Sunteți pe pagina 1din 3516

Capitolul1.

Anatomia#iembriologiaaparatuluiurogenital

Capitolul

ANATOMIA#IEMBRIOLOGIA
APARATULUIUROGENITAL

Conf.Dr.DANMISCHIANU

Dr.VICTORM~DAN,
Dr.C~T~LINPRICOP

TratatdeUrologie

Cuprins:

Rinichiul3
Glandelesuprarenale16
Ureterele18
Vezicaurinar~24
Prostata30
Uretramasculin~39
GlandelebulbouretraleCowper(glandeleluiMery)42
Uretrafeminin~43
Penisul45
Scrotul#iconinutulscrotal52
Testiculele,epididimul#icordonulspermatic55
Funicululspermatic58
Ductuldeferent#iveziculeleseminale59

Bibliografie60

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Motto:
Anatomiaeste#tiin[aformeivii!

Chirurgiaesteanatomiaplanurilordeclivaj

FranciscIosifRainer
J.Grgoire

Rinichiul

Rinichiulesteunorganperecheac~ruiform~esteasem~nat~,clasic,cuoboab~de
fasole.
`n stare proasp~t~, el are o culoare maroro#iatic~, suprafa[~ neted~ #i regulat~,
str~lucitoare #i consisten[~ ferm~. Modificarea culorii sau/#i a consisten[ei reprezint~
semne de suferin[~ renal~. Sunt situa[ii c]nd marginea lateral~ a rinichiului, datorit~ unor
compresiunialeorganelordinvecin~tate,prezint~modific~ri`ncocoa#~.
Fiecare rinichi are aproximativ 12 cm lungime, 6 cm l~[ime #i 3 cm grosime, iar
greutateaestede130150g.Labatr]ni,organulsufer~fenomeneregresive,fiindcevamai
micdec]tlaadult.
Rinichiuldreptesteadeseapu[inmaivoluminosdec]tcelst]ng.Dimensiunimaimici
apar`nmalforma[iicongenitale(rinichihipoplazic,rinichiminiatural)sau`nst~ripatologice
(rinichi scleroatrofic, pielonefrit~ cronic~), iar dimensiuni mai mari apar `n alte st~ri
patologice (hidronefroz~, pionefroz~) sau `n cazul absen[ei congenitale sau dob]ndite a
celuilaltrinichi,c]