdea discreditaANSiastrniurampotrivaeicuajutorulinstinctuluieraopracticde dezinformaresentimentalbinecunoscut.iamintimnecilenegre.Decearfi fosttotuiANSmaibundectSS?Sesimiluptndcutoatluciditateampotriva lipseideimparialitatedecareddeadovad.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Suntimplicat.Suntimplicatfrvoie.ntrunfel,eochestiemasochist. E greu s lupi mpotriva propriei inimi. Sau poate nui deloc aa. Hipnoza se adreseaz minii. Lupt cu mintea mpotriva proprieimini! Probabil numai oalt edindehipnozmarputeavindeca. Descoperi c nui mai era fric de hipnoz, pentru c se crease deja un precedent.tiactederuictedebine. Cele mai multe sentimente de fric sunt date de necunoatere. Aici intervine imaginaia. Dar de ce aceasta sporete latura negativ a fenomenului? Datoritpesimismuluidinom. Reieea c fusese pesimist. i el care se considerase dintotdeauna o fire optimist!Eraonoudovadadualitiicaracteruluisu.iamintizicala:Spun csuntpesimistpentrucsuntoptimist.Dardacaififostpesimist,ceaifispus? Afitcut. Casvezi!Amajunsdelaatentatlapesimism! Privi la colegi, care urmreau cu atenie interviurile luate martorilor oculari. Oare ce gndea Branko? Oare mai erau i alii membri ANS? ncepu s asculteiel,nsvnndinexactitiiremarcitendenioase.icinecaut,gsete. Reporterantreba: CepedeapsconsideraicsecuvinemembrilorANS? S fie omori, la fel cum iau omort i ei pe copiii tia! rspundea o femeiecarepreainteresatdeorice,maipuindekilogramelesalenplus. Instigare! nprimulrnd,evenimentulnufusesencrevendicat,iapoi,cetrebuia fcut?Reintroduslinajuloficialpentruunatentat? Cedracuecumine?Deundeattapatim?Emaigravdectcredeam. Se concentr, ncercnd s respire regulat i s se calmeze. Avu noroc c reportajulsenchei,fraltecomentarii. Totui,ultimaimpresiermneceamaiimportant.Snuiconcediezipe toi? Ziua urmtoare era joi i, din cei spusese Vigdis, era ziua lui norocoas. De diminea afl c administraia dduse un avertisment tuturor studenilor n searaprecedent,cuprivirelahipnotest.Vaszic,nufuseseuitat.Sedovedisec sprgtorulnuputeafidectcinevadincminiastfel,celpuinteoretic,trebuia s fie mai uor de prins. Spre surpriza lui, mai afl c doar 7 studeni nu depuseser mrturie pn atunci, i erau ameninai cu excluderea din facultate! Iatgenuldetiremenitslnveseleascnziualuinorocoas. Branko i romnii plecar spre Universitate gnditori, iar Tom i urm ndeaproape,nemaitiindceszic. OwainseurcielsupratnAGM.Aveadealesacumntreviitorulsu (ialaltor5)itrdareaunuiprieten.Unprietencareavusesencrederenel.Un prieten care se dusese pe o vreme groaznic acas ca si aduc bicicleta. Un
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


prieten carel fcuse bogat. Carei ceruse iertare pentru nechibzuina tuturor. Ce drept avea el acums mearglaPI pentru test? Hotr c nu vaface acest lucru, oricarear fi consecinele. Totodat,spera c unuldin colegi,sau chiar Branko,s cedeze. Dupterminareacursurilor,orugpeVigdissseplimbepuinmpreun, ntructaveacevaimportantsispun.Fataseartmiratiaccept. Tuaifcuthipnotestul?ontrebel,nlocdeintroducere. Da.Dece? Eunulamfcut. Islandeza l privi ciudat, parc nspimntat, dar i curioas n acelai timp. Aivreunmotiv? Da.Darmainainte,vreaustentreb:cefacidacfaciunlucruru? Easegndioclip,apoirspunseezitnd: Credc...ncercislndrepi. Discuiaastanuducenicieri.Maibineizictotul. n fine, l cunosc pe sprgtor. Dar nu m pot duce la poliie. E prietenulmeu! Dartermenullimitemine! Iauzi! Dacnuteduci,ali6vorfidaiafar.itulafel.Presupuncprietenul staaltunuiafcutnicieltestul. Nu,firete. Atunci,pentrueletotuna!Oricumvapierde.Darveipierdeituodat cuel. Eraoperspectivnou.Galezulnusegndisepnacumlaea. neleg,dar...cumsispun?elnseamnmultpentrumine.Acrezutn mine.Nuvreausfieprinsdatoritmie.Adaoricesfiealtcineva! Decilmaicunoscialii! Da. Nuedelocprevztor. Aavutncredere!Nupotsifacunacaasta! Teneleg,darmaigndeteteodat.Soartaluiepecetluit.Destinultu depindedetine.ipoate,destinelealtorcinci.Gndetetelaei!Suntsuspectaide ocrimpecarenaucomiso.Desigur,aualtepcate,darpcatulacestanu! Simea c fata are dreptate. Dar cum sl trdeze el? Tocmai el?! Parc ghicinduindoiala,islandezaconcluzion: n toate exist un plan fizic, o explicaie psihologic i o semnificaie transcendent.Depild,uncopilaruncopiatrcareloveteunAGMiomoar doi oameni. Planul fizic e nsi aciunea lui, aruncarea propriuzis. Explicaia psihologicestedatdemotiveleluiceagnditcopilulnaceaclip.Apoi,cea
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mai important, semnificaia transcendent. Ce sfrit tragic dintrun gest ce aprealanceputcompletinofensiv!Cinespuneastanusegndetecastatrebuia s se ntmple. La fel i fapta ta, dincolo de toate, reprezint doar ceva necesar. Trebuiessefacdreptate. Cediscursfatalist!zisetristOwain.Aae.Dardreptateameaeaceeaicu dreptatealui... EractpeceszicBranko. ...prietenului? Aceastadejanumaieraontrebare,cciVigdislconvinsese.iexprima ultimelerezerve,ultimelendoieli.Fataidduseamainurspunse. Cumdemnelegiaadebine? Aiauzitdecomunicareempatic? Hm...mntrebdacieuteneleglafeldebine.Miadori,stii.Mia dorifoartemult. Poateidoreticevaceairealizatdeja. Poate... De ce nu mai vrem un lucru odat ce e al nostru? De ce vrem mereucevanou? Dacnutemulumeticupuin,nuteveimulumicunimic. Celegturaentrehipnotestidorin? Dacnuvezilegtura,nunseamnceanuexist. Nusereferiselael;vorbisengeneral. ntretoatetrebuiesfieolegtur. ntretoate,ntrifata. Sedesprirntcere.ApoiOwainlvzupeStjepanialergspreel.i zisectrebuiesivorbeascReginei.Lanceput,croatulnicinuvrusaud,dar galezul insist, spunnd c e ceva foarte important. Se feri si ordone, dar era contientc,daccellaltnuseartarezonabil,nuarfistatpreamultpegnduri. Svdcepotface,rostiselaurmaStjepan. Imediat ce ajunse la cmin, croatul l chem prin computer ii ddu un numrlacaretrebuiassunedelaunaparatpublicnjumtatedeor.Owainmai cnusarinsusdebucurie,apoizburpescrispreAGM. Fu nevoit s atepte douzeci de minute, micnduse nervos de pe un piciorpealtulintrebndusecesperadefaptsafledinconversaiaurmtoare. Lamomentulfixat,dupoclipdepanic(Amuitatnumrul,tmpitce sunt),introduseCIulncomputeriformcombinaia. Imediat,nholoscrinaprufiguraReginei.Diferenaerasimitoarefade chipuldinpenumbr,darnuaademareprecumseateptase.izmbea. Ceeste,Owain? Pentruoclip,intimidat,nureuisdeschidgura.Femeiacontinusl priveasc blnd, ncurajator. Putea fi aceasta o persoan malefic? Era posibil s greeascattdemult?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


AvreastentrebdespreBrankoL. lcunosc.ENebundeMakedonija. Ce? nochiiRegineiscproscnteiedespaim. iefricsnuiordon? Reveniladialog. Nebun?imiaspuscafostlaIniierenurmcuosptmn! DecndenOrganizaie? Nutiuexact. Maimultdeolun? A,sigur!Devreo3ani. Decemaminit? ProbabilctiideArhive. Da.Brankoneatransmisconinutullor. Decimacedoneanulfcusemultmaimultdectosimpldemonstraiede informatic. Dumanul trebuie distrus din interior. De fapt, Branko nu minise dect o dat. i atunci, de ce a fcuto? Putea s zic doar Am fost i eu la Iniiere.Probabillluasegurapedinainte. Reginainterpretpauzagalezuluicapeoinvitaiedeacontinua: Dinarhiveamaflatidespretine. Owainavucuadevratunoc. Cescauteunarhivelesecrete? Ceaiaflat?ntrebel,moale. CaveaiAGFTicurmasfiiunconductor. Privireaperplexodeterminsexplice: Probabilcnartrebuisispunasta,cciamaflatdehipnotest.DarANS se bazeaz pe ncredere. i tu eti Turn. AGFT nseamn antigravitofobie temporar, o boal foarte rar i care se deosebete de cea genetic. Principiul e camaa:dinmotivenecunoscute,sistemulnervosncepesreacionezenegativn prezena antigravitonilor. E nevoie de 8 luni pentru ca organismul s dezvolte o aprareeficient,iarlasfrit,odatcuvindecareadeboalapropriuzis,aparei capacitateadeaimpunevoina.Sarputeasfieochestieasemntoarehipnozei, darnimeninuadescoperitcumfuncioneazdefapt. Bineneles, procesele fundamentale sunt necunoscute. Nu cunoatem dectceeaceneepermis.imaufcutTurnnudindragoste,cidininteres,nu? Adic,uite,noitefacemfrumuelTurnituneajuisrsturnmImperiul. Concluzialogicsedesprindeaclar,nseltotnureueasuiteIniierea. Dareratimpulsiasculteraiunea,aac,deinuodorea,ntrerupselegturai sentoarselacmin. naceeaisear,cutndlantmplareprinfiierelecupoezii,ddupeste FlorinL.iPatru.itrecuochiipesteea,frniciunscopprecis,ilasfritavuo
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


surpriz. Steleningdincerulnegru Pesteaapelorblesteme. Reciti poezia, nevenindui s cread. De cel minise Vigdis, cu atta siguran? Nu venise nc timpul? Acesta era unicul rspuns posibil. Timpul era acum. Toisenvrtnjurulmeu,apropiindumsaudeprtndumdeadevr. Darceeacestadevr,dinmomentcejoculloreattdecomplex?Mtrscspre fiecare urm, fr s vd dac m duce nainte sau napoi; m leg de fiecare speran, fr ssimt dac e curat sau ntunecat.i la sfritmi dau seamac amalesdefiecaredatgreit.Darlafiecarentoarcere,amctigat. Gndul acesta i ddu putere. Mai trebuia acum s neleag semnificaia versurilor.Aceastaiveniattdeuor,nctnicinumaipreaunraionament,ci doar o adiere de cunoatere. Fiecare rnd sugera un element, nvase asta i la coal.Vigdiserabalan,deciversulaltreilea,aerul,odefineapeea.Alpatrulea, apa, l reprezenta pe el, cci era pete. i Vigdis l susinea, i ddea noi fore, n ciuda tuturor necazurilor i interpretrilor, n ciuda deprtrii, deocamdat neobservat,lafelcumsteleledincersetransformaunninsoare,pentruaacoperi blestemeleapelor.Trebuiasoasculte,soajuteslpoatajuta. Era doar o simpl unealt a destinului. Se hotrse s mearg n ziua urmtoare pentru hipnotest. Acum, cnd decizia fusese luat, nul mai chinuir nicindoiala,nicincrederea.Acestcapitolsencheiase. Totui,Brankonueraal9lea. Adouazi,dupcursuri,sedusedirectlasediulPoliieiImperialeiceru un hipnotest. Fu identificat i apoi i se puse la dispoziie un hipnolog. Mai bine spus,elfupusladispoziiahipnologului.LiserepartizimediatosaliOwainse gndicproblemeiiseacordoateniedeosebit. Cameraeraperfectcubic,cupereiideunalbastrulinititor,frferestre saualtelegturivizibilecuexteriorul.Chiaruaabiaseobservanfonduluniform. Se prea c pereii nii radiau lumin, cci nu existau alte dispozitive potrivite acestuiscop.ncpereaeracompletgoal,cuexcepiaadoufotolii,aezatefan fa. Hipnologul l invit cu un gest al minii s ia loc pe cel din stnga. La prima vedere putea fi considerat o dovad de plictiseal. Dar aceast meserie, presupuse galezul, impunea, din contr, o atenie deosebit pentru fiecare caz n parte.Doaroimpresiededezintereserasuficientpentruuneec. Cumtenumeti?lntrebcellaltprietenos,decumseaezar. Suntconvinscvisacomunicat. Apoizmbi,dnduiseamacatitudineaaceastanuprevesteanimicbun. Scuzaim.SuntOwainLlyn. Hipnologul se prezent i el i insist ca galezul s i se adreseze la
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


singular. Astafacepartedinctigareancrederii,nu? Da,ajut.Laurmaurmei,trebuiesteconvingstelainminilemele. miplacecesincer. Odatceamvenitaici,nusededuceimplicitcsuntdeacordcuasta? Simiinstantaneucpuseseontrebarestupid,lacarepreferasnuise rspund.Darbrbatulnuliert: Unaesfiideacordnprincipiucuhipnotestulialtasfiifanfacu mine,cuochiinminteata. il imagin cu ochii bulbucai deasupra lui, eventual cu spume la gur. Hipnologulrealizcmetaforaluifuseseneleasaltfelisegrbisindrepte greeala: iaiformatoimagineostil.Rolulmeuestelinitesciseparecpn acumamfcutexactcontrariul. Dimpotriv. Discuiile acestea, n care adopta o atitudine complet defensiv, interiorizat, l distrau. Deodat i veni o idee: ce nevoie era de hipnotest? Ar fi pututfoartebinesdeaodeclaraiecontient.Decenusenscusecutreizecide aninurm? Cearfisncepemdinnou? Cuprezentrile?Caladeseneanimate. Zmbi.Cellaltobserv. Lacetegndeti? Lanimic. Eosituaiepenibil!Dacafieunlocullui? Ladeseneanimate.Cndaispus...aispussolumdelanceputmia venitnmintesecvenaaceea,ncaresefacdinnouprezentrile. Hipnologulridicielcolurilebuzelor. iplacdeseneleanimate?lntrebOwain. Amdoicopiimici.Cndseuitei,muitieu. Teamntrebatdaciplac,nudacteuii. Presupuncnueunsubiectpreainteresant,ziseconciliantgalezul. Banu.Faptulcleurmretispunemultedesprecaracterultu. Sensibilitate.Naivitate.Tottacmul. Snentoarcemlatest.Vreisdaidefaptodeclaraie?Sausperisgsim mpreunceva? ...cenampututgsisingur. Nu,vreausdeclarceva.Strdezunprieten. Sesperidecespusese.Doarerahotrt. Trdarea e un lucru ru. Dac vrei si faci ru, nseamn c nu ie prieten.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Banu.nseamnceunuisuntprieten.Tottimpulajungemsfacemru celorcarenefacbine. Cellalttcupuin,analizndvorbelegalezului.Apoizise: Facem i bine i ru. Tuturor. Dac o persoan are o atitudine pozitiv fadenoi,atuncicndifacemrusuferimalturideea. Da.Oaresuferimpentrunoisaupentruea? Pentrunoi.Pentrucsuferinaeinefaceipenoissuferim. Decisuferinapentrualtuleegoist?Dacpunemproblemainvers,facem binecsnebucurmalturi?Altruismulnsuieodovaddeegoism?Decichiar dac na fi venit azi aici, a fi fcuto tot din egoism? E totuna? Chiar aciunile melenuconteazdeloc? Aciunilefiecruiaconteaz.Uite,spresupunemcnumafinscuteu. Ai fi avut acum n fa pe altcineva. Poate chiar ar fi fcut o gaf, care tear fi determinatsplecisuprat.Ieindgrbit,aififostomortdeunAGM. Mersi. Teamconvins? Mai. Hipnologullprivipuinnelmurit. Voiaiszicydych? Bun...tiicummergetreaba? nmare. Atuncituostrebuiascsteliniteti.Fotoliulecomod,nu? Esimpatic.Observiambiana!... Mda. Ofer toate condiiile, nu? Acum despre fotoliu: ca s grbesc relaxarea, voi declana un cmp antigravitic. Asta ajut i la receptivitatea hipnotic. Adicspunetot. Camaa.Slbeteuorrezistenasistemuluinervos. Dareusuntacumimun! Nu e curios cum pot interaciona dou lucruri aparent diferite? spuse hipnologul. Ceerealiceeaparen? Lacentrebaresepoaterspundeilacarenu? De ce se rspunde la o ntrebare tot cu o ntrebare cnd nu se tie rspunsul? Decesnuparisuperior?Decesnucreadcellaltctutiirspunsul, cnddefaptitulcauinel? Owainnugsireplica.Hipnologulnudduimportanvictoriei. Sperciamctigatncrederea. Binenelescnu! Zmbetulsusugeracutotulaltceva.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Perfect. ncceva!Trebuiesaiomulimedeclieni... Treipezimaxim.Deinupare,eomeserieobositoare. Cred.Darmaicredcniciunuldineinureprezintcevadeosebitpentru tine.Ciaintrunan?ntrovia?!Euosmiamintescpoateipeste20deani detineideedinaasta.Tuaismuiipesteosptmn. Cellaltnicinuncercsnege,fiindcarfiprutridicoldefals. Speramcatocmaiprinacestecuvintesiatragatenia. Nusuntsigurdacsizicsaunu... Privireagalezuluilndemnscontinue. Nicinutiicimispunasta! Vaszic,tocmaiastfelmamcufundatnmulime! Suntmultmaimuliceicenauspus. nprimii100.Ceconteaz? Nuconteaz. Aputeasmopunlahipnoz. Putemfolosicaleaartificial.Unfluxdeinfrasunetearaveaacelaiefect. Aa procedm cu infractorii dovedii, prini n flagrant, ca s recunoasc. Pe tine nuteoblignimenisfacitestul.Poipleca,dacvrei. Spercnuteaisuprat! Arfiogaf. Mbucur.ieumaivreaustriesc.Aac...sncepem! Traseaernpiept,deparcsarfipregtitcahipnologulsideaunpumn nnas.AcestaapsotastdinbrauldreptalfotoliuluisuiOwainsimiefectul antigravitaiei.Selinitii, subndemnurile celuilalt, ncepu s coboare treptat n ntuneric. Deschideochii!rostiStpnuliOwainsesupuse. n momentul acela intr n camer un brbat necunoscut i se aez pe braulstngalfotoliuluihipnologului. Elsunteu!Aineles? ntradevr, galezul l privi din nou i i ddu seama c cei doi erau aceeaipersoan.Doutrupuricuaceeaiidentitate.Iseprupuinciudat,darnu ddupreamareimportan. Stpnuldepebralntreb: tiicevadesprespargereaarhivelorsecrete? Da. Cineafcuto? BrankoL.dinMacedonia. ncescop? SdeainformaiileANS. CunotipersoanecarefacpartedinANS?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Da. Enumerle! Anne Regina de France, eu, Stjepan Pion de Hrvatska, Cristina Cal de Romnia,BrankoNebundeMakedonija... Maitiadounume,darnuicunoteapersonal,aacnumaizisenimic. Selstcerepentruunmoment,apoiceldepebravorbi: Aiavutantigravitofobie? Da. Decndpncnd? Depe1octombriepnpe1iunie. Acumetivindecat. Owainnurspunse,fiindcnuiseadresaseontrebare. ietiloialmpratului? Loialitateanunsemnaaprobaresaurespingere,ciobligaie. Da. Bine. ntoarsecapulspreStpnuldinfotoliu: Espicher.Aranjeazl! Apoi se ridic i iei din camer. Rmaser din nou singuri, fa n fa. Ochiinegrieraupentrugalezcentruluniversului. iefricdeceva? Da. Dece? Nulinteresamotivul,ciobiectul. Desintetizatoare. Dece? Acumda. Mamcurentat. Traieteaceaamintire. Suntsinguracas.Sintetizatorulestricatitatamiainterzisscntpn lrepar.Darsuntsingurivreauscnt...Cnt.Ritmulnuebun.Aaa! Owainipiiacoperifaacuminiledesuferin.njurprintredinii hipnologulsegrbislcalmeze.Apoiizise: Nu tea durut! Nu tea durut deloc! Cni fiindc i place s cni! i placescni!Nuiefricdesintetizatoare!Aineles? Da. iefricdesintetizatoare? Nu. iefricdeceva? Nu. Etilegatdeceva?
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Da. Dece? De ANS. Nici un sacrificiu nu e prea mare pentru cauza noastr. ANS e viaameaiviaameaeviaalor. Cineiaspusacestecuvinte? Regina. Regina tea minit! i vrea rul! Nu ai ncredere n regin! ANS este dumanul!Aineles? Owaintcu.Nueraconvins. Eusuntregina! nfaaluistteaacumea. Team minit. tiu c tu mai crezut, dar eu n tot acest timp rdeam de tine. Rdeam n spatele tu, cnd tu te ntorceai. Team folosit ca pe o jucrie. i acumamdegndstearuncfiindcnumimaietinecesar.Aaamfcuttoi.Noi toi. Dectticloieputusefinstare! Maiaincrederenmine? Nu!opticuur. AincrederenANS? Nu! Bine,linitetete.EusuntVictor! Nuamncrederentine! Dece? Victoreregina. Hipnologul avu o reacie violent, manifestat doar printro concentrare bruscaprivirii,pentruofraciunedesecund.Apoiseforssecalmeze. Voinumrapnlatrei.Cndvoiajungelatrei,teveitrezi.Unu...Doi... Trei.Trezetete! Nuamncrederentine! Deschiseochiiiseuitmiratnjur.Erantrocamermic,cuunsingur pat.npatstteael.Privipefereastradindreaptaiobservcafarerantuneric. Cesantmplat? Dinpcate,nuiputeaamintimarelucru.Venisepentruhipnotest,darce fusesedupaceeaerancnumbr. Uasedeschiseiapruofemeiembrcatnalb. Sormedical? Teaitrezit! Owainnutidacsaprobesausntrebe. Tesimibine? Probabil.Nicinumaitiucenseamnstesimibine!... Eh,oricum,etipecaleaceabun.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Cesantmplat? Victornuteamaipututtrezidinhipnoz.Teamlsatsdormiiuitte acumlatine:eticanou. Victor.Ceticlos! Haisizicopoant!Pacientulvedecaprinceaofigurdeasupraluii ntreab: A reuit operaia, doctore? i i se rspunde: Nu tiu, fiule, eu sunt Sfntu Petru. Galezulsechinuisrdfrstueasc.Sesimeadejamaibine. Potsmridic? Doaroclip,siauhamuriledepetine! Seapropiincepusidesfacelectroziiimicroscanereledepecorp. Maisupravegheat,nuglum! Altfelcumstimcndteaitrezit?Doarnuerasstaunumailngtine. Mersipentruateniadeosebit. Acumpoistescoli. Erancslbit,darseputeamica. Suntlaspital? Nu,etitotlapoliie.Nusemoaredintrunhipnotest!Ah,miamamintit. Trebuiessemnezideclaraia. Cedeclaraie? Aispuscevalatest,nu?Trebuiessemnezi. Aveiaacevapeaici? Pemsuadinstnga. Ofoaiescrisntrunholoscrindecomputeriuncreionlegatcuunfir. Att de puin am vorbit? se ntreb el, citind foaia. Apoi semn cu creionulpemsuiarurmaluiaprupefoaie. Deacumgata,etiliber! Potsplec? Firete. Seuitlaceas:eraora10.Segrbidecissentoarclacmin. Nimeni nul ntreb nimic. Se uitau cu toii la holovizor. Galezul li se altur. Dupjumtatedeor,uadelaintraresedeschiseiaprurdoibrbai nuniforme.naintarpnnsufragerie,apoiunulntreb: CineesteBrankoL.? Macedoneanul se ridic. Nu prea surprins, ci o tristee fr margini i acopereafaa. Am dori s ne urmai pentru efectuarea unui hipnotest. Dorii s cunoateimotivul? Nu,tiumotivul.Motivulecamcrezutnoameni.Iertaimcamavut ncrederenvoi!sentoarseelsprecolegiinmrmurii.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Avei dreptul s refuzai hipnotestul, dar, dat fiind faptul c nu facei acest lucru din motive medicale, gestul dumneavoastr va fi considerat o recunoatereimplicitavinoviei. Brankoieifrsmaiscoatovorb,iarceidoivenirdupel. Bine iau fcut! gndi Owain, apoi se speri. Doamne, ce spun? Mie prieten! Deveneadincencemaiclarcisentmplasecevamaimultntimpul testuluiicdeclaraiapecareosemnasenueradelocparteaceamaiimportant. n definitiv, ce i se putea ntmpla lui Branko? Trebuia s spun ct mai mulimembriANS,apoisisetearginformaiilecuprivirelacomputere,arhive iorganizaie.nmodnormal,ntrosptmnlarfivzutdinnou.Daroarear maififostcuadevratBrankopecarelcunotea?Prietenulsu?Poatesingurul. Deocamdat, era nc Nebun de ANS i acest lucru l fcea duman. Peste o sptmnputeaufidinnouprieteni. Acest lucru nu se ntmpl ns. n seara aceea l vzur pentru ultima oar. Li se comunic faptul c fusese exclus din Universitate i trimis n Macedonia. Attdeaproape,itotuldatoritmie! Patulneocupat,computerulliberifotoliulgoleraunfiecaresearcapete de acuzare, iar conceptele de bine i de ru, care ncepuser s capete un sens concret,isenvlmeauiarnminte.AveaimpresiacTomiceilaliidduser seama c el trdase i n fiecare vorb sau gest gsea o dojan sau o dovad de dispre.SingurulreperrmseseVigdis. Era sear, ca de attea alte ori. Ajunsese la concluzia c aceste plimbri erau doar pretexte pentru meditaii alturi de cineva apropiat, care si tolereze absenaiexcesele. M gndesc ce va fi peste o lun. Vom deveni cu toii nite strini. Mai alestu.Aproapenumipotimagina. imiemipareru.Aivreasnescriem?Svorbimnfiecarezi? Nucrednchestiaasta.Lanceputnfiecarezi,apoiodatladouzile. Darcelpuinarfiodespriretreptat. Da... Nammaidiscutatdecndamfcuttestul.Sauntmplatomulimede lucruri. Fataateptscontinue. Team ascultat, mam convins, am fost sigur, pentru ca apoi sl aud pe Brankocummicereiertarepentrucaavutncrederenmine! ncredereanseamnmultpentrutine. Ceaidacnaincredere? Attatimpctncredereanunseamnnaivitate.Decetezbaitottimpul? Numaipoischimbanimic.Decenuteieri?Dacarfifostaltcineva,laifiiertat.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Da,aae,miarfiplcutcaBrankosmtrdezepemine. Gndetetecpeste50deaniveirdeamintinduiperioadaasta. Afiunprostdacarde.Darcinetiecevafi?! Maibineuit.Mcarpentrusearaasta.Mcarodat. Eradistant? Aatrebuie.tii,nenchipuimcfiecaremomentconteaz,spermdoar pentru viitorul apropiat, i dintro dat ne trezim pe patul de moarte, i spunem Atrecuttotulcaoclip. A putea s zic: tu trieti doar n trecut sau n viitor. Nu poi tri prezentul. Eadevrat,pejumtate. Amsncerc.Pentrutine...? Vigdisizmbi. Se fcu noapte, rznd i discutnd nimicuri. Fata avusese dreptate: i o clippoatefifrumoas.Pentrucapoiamintirilevorfifrumoase. Seuitsprecer:senin,frlun,doarstele. iplacespriveticerul? Vigdisridicochiinnalt. CareeBalana?iPetii? Eutiu?Acumsuntempeterenneutru. Owainerambtatdefericire. Poateficevaperfect? Islandezarspunsescurt: Nu. Cevanueranregul.Acumiddeaseamaceramaimultdectatt.i nu observase nimic. Poate nici nu avusese ce s observe. Sau poate nu voise s observe. Eunamminit. Aidreptate. Stelelenumainingeau. Atuncidece? Atrebuit. Eranecesar? Ceaisimitpentrumine? Miafostmil... Mil?Erevolttor!Miegrea!Grea!Grea! Vigdiscontinuasvorbeasc. Owainsedeprtinvoluntar. S tii c nu mie uor si spun. Tu nai minit. Trebuie s zic i eu adevrul.Iartm. Toimicereiiertare.Cesunteu?i,nfond,decesteiert?Doarpentru
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


cnumiaispusdelanceput.Potsstauieu?Ceglum! Nunelegi.Nuvreisnelegi! Eraadevrat.iveneasicearlegitimaia! Aidreptate.Deceoaremprsesctoiceicaremneleg? Vigdisnurspunse. Mateptamlaunsfritmaifrumos,credem. Niciunsfritnuefrumos?! Spunemi, totui, aa, pentru cultura mea general, ce prere ai despre mine? iplacesaparimaibundecteti,pentrucaapoi,cndceilalinceps te cunoasc cu adevrat, s lai totul balt. Ai vrea s fii perfect, dar nimeni nu poatefimaibundecteste,launmomentdat.Nuareroststotplngiistetot ntrebiamfcutbinesaunu.Cutoateastea,aifostuncazinteresant! Astaejignireafinal,nu? ntocmai. Mcarnepstrmsimulumorului. Mcaratt.tiiglumacurmnemprieteni? Nu,ispersnoafluazi,delatine! Minise,frstienicieldece.Arfidoritmultprieteniaei. Trebuiesimaispunceva,nlegturcuvisultu.Poateodatveireui siieizborulistrecidincolodelun.ipoateacolocinevatevaatepta. ispercaelsnuizicPmntulemare. Se ntoarser fr o vorb la cmin. Lui Owain aceasta i se prea o pedeapsdreapt. Mairmneauexamenelefinale,pecaregalezullepregtidestuldebine. Oricum,numaiaveaaltcevadefcut.Aacreuisfacofigurfrumoas. Totodat,ddutezalasupervizatiateptcusufletullagurasusinereaei oral. Veni i acest moment. La nceput avu emoii, apoi, pe msur ce vorbea, acesteapiereaupenesimite.Crezuseceraolucrarebun,dardintimpntimp profesorii examinatori fceau cte o mutr dezaprobatoare sau puneau cte o ntrebarealcreirspunsOwainpresupusesecrezultadincontext. Lasfrit,unprofesoravuproastinspiraieslntrebe: Ctcrezicmerii? Galezului nui veni s cread ce noroc dduse peste el. Nul interesa prereaexaminatorilor,attatimpctelmunciseipurisimpluteza,nformaei final, l satisfcuse. Se concentr deci, ca pentru un Ordin ce simpl i se prea acumdiferenadintreoPorunciobanalridicareatonuluiivorbi: Merit10! Comisiancremenipentruoclip,apoidduverdictul: Zece. Terminase facultatea. Anii care se presupuneau a fi cei mai frumoi din
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


via.Pentruel,sfritulfusesemizerabil,cadeobicei.iculmea,simeatotuici vorlipsiiprofesoriiacroraprecieresincernovacunoateniciodat,icolegii careacumpoatelnjuraungnd,dinmotivecutotuldiferite. isevantoarceacasnaraGalilor,deparcnimicnusarfintmplat n acest an nenorocit. Ct de crud poate fi uneori o victorie i ct de glorios un eec! Cine tie unde m voi ngropa acum pentru tot restul vieii, fr s realizeznimicimportant.Smiiauoslujb,onevast,unmormntissfresc nel.Perfect.DomnulLlynafostunomdetreab,catoiceilalioamenidetreab pecareicunosc. Serbareadefinalsedovedidestuldefrumoas.Cndisenmndiploma, Owain fu aplaudat la fel de mult ca i colegii si. Dar tia c nu poate auzi aplauzelecarearficontatcuadevratpentruel. Iatcumpoiajungepersonajulnegativ. Salaizmbeancurajator. iparanoicpedeasupra. idduseamacopedeapsadevratnupoatefidectsubiectiv. Nuepedeapsdectceeaceconsidermnoininepedeaps.Practic,ne pedepsim singuri. Poate si ard casa i s fii fericit c ai scpat cu via sau, dimpotriv,poisstingiincendiulisiplnginpumnicaarsnumaitabloul lacareineaicelmaimult. Ajunseselafundiacumncepeadinnousurce. Cel mai adevrat lucru pe care lam auzit a fost c viaa e funcie de sinus. Anunvesteaacasifunevoitssuportecurbdarebucuriaprinilori asurorii.Sepregtidecisufletetepentruntoarcere,prevzutpestedouzile. n aceeai sear, auzi la HV tirea despre moartea guvernatorului rii Galilor,lanumai75deani.Urmaunminidocumentarprivindactivitateaiopera sa. Fu menionat i episodul Aberystwyth, de care i vorbise Williams. Ca fiecare om politic care se respect, publicase trei cri, n care i expusese probabil viziuneaasuprasocietii,guvernriisaueconomiei. Mcartiucexist.Oricumnoslecitescniciodat. Segndilascrisoareadefelicitarepecareiotrimisesecuprilejulveniriin Romnia. Era destul de drgu i se ntreb dac o scrisese el personal sau cine tiececonsilieramrt. Rmneaproblemanouluiguvernator.Eracuriosdacvafinumittotun galez,sautradiiavfintrerupt. Seara urmtoare avu loc petrecerea de adio. Din grupa sa, lipseau 2 persoane:BrankoiVigdis.idorisnusefidusniciel,darapoi,pemsurce timpultrecea,sechinuisseintegreze.Sepreachiarcnuipoartnimenipic, ba fu i felicitat pentru rezultatul deosebit. La sfrit, toi fcur schimb de
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


numere, pentru a putea pstra legtura. Dintrun impuls oarecum inexplicabil, Owaindduunnumrgreit,lantmplare.SemnavagcuacelaalluiMyfanwy. Myfanwycarenulateptase.Notcurbdareinumerelecolegilor,ntrebnduse dacivorfolosivreodatlaceva.Oricum,cndpetrecereasesparse,sedesprir prieteni. LantoarcereanaraGalilorirezervunlocdeavion.Constatasecn contulsupersonalrmseseaceeaisumfabuloas. OarenauaflatdesprecarteledelaBranko? Rostiseparolacuouoarreinere.naltecircumstane,iarfizis:Asta sunt,unobolan!,daracumtotulurmassesfreascncurnd. Poatevoiuita. Laaeroportlateptauprinii,sora,unelerudemaindeprtateiciva cunoscui.ntotal,vreo12. Aivenittoatbanda!rnjiel,privinduipefiecarenparte. Sepregtipentruasalt,nslaudeleimbririlefursuportabile,chiar relaxante. Hai,acumpovestetene!zmbicubunvoincineva. Owain i trimise o privire la fel de binevoitoare, amintindui toate njurturile romne,galeze i englezepe care le cunotea, bachiar invent pe loc altelenoi,adaptatesituaiei.Totui,ladreptvorbind,eraocuriozitatefireasc.Se enervase mai mult din inerie, din cauz c aa ar fi reacionat n mod normal. Acum,analiznduse,realizcnupoatedescopericauzairitrii.Fiindcnuexista nici una. Vorbi tot drumul spre cas, i apoi nc jumtate de or. Din cte tia, oamenii se plictiseau repede de un anumit subiect i ncercau s fac legturi cu altele noi. Se atepta deci s fie scutit repede de efort, ns acest lucru nu se ntmpl. l ascultau cu atenie, preau interesai, iar el se sili s povesteasc ct maifrumos.ntretimpsemaiadunaseriniteprieteni(fotiprieteni?)deailuii prinii fur nevoii s mai pun pe mas cteva farfurii. Era o primire drgu. Chiarfoartedrgu. Vestealgsicompletnepregtit,cuzmbetulpebuze.Nuidduseama cine o spusese i, datorit ocului, nici nu se czni s afle. Myfanwy murise la o lundupplecarealui.Ceeraculmea,toiinchipuiserceltiaacestlucruic llsasenurm. Nimeninuseobosiseaadarslanune,deiputeaficonsideratcelpuin un cunoscut. Nimeni nul luase n seam? Aceast variant i se pru mai aproapedesuflet,darsechinuisondeprteze.Eraoricumunaspectsecundar. Ceeacelnnebuneapurisimplueraamintireaconversaiei,ncareafirmasec tiacfatanulvaatepta. Cetmpit!Cedobitoc!tiam!Cedobitoc! Zisese aa gndinduse la cu totul alte motive i i era acum o ruine imens.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Miefricsspununlucrucnucumvasmnel,icndmhotrsc totuisdeschidgura,ofacattdeprostete! Totui,cndscosesecuvntulacela,avusesenmodcertimpresiacspune adevrul,caaeradefapt. Ceciudat,ceticlosicesublimpoatefidestinul!ipreaoluptcontinu: elncercndsintuiascviitorulisoartapregtinduinmodsistematiccevanou. Defiecaredatapreaovariantpecarenoluasenconsideraie.Eraelmrginit sau destinul nu juca corect, dndui s rezolve o problem, pentru ca apoi si schimbeipoteza? Aa pot s m gndesc la orice, tot degeaba. Ce m mpiedic s iau n calculuncutremur? i,ntradevr,fucutremur.Pmntulncepussemiteiconcomitentse auzi sunetul profund, nfricotor, caracteristic acestui fenomen. Toat lumea se ridicnpicioare,scauneczur,exclamaiidespaimsaustupoaresenlar,ua de la intrare se trnti i fugir afar. Abia ieii, totul se termin. Nu fusese un cutremurfoarteputernic,doarctssperiepuinoamenii. Acumausubiectdediscuie!gndiOwainsarcastic. Constatase c dup prima descrcare de adrenalin, chiar n timp ce podeauasezguduianc,ncepusesiredobndeasccontrolulisobservecu oarecaredetaarefenomenul. Acum,ieitdincentrulateniei,puteasicontinuemeditaiacuprivirela dispariia lui Myfanwy. Se ntreb ce diferen era ntre aceasta i majoritatea colegilor si de care abia se desprise i de care poate nu va mai auzi niciodat. Din punct de vedere fizic, rentlnirea cu ei era cel puin posibil, dac nu probabil, iar rentlnirea cu fata imposibil. Aici totul era terminat. n plan psihic,rmneauamintirile,carepentruelreprezentauaproapeoadouarealitate, alturidenchipuiri.nplantranscendent,lucrurileeraumaicomplicate.Daciar fingduit,arputealuachiarlegturacuea,ccispiritismulnumaieraconsiderat demultosimplnscocire.Darnacestcaz,ceiarspune?Dacarfinfaalui,ce iarspune?Dacarfilngel,ceiarspune? Cemammaisperiat!ziceamaicsa.Darstaafostmaislabdectceldin 54. Ceilaliaprobarireluarapoiideeacualtecuvinte. Era o zi plin de evenimente. i Owain simi un imbold irezistibil de a cntalasintetizator. Dupexactosptmn,primiunapelprincomputer.nholoscrinseafla faaplinuaunuibrbatdevreo50deani.Dupexpresiafigurii,eraoribolnav, ori om politic. Dup ce se prezent, cu un rnjet politicos, se dovedi c a doua varianteraadevrat.EraConsilierImperialpentruaraGalilor.Owainispuse ielcircumspectnumele,realizndimediatceraunlucrudeprisos. O clip, i fu fric s nu aib cumva probleme din cauza contului, dar
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


realizapoicnuiartrimitempratulunconsilierpentruattalucru. Vaignditvreodatsurmaiocarierpolitic? ntrebarealmir. Oareundevreasajung? Nu. Darvarsurdeideeasaveiofuncieimportant? Sefstci. Nu.Nutiu...Depinde.Poate...Depindecefuncie. Vamluatprinsurprindere,nu? Mda. Decinprincipiuaifideacord.AcumosvcitescmesajulnlimiiSale mpratuluiIoanI. Mesajulmpratului?Doarpentrumine? DomnuleOwainLlyn,insvreamintesccnconformitatecuarticolul17din Constituie, mpratul numete personal guvernatorii provinciilor Imperiului Romn. Astfel,aconsideraofavoarepersonaldacaiacceptanumireadumneavoastrnaceast funcie pentru ara Galilor. Contient de dificultatea i nalta responsabilitate a acestei decizii, doresc s v cer totui un rspuns ct mai rapid. Cu sperana c acesta va fi afirmativ,semneaznlimeaSaIoanI,mpratalImperiuluiRomn. Consilierulridicochiidepehrtiadinfaasa,privindulapoipeOwain. Guvernator?Amdoar22deani!Urmasfiiconductor!Seateaptlaun dacategoric.Cearfisfacpedos?Cearfisdaucupiciorulansei? Adoripuintimpdegndire. Cellaltridicsurprinsdinsprncene. Firete.Potsvdaudetiremine,laaceeaior? Da. ivoiavearspunsul? Da. Foartebine.Sntate! Sntate! Legturasentrerupse. Destinui prinilor ce se ntmplase, i cum era de ateptat, acetia nul crezur.Insist,darisespusecprinseseunumorciudatctnvasenRomnia. Exasperatntrooarecaremsur,daribucuros(Uitecepersonajimportantsunt pecalesdevin,oameniinicinuviseazlaaaceva),idducuvntuldeonoare, imaginndui lacrimile fericite i mbririle cordiale. Dar i se ntoarse spatele. Rmasepironitlocului,frovorb. Aadar,cuvntulmeudeonoarenuvaloreaznimicpentrupriniimei. Aceastaeradoarosimplconstatare.Faptullmiraseilmhnisepuin, darnumaiatt.Nusesuprase,dimpotriv,situaiaisepreaamuzant.Dacmai rmseseopicturdendoialninimasa,acumseevapor.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Amslearteulatoi. Departe de gndul unei ameninri, Owain dorea din tot sufletul si demonstreze calitile, avea pentru prima oar cu adevrat prilejul s ias n eviden, si depeasc mediocritatea condiiei. Era contient c alii ar fi dat orice s fie n locul lui. Era printre cei mai buni, dar nu era printre primii. nc. Voiamaimult,iastanuerabine.Darcinetieceebineiceeru?Isepreace bine,pentrucnusesimeacunimicvinovat. Rmneaproblemaprinilor,careiignorasercuvntul.Cuattmairu pentruei!Nufcuserdectsseafundeimaimultnmocirl.Owainarfivrut dinpartealorosclipire.Dinpcate,nufuseseposibil. Nuinimic,voraveancurndomicsurpriz. Astadacomulerantradevrconsilier.Daceraobtaiedejoc,eramai binecnulcrezuser. Cenaibafac?Mndoiescieu? indeprtdinminteacesteidei. Adouazirspunselaapelulpecalculator.Erasingurncamer,lafelcan urmcudouzeciipatrudeore.Consilierullprivinochi,frsspunnimic. Da,ziseOwain. Mbucur,zisecellaltintrerupse. Amfcutoipeasta. Nuseschimbasenimic.Eraacelai. Seara,seaduntoatfamilianjurulholovizoruluipentrutiri: NeafostcomunicatastzinumelenouluiguvernatoralriiGalilor.Else numete Owain Llyn, locuiete n Caerdydd, are 22 de ani i abia a revenit de la Bucureti,undeafosttrimiscuobursdestudii.AabsolvitFacultateadeFilologie Romncunota10. Urmopoz3D,nfindulrnjindcaunbleg. Vomncercasvprezentmnediiademineuninterviucudomniasa. Ceremoniaoficialdenvestirevaavealocduminic,11iulie,ivaficondusde nlimeaSaIoanI,mpratalImperiuluiRomn. Hologramapersistanholoscrin.Erael,frndoial.Parciseridicaseo piatr de pe suflet. Nu se nelase. Simea privirile celorlali, mirarea, vinovia, respectul,admiraia.Lascapulpespateihohotindelung,caunnebun,frs incontdenimeni.Sesimeabine.Intrasenistorie.Eratotceidorisevreodat. Nu se gndise neaprat la o funcie politic, de fapt aceasta se gsea printre ultimeleopiuni,darcemaicontaacum?Sepriveanfairdea. Dup o or, i ultima urm de ncntare pieri, cci se obinuise cu noua stare. Obinuina e cel mai mare duman al mulumirii. Fiecare vrea mai mult fiindcvreacevanou. Toat viaa ateptm ceva nou i cnd gsim, n sfrit, poate nui mai acordm nici o atenie, pentru c deja n gnd neam obinuit cu el. Dac nu era
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


familia,eramguvernatordeieri.Artrebuislemulumesc.Slemulumesccau greit?! Segndiapoicvaaveadedatinterviuri.Riscuriledeadeveniopersoan public!Renunspregteascodeclaraieanume,fiindcdinexperientiaci sevorpunecutotulaltentrebri.iapoi,chinuindutesprezinioideectmai bine,numaieticapabilsteconcentrezilaaltele. Prinii,imaialessorsa,intrarimediatnjocichiarseoferirsiin companie n timpul ntrevederii cu reprezentanii holoviziunii, de a doua zi. Conform ateptrilor, chiar diminea apru o reporter cu un operator, cernd puindintimpulsupreios. Se ateptase de asemenea s fie o femeie n postura de anchetator. Avea impresia c femeile dovedeau o mai mare aplecare spre senzaional, poate chiar scandal, spre ce vrea publicul. Coboarte la nivelul publicului i publicul va coborlanivelultu. Urmtoareledouoreischimbaroarecumprerea.Reporteraseartase chiartimidlanceputiOwainsegndeacdeabiaateptainterviulcasidea cuadevrataramapefaa.Darnupreafuaa.ipusentrebridestuldenormale, deinteresgeneral.Ladreptvorbind,eradenelesdorinagalezilordeaaflacine le va fi guvernator. Cnd se afl n ncurctur, prinii i sora intervenir salvndul i chiar detect n acele momente sclipiri ncurajatoare n ochii femeii. Nu voia si ias prost emisiunea sau dorea ca el s fac o figur frumoas? La dreptvorbind,ceipsa? iacum,nncheiere,oultimntrebare:aifostmembruANS? Simiunvaldetranspiraieacoperinduicorpulifucontientcfaaise nroea i i se nfierbnta. Se instal o pauz penibil i cu valoarea unui semirspuns.Sepregteacutoateforeleszicda. Sorsavorbi,netiindexactcesentmplcueasaucuceilali: Binenelescnu!Deundevavenitaaoidee?Credeicmpratularfi numitguvernatoruncriminalterorist? A fost o glum, zise reportera, privindul n ochi, parc spunndui: Teamprinsnsfritcuceva! V mulumesc n numele postului HVG i al numeroilor notri holospectatori,carecredcvorfimulumiidedumneavoastr. Acuminveciivecilor!mormiOwain. Toirserdecircumstan.Ceputeasfaceldacsestrduiauattsl facpopular? Montajulinterviuluifudifuzatimediatduptiri,cusurleleitrmbiele cuvenite.Ultimantrebarefutiat. Se apropia cu vitez ceremonia. mpratul sosi smbt, cu avionul personal. Agitaia abia ncepea. Venir apoi i guvernatorii celorlalte 40 de provincii. Owain urmrea toat tevatura de acas, holbat n faa holovizorului.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Vinerilaprnzprimiunapeldelaconsilier.Acestalntrebdacvoiasiscrie singurdiscursul(trebuiasziccevaacolo,nu?)sausifiepusladispoziieunul gata redactat. Owain reflect o clip. Ar fi fost demn s scrie singur, dar ce? Mulumesc, mprate, chiar mi prinde bine. Aa c alese a doua variant. Se simeadejaobosit,icirculnicinuncepusecuadevrat. Duminicdimineaa(ziuaceamare),unAGMalbcunsemneleimperiale oprinfaacaseisaleioferullinvitslnsoeasc.Restulfamilieifurefuzat politicos,ntructlaceremonienueraadmispublicul,nschimbtotuleratransmis ndirectlaHV. n main l atepta consilierul. Ce diferen poate fi ntre un om i imaginealuitridimensional!inmndiscursulpatrupaginitipritedestulde miciidduultimeleindicaii:snuspunnimic,totuleraaranjat,totulvafin regul. Owain se gndi emoionat c va trebui sl ntlneasc personal pe mprat,darapoisestrduisiimpuncacestanueradectunomobinuit. Toisuntemoameni. Nu se ntlnea cu puterea lui, ci cu el. Puterea nu e dat dect de frica celorlalidealnfrunta,datoritfierespectului,fieposibilelorrepresalii.Dactoi ar avea curajul s se opun, chiar cu preul vieii, nimeni nu ar fi capabil si pstrezeputerea.Nuexiststpnfrsupui.Darcttimpcinevasegndetela avantajepersonale,nicielnupoatefiliberiniciceilali. Dar,ladreptvorbind,ceelibertateaastadecarenetotcramponm?iea, lafelcatoatecelelalte,estesubiectiv.Tepoisimiliberintronchisoare,can secolultrecut.Ceelibertatea?Putereadeafacecevrei.nsnimeninufacetotce vrea. ngrdirile sunt prea puternice i nici un om normal nui poate permite o libertatetotal,pentruciarpierdeastfeldimensiuneasocial,drepturilegeneral recunoscuteidecilibertateadeaacionaconformlor. Consilierulltrezidinspeculaii: Amajuns. A putea si dau o palm sau sl strng de gt, i zise Owain, dar amndoitimcnuvoifaceaa. oferul deschise portierele, coborr i urcar n linite treptele Palatului Guvernamental. CunoatetipecinevanumitStjepan? Nu.Dece? Toateasteamiaducamintedeontmplarenefericit. Astanuvafinefericit. Ssperm. Sfimsiguri! FolosiseoComand??!Nu,firete,selinitindatOwain.Doartonulcu totuldetaatiinsuflaseostaredecalmincrederebinevenit.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Uileautomatesedeschisernaintealor. Aicivoivenitotrestulvieii! Niciunguvernatornufusesevreodatdemis. Consilierul l conduse ntro sal mare, cu pereii de un violet obositor, aproapeinvizibil,aflnduseprobabillacaptulspectrului. Cei40deguvernatoristteaualiniainparteastngiarnfa,petron,se afla mpratul. Owain nghii n sec i ncerc si calmeze btile inimii, proiectndusementalpestedouore,cndtotulsevafiterminat. naint. Camerele duble HV l urmreau, la fel ca i ochii lipsii de expresie.Covorulroudeceremonielfcusesapreciezegreitdistanapnla tron.Aceastaeramaimaredectseateptase,saupoatemergeapreancet.nsnu segrbi,pstrritmulconstant. Ajunselatreipainfaampratului.Coroanadeaur,nlocsideaun aspect caraghios (cci la o privire sumar parc avea dou capete suprapuse) i confereaodetaaresuveran.Cutoateastea,izmbea. Eosimplformalitate.Trebuiestrecemideasta. Pe nesimite, pulsul i reveni la normal. Era de partea lui. ngenunche n faatronului,dupcumcereatradiia.mpratulseridic,venilngeliipuse mnadreaptpeumr;Owainseridic.laveanfapeIoanI.Chiarlpriveade sus,fiindcstaturaceluilalteramaimic. mpratulludinstngatronuluioearfbrodatcuargint,pecarescria culiteredeaurGuvernatoralriiGaliloriiopusepecapcusiguran,nscrisul rmnnduinfa. Ceiescrisnfrunteiepus,gndiiireprimcuefortunzmbet. IoanIavuoreacieasemntoare. Te nvestesc, zise el apoi, Guvernator al poporului galez, reprezentant personalalnostrunaceastprovincie.Dumnezeusteajute! Seapropiilmbri.Owainsimicacestgestdeapropierefizicnui fceampratuluinicioplcere,deicontinuaslsusinnplanpsihic. Dupaceeatrebuismbriezeisprimeascfelicitrilecelor40.Putea sideaseamadestareafiecruia,deinuchiarattdeclarcancazulluiIoanI. Toierausincerinurriinsufletulgalezuluiseinstalbunadispoziie.Ungnd venit de niciundei cltin, pentru unmoment, ncrederea, darse sili sl alunge imediat: Suntem41.Unulenplus.Cineesteoare?Poatenusunteu. Totulsetermindestulderepede.Seuitlaceasirealizcnutrecuser dect 10 minute! Consilierul i fcu un semn discret din preajma uii. Owain se ndreptspreel.Cellaltlndemnprintrungestexplicitsiasdinsal,ceeace galezul ndeplini fr s clipeasc. Simea o uoar durere de cap, probabil din cauzaconcentrriiitensiuniinervoase. Pregtiivscitiidiscursul,iseopti.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


i duse instinctiv mna la buzunar, atingnd foile pentru mai mult siguran. Consilierul fugi n faa lui i deschise ua de la intrarea n palat. Atunci ncepucomarul.Oarmatdereporteriserepeziurlndasupralui,asurzinduli nbuindul,nciudapoliitilorcesechinuiausitemperezectdect. Nulmaivedeapeconsilier,darlauzizbiernd: ExcelenaSavadaodeclaraie!Linite,vrog! Zumzetul se potoli treptat i haita ddu napoi civa pai. Membrii PI probabilaveauexperiennacestdomeniu. Owainscoasefoileincepusciteasc.Maintinuavuemoii,ccifuria generatdeinstinctuldesupravieuirenceraprezentnel.Peparcursnsi imagintoatprovinciasauchiartoataradevornduifiecarecuvnt,punctnd fiecare stngcie sau greeal. Invidia, chiar nemrturisit, chiar incontient, trebuiasfieprezent:Decelapuspestainumapuspemine?!Nicinutie sciteasccorect. nacelmomentsencurcpuinirelunjurndngnd.Foilencepur stremureaproapeimperceptibilielsestrduissedetaezectmaimult. Duponougreealivenisaruncefoileisideademisia.iaminti deVigdis.Cumputuseslcaracterizezeattdeexact?Darprimaimpresieestecea maiimportant,bazapecaresecldescconsideraiileviitoare. Discursul era mediocru, cu o mulime de platitudini spuse pompos i n cenuiul stil oficial, lipsit de nuane. Nuanele, frazele interpretabile diferit, erau necesare,darnuntrunmomentcaacesta. Onougreeal.Isentunecnfaaochilor.Nusemaiputeasalvadect printronebunie.Pnacumnufusesespontan.ifusesefricsfiespontan.Era timpulsiaratecealaltfa. Se opri din citit, mototoli foile i le arunc pe jos. Ridic ochii n ochii reporterilor uimii i ai camerelor inexpresive de dup care priveau milioane de expresii. Cenaiba,amemoii,nuvedei?Trebuiesmimaidaioans.Recunosc ieu,discursulstaiinterviuldesptmnatrecutnaufostpreagrozave.Dar cesifacinammaifostguvernatorpnacumitrebuiesmadaptezdinmers. Probabilmulisentreabdeceamfostpuseuinualtul.ieumntreb.Lam ntlnitpempratacumunsfertdeorinumiaspus. Mincinosciniciticlos. Unaltpunctslabevrstaideciexperiena.Separecostrebuiascs v obinuii cu mine. Doar dac nu se ndur vreunul smi dea pe la un col cu ceva n cap. Probabil c domnii de la PI vor avea grij, dar nu stric s ncerce. Credsmamnroitcaunrac,deisuntpete.nmodnormalfricatefaceste nglbeneti.Sevedetreabaceuamtrecutdestadiulsta.Eunpasnainte,nu? Naivreacaguvernatorulvostrusseteamdevoi.Suntieulafeldecurioscum
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mivoindeplinimisiunea.Sspermcovoifacectmaibine.Maiamunsingur lucru de spus. Am avut deja aceast discuie cu unul pe care acum nu pot sl sufr, dar pe care l rog s m ierte c m repet fa de el. E vorba de problema perspectivei. M adresez holospectatorilor, mai ales galezi. Eu sunt unul, voi sunteimilioane.Pentruvoieusuntdoaropersoan,pentruminefiecaredinvoie doaroparte.Aficuadevratfericitspotacordaoateniedeosebitfiecruiadin voi,darnusepoate.Ladreptvorbind,censeamnchiarmilioanele?Pentrumine edoarunnumrcu7cifre.Dinpcate.Puneivnloculmeu,nfaamilioanelor, inumjudecaipreaaspru.Suncampatetic,darcesfac?Astae.Attamavut despus. Reporterii se nghesuir iari, iar consilierul l ndemn s mearg la main.Oaredecenurmcuojumtatedeornueranimeni?ProbabiltotPIul eraresponsabil.Deodativenioidee. Nu,stai,izise.Potsrspundlantrebri.Dar,dacsepoate,pernd. Durdouore,pncndicelmaiamrtajunselacuvnt.Owainvorbi aproapencontinuu.Oricumtrebuiasseobinuiasccuconferineledepres.Se strdui s nu deaaceleairspunsuri la ntrebri asemntoare, ba chiar propuse noi probleme de discuie. i totul era transmis n direct pe postul central de holoviziunentotImperiul,dupcumaflulterior. Sentoarseacasireaciafamilieifupesteateptri.Dupcescpide ei,sedusesseculce.Cndsetrezi,iseprutotulunvis.Nutiancdacera frumossaunu,dartiacerareal.Deinusimeadelocacestlucru. Denecontestateradoarfaptulcavusesesucces.Astaipentrucfolosise tottimpuldiscursuluiComandanonverbalIubiim!Aacevanuputeaavea mare efect asupra holospectatorilor, dar Owain i punea toate speranele n putereamasmedieidealnfianculorictmaiagreabile. Deveni n scurt timp cel mai popular guvernator pe carel avusese vreodataraGalilor. itrecuraa21deani. Orictdeimprobabiliarfiprutmainainte,aveaacumonevastdrgu itreicopii.Eramulumit,darnufericit.Seobinuisedetnrcusuccesulivoia cudisperare(icunfrnareadisperatcorespunztoare)maimult.Darmaimult nu se mai putea. Vedea c era destul de ru s ajungi pe culmi prea devreme, pentrucurmastagnareapentrutotrestulvieii,sauchiardecderea. Era totui o munc solicitant; zilnic se iveau noi probleme, care de care mai urgente, necesitnd att autoritate ct i abilitate diplomatic. nvase s se impun prin propriile caliti, nemaiutiliznd Comanda dect n cazuri excepionale.Aacevanusemaiartasede7ani. Dar, conform ultimelor rapoarte ale SS, nu mai era mult timp pn la urmtorul. Era 7 iulie i Owain sttea pierdut la birou. Aflase c o demonstraie
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


mpotriva sanciunilor impuse Statelor Unite fusese aprobat de Primria din Caerdydd. Era mai mult ca sigur c protestele vor degenera ntrun trboi antiimperialicvafidatorialuisitrimitpetoilacaselelor.Darindispoziia sa era cauzat de cu totul alte motive. Data i sugera ceva nedefinit, ngropat de multnmemoriasecundar.Totuielcutarspunsul.Punineuroniceseformau, spnd tot mai adnc pentru aflarea informaiei. ncerc s utilizeze Comanda asupraluinsuipentruaaveaacceslasubcontient,darnureuinimic.Crezuce mai bine s renune. i puse mnuile i ochelarii V (pentru interconectare la reeaua virtual) i ncepu s studieze nite documente, ns presiunea intracranianlntiina:creierulcontinuascaute.ideodatconexiunileajunser nacellocdemultprsit,purtndnapoivictorioaserspunsul.7iulieeraziuade naterealuiMyfanwy.Amintirileseadunarnjurulei,evocndoperioadatt deaventuroasncomparaiecuultimii10ani. Cum trece timpul! Cum trece naibii timpul! Myfanwy. i Vigdis. Apoi Gwen... Gwenerasoiasaiziuaeierapesteexactosptmn.DarOwaindepi aceast legtur cu prezentul, cufundnduse i mai mult n trecut. i i aminti visul.Attdeclar,deparcabiasetrezisedinsomn. Douzeci de ani nau nsemnat nimic. Noaptea aceea e nc cea mai important din viaa mea. Ce se ntmpla dac refuzam bursa? Dac refuzam funciadeguvernator? i aminti istoria aspirantului la titlul de nelept, care aducea mereu maestrului su dovezi privind calitile sale, neobinnd dect dojeni i amnri. ntro zi, scrbit, se ntoarse acas, convins c era nedemn de aceast cinste. i maestrulitrimisevorba:Frate,cndaitimp,vinosdiscutm. Nu obii un lucru dect cnd renuni la el. Cred c am apucat pe o cale greit.Darnuetotulpierdut.Miamatinsndefinitivscopul?Trebuiesrenun laacestscop. DomnuleGuvernator,vcautaComandantulPI,zisesecretara. Dmilegtura. efulPoliieiaveaofiguragitat,trdndomarencordare. Excelen,tiidespredemonstraiacontrasanciunilor? Da.Aieitscandal,nu? Cellaltnuprumirat,convinscareiGuvernatorulsurselelui. Sunt cam o sut de mii. Au vrut s se ndrepte mai nti spre Palat, la dumneavoastr,dariamoprit.AcumstaunPiaircnescJosmpratul. Amneles.Trimiteioprotejat,smducsvorbesccuei. Excelen... Cunosc.Eunordin! Comandantullsochiinjos: Preabine.ncinciminute.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Mulumesc. ntrerupsesatisfcutconvorbireaisepregtideplecare. Ajunse la locul demonstraiei. AGMul oficial se ndrept spre tribuna improvizat,nhuiduielilegenerale.Owainzmbi,pentrucinelegeaperfect:el era reprezentantul personal al lui Ioan I. Cobor din main aprat de grzile de corp. Vzduhul vui de strigtele protestatarilor, dar nimeni nu ncerc sl agresezefizic.Eraunmajoritatetineri.Credeauncefceau.Sengrmdipnla tribun. Urletele nu ncetar atunci cnd el ridic minile, ca si liniteasc. Ba chiarsenteir. Aputeasvamuesccuuncuvnt.Saupoateniciatt. Vorbise cu un aer amuzat, iar demonstranii (cei care l auziser) nnebunir. EwchoGymru!18 MarlaBucureti! Cymrurydd!19 Demisia! JosLlyn! Tcei!PorunciOwain. Piaaseliniticaprinfarmec. Acum ar trebui si conving c Imperiul e bun i gata! Duceiv acas, priniivateapt.icemiarfolosi?Niciunguvernatornulatrdatpemprat. Totui, de ce s m complac i eu? Dar nu e numai asta. De mult nu sa mai ntmplatnimicnaraGalilor.Acumsvedeivoidistracie! Suntdeparteavoastr! Huo! Gura! Amvenitsvsprijin! Rumoare. Cymru trebuie s fie independent! Ce ne pas nou de americani? Noi vremaranoastr. Uniiseentuziasmar,darmajoritatearmneareticent.Totui,undiscurs naionalistnromneraaproapeoparodie.Mulimeaaveanevoiedelozinci: Brodyr,twlltinpobYmerawdwr!Rhyddid!20 Jumtate scandar Rhyddid! iar ceilali continuar s tac sau s murmure. Owainseenerv. Ceproti!Ledaicevorilorleefric.
PleacdinaraGalilor!(gal.) araGalilorliber!(gal.) 20Frailor,joscumpratul!Libertate!(gal.)
18 19

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Hotrsiridiculizeze. Rhyddid!Comandel. Osutdemiideglasurisetrezirlavia.Piaaexplod: Rhyddid! Bwyd!21 Bwyd! Triascmpratul! Triascmpratul! Acummaracasinumaidemonstraictezileveimaiavea! Mulimea ncepu s se disperseze. Owain rmase la tribun, scrbit. Sptmnancepusebine. Poifacecevreiinuainiciosatisfacie. Sentrebcumarfifostsseproclamepreedinte.Toilarfisusinut,fr ndoial. Cel puin, pn la o ntlnire cu Ioan I, care trebuia s aib i el darul acesta.Oarecinearfictigatntroconfruntarentrempratiel? Myfanwyntrebactcostziarulacela.Imagineaiveniprinsurprindere. nc din anii 20, ziarele fuseser nlocuite de jurnale computerizate, de infotiri. Cum trebuia s neleag deci ntreruperea fetei? Se ivi o posibilitate: ce pre are trecutul? Coborgnditordelatribun,seurcnAGM,darnusentoarselabirou, cisedusedirectacas. Considera incidentul ncheiat, dar se nela amarnic, fiindc nu lua n consideraretocmaiforacarelfcusecelebru:masmedia.Civaziariti(termenul sepstranciudarealitiischimbate)fuseserluaidevaliei,lafaalocului,dar un post de holoviziune virtual transmisese n direct demonstraia. Ali ziariti o urmrirnacestmodincepurssentrebe. Astfel izbucni scandalul. Vocea Cambriei, virtjurnalul cu cea mai mare audien din ara Galilor, public un articol de fond intitulat Guvernatorul manipuleaz masele, n care era analizat minuios ntreaga sa intervenie de la tribun. Putea si liniteasc imediat pe toi, ntro conferin de pres, dar nu o fcu. i tirile senzaionale ajunser la Bucureti. Postul central HVV difuz un amplumaterial,apropiindusepericulosdemultdeadevr. n seara aceleiai zile, primi un apel prin care era solicitat pentru o ntrevederefizicurgentcumpratul. iscoaseochelariiVcumnatremurnddincauzaemoiei.Apoiiddu seamacfiorulerachiarfric.ntoarsecapulsprecanapeauapecarestteafamilia. NevastsairidicasedepecapcascapentruHVVilprivea. Trebuiesplec.


Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Sembrcnlinite,ntimpceealurmrea.Dojenitoare. Namceface.Mcheammpratul. Darnamspusnimic. Nuconteazcnaispus.Doarvoiaistii,oricum. Da,voiam. ireaezcasca. Owainfugataimediat.UnAGMlateptanfaacasei.ipuseielsfera mat.iputeavedeaacumpecopiiisoie,privindaciuneaunuifilmpoliist. Trebuiesplec,repet. Tointoarsercapulspreel. Dece?ntrebCerys. Cndvii?ntrebAngharad. Vexplicmama.Nutiucndvin. Saudacvin.Saudacvoifilafel. Rsensinealui.Nueradraculchiarattdenegru. Seapropidefiecare,imbriiisrutpeobraz.Apoiiscoasecasca iplec. n main era doar oferul. Coordonatele erau fixate dinainte, aa c pornir imediat. Ajunser la aeroport, unde se gsea un avion special pregtit pentruel.ntroorfunBucuretiiunAGMlconduselapalatulrezidenialal mpratului. IoanIlateptantroncperemic,nspateleunuibirou.Owainluloc peunscaunclasicnfaalui.lcomparcuimagineadeacumdouzecideani. Prulialbise,darochiieraulafeldeptrunztori.Dacpedrumfusesenpragul panicii,nacelemomenteOwainseliniti.Liniteadinainteafurtunii? Cunotimotivulchemrii,gndimpratul. Da,rspunseel. Afostogreeal.Maibineaziceoprostie. Aaeste. tiidecemasurprinsnprimulrndieireata?Pentruchipnologiicare pregtescviitoriiguvernatoriauobligaiasleimprimedragostefaadeimperiui mprat. Probabil n cazul tu a fost oneglijensau o eroare. Darsunt curios:ai fostsincercndteczneaisstrigiJoscumpratul? Binenelescnu.Totui,ntinereeamfostautonomist,zmbiOwain. Etigalez?ntrebararIoaniochiiiscnteiar. Da. De fapt, nu tiu. Nu mai tiu. tiu galeza, dar vorbesc romnete. Visezromnete. Un popor i imprim n limb mentalitatea proprie; folosind limba respectiv,mprumuiinvoluntarviziuneaspecificasupravieii,devenindpartea aceluipopor.ituetiromn,chiardacteainscutnaraGalilor.araGalilor, cu toate c unii i nchipuie nu tiu ce atitudine curajoas i independent
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


spunndCymru. Eoprostiesamestecidoulimbi,fudeacordOwain. Deceaifcuto? Habarnam.Amncercatcevanou.Darseparecnumaipoifaceceva nou. Te neli. Ceea ce ai fcut tu era mpotriva mentalitii generale. Cum puteaueisteridicenslvidaceraireprezentantuladversaruluilor?! Amimpresiacnicieinucredeaucuadevratcestrigau.Banu,credeau, darnucunoteautoatedateleproblemei. Eadevrat.Oameniisuntngeneralmulumii.Nicitu,cndteainscris nANS,nulecunoteai. Owainavuunfiorderepulsieiruineamintinduifaptasa. n perioada aceea, generaia fiind integraionist, ANS, care pornise la nceputcaomicareofensivputernic,aconstituitdoarunfactordediversiunei chiar de divertisment. Dac nar fi fost distrusns, acum sar fi putut revigora. Poatearfiredevenitunpericol. AicontrolatANS?!icndadevenitindezirabil... Decenu? TueraiRegele? Nu,deieraovariant. Practicputemfacecevrem.Ceghinionpebieiioameni! Dimpotriv! Ce noroc pe ei! Ai auzit de vreun guvernator corupt? A suferitcinevadincauzanoastr? Pi dac le poruncim s fie fericii?! Scuzm, am ajuns prea departe. Nimeni nu lea poruncit aa ceva. Darce farmec mai are viaa cnd sunt obligai siiubeascconductorii? icevezirunasta,attatimpctconductoriisuntbuni?Nuvezicese ntmplnStateleUnite?Oricumiariubi,daciarnelege. Da,aidreptate,numamgnditlaasta.Cndpoifaceoricedinoameni, ai ntradevr o psihologie diferit. Dei poi, nu vrei, pentru c simi c nu are rost.itotuiImperiuleviabil. Pentru c are la baza ideea de ncredere, de nelegere. Tolerana e cea maiputernicdictatur. Dar viitorul Imperiului e incert. Cine poate garanta c vor fi n fiecare generaie42deoamenicuastfeldeputere? Nueontrebarecorect!replicmpratul.Noipornimdelaipotezac acestlucrueposibil.ichiardacnarfi,amrmneoricumnistorie.Dejasuntem nistorieioameniivortidenoiipeste1000deani.Limbaromnvafivorbit ncmulttimp...Dareucredceposibil. Dardecndeposibil? Owainsenfior.Simeacatinseseunpunctimportant.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


PrimulmpratafostFlorinI. Simeanacelaitimpcafostcelmaiputernic. Totui,cumaajunsmprat? Decemaintrebi,cndaitoaterspunsurile? Da,aaeste,amtoaterspunsurile.Maieceva.Acumdouzecideani,la ceremonie,mamgnditdecesunt41deguvernatori.Estecumvaunulnplus? La prima vedere, aa ar prea. ie fric s nu fii tu acela?! Nu eti tu. Dintretoateprovinciile,alcreiguvernatorarputeafinplus? CreierulluiOwainncepuslucrezedinnounregimdesuprasolicitare. AjutatpuinideIoan,probabil,rspunsulveni.Attdelimpede,nctluimi. Romnia. Da. Dar tii de ce raionamentul e greit? Pentru c Romnia este consideratprimaprovinciecucerit. mpratul lu de pe mas o foaie plasticat i o arunc spre Owain. Aceasta descrise n aer o rotaie de 180 i ateriz pe birou n faa lui. i arunc ochiipeea.Cuprindealistaprovinciilor,nordineauniriilorlaImperiu.Romnia erantradevrprima.Inimancepusibatdincencemairepede.Simeacse apropie de o nou dezvluire. Parc i era fric s coboare cu privirea mai jos. O fcu. Un nou fior, de bucurie i mhnire, de victorie i dezamgire, l fcu s nchidochii.Macedoniaerapepoziiaa9a. Al9leaarenumrul999... Cetotspui?ntrebamiratIoanI. Autrecutdouzecideanipnsnelegcompletunvis.Douzeci!... Niciodatnuipreatrziu.Oricum,nupoizicecntotacesttimpnai realizatnimic.iaminteticrizaenergetic? Owainzmbi.Sentmplasenaugust68.Lucrtoriicentralelornucleare din ara Galilor opriser lucrul, invocnd lipsa proteciilor adecvate. El fusese chematlafaaloculuiirezolvaseconflictul,frautilizaComanda. ntradevr. De atunci am ncercat, pe ct posibil, smi folosesc doar propriilefore. Efoartefrumoscrespecilibertateaoamenilor,nsnutrebuiesuiic acestdarestedeasemeneapartedintine. Toatviaaamvrutsurc.Faptulcrenunamlaaceastputere,itotui mdescurcam,ansemnatpentrumineunpasnainte.Darde10aninumaipot facenimic. Deceteaimpotmolitnlume? Primulimpulsalsufusrespingideea.Apoi,ncetncet,realizcera adevrat.Funciadeguvernatordevenisepreaimportant. Aincercatsifolosetiforelectmaibine.Complet.iaireuit.Acum trebuiestrecimaideparte. Ctavreaieuasta!Darnutiucum.
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Avemputerifoartemari,darnusuntematotputernici! Eraunrepro.Darunreprobinevoitor.ncercasesrealizezetotulsingur. i acum era nefericit, fiindc i atinsese propriile limite. Aceste limite puteau fi depite doar printro nou viziune asupra lucrurilor. Doar ajutat. Trebuia s accepte ajutorul. i revzu viaa, ntrebnduse cum ar fi artat ea, dac lar fi primit de la nceput. Probabil c ar fi fost mai fericit. Probabil ar fi acceptat mplinirilefrssegndeasclaelecalaunscop.Acumaceastaerasinguracale rmas. Se ntreb de ce totui nu fcuse acest lucru mai nainte. Nu era nc timpul?Oricndpoatefitimpul? n fiecare clip facem o opiune. Exista un singur trecut, un infinit de viitoruri, i prezentul, care ucide celelalte variante. Dar aceste variante rmn n sufletul nostru, uneori incontient, i ne fac s ne gndim la ele cu regret sau cu satisfacie. Fyrirgefossvorarskuldir,svosemvrogfyrirgefumvorumskuldunautum.22 Luase hotrrea ntro clip, nsoit, desigur, de revelaie. Toate evenimentele importante se petrec fulgertor, restul este ateptare. Mai avea o singurdatoriefadetrecut.Cuumilin,darfericit,izise: Teiert,Branko.Dumnezeusneierte! nsfrit,maiurcaseotreapt. (5mai31iulie1995;18.1518.39)



Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

A doua fa

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1

Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Nebuniispreucugroazprivesc Ccilunaaparenfereastr iochiilornegricuurlucesc Sfidndlicrireaalbastr. Unvuietmetalicsenchisennoapte, Unurletprelungrsunnpustiu. Nebuniirzndsevorbirnoapte isparsergeamulcelgros,cenuiu. Nebuniipeorazdelunpornesc iuradinsufletlepiere ntimpcedeparteflorialbevestesc Trezireadinvisidurere. (16noiembrie1994;17.69)

Nupotsvd, Nuvreausaud, Namcessimt, Nicicesascult. Numerg,nufug, Nuvreausurc, Nupotssimt, Namcesascult. Nupotszbor, Nutiuceavrea, Nuvreaussimt, Nusunt.Bada. (31ianuarie1995;17.90)
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Vineunceluncuc iroiurulmuc. Apoivinecopilau iladuncufrau. ApoivineAzora ilmucpecopila. Bunicuangrijorat Cadecucapuntrobalt. ibunicultractorist Demulianifiindceapist Vineacasfrumuel ilomoarpecel. Bunicuasuprat idncapcuolopat. iroiulcelturbat Oscurteazdeuncap. Apoivineuncpitan ilaruncpemaidan. Cineafcutgrozvia Osnfundepucria! Cpitanuestepus Sridicemnasus. Darelpleacap,p,p, Copilauscoateun! (10noiembrie1992;15.67)
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Ningmeteoriipestear Peceralbiiroiibani, Ionstnasachilioar itragecupucandumani. igloanelecurgvitejete, Sunttrasedeunbravterorist, IardragulIonmaizmbete iocheteunparautist. Acumparautadispare. Sanchisiarcurentul!Oh,mor! Dariat:luminaapare. Unpumndncalculator. (10februarie1993;15.92)

Maehenwladfynhadauynannwylimi, Gwladbeirddachantorion,enwogionofri, Eigwrolryfelwyr,gwlatgarwyrtramad, Trosryddidcollasanteugwaed. Gwlad!Gwlad! Pleidiolwyfimgwlad. Tramorynfurirburhoffbau, Obyddedirheniaithbarhau.

Miedragvechiulpmntaltailormei, arabarziloricntreilor,faimoi,derenume, Rzboiniciieiviteji,attdebunipatrioi, iauvrsatsngelepentrulibertate. Patrie!Patrie!
Florin Leon (2009). Cele sapte trepte, Tehnopress, Iasi, ISBN 978-973-702-694-1


Suntcredinciospatrieimele. Ctmareavafizidpentrucurata,scumpaar, O,vechealimbvadinui. (6februarie1995;17.91)

Thecrowdisshoutingloudernow Theycuttheirveinsandlaugh Costheyalltookadeathfulvow Thewaytheywalkisrough. Fornoonecanbutdieatonce Inrot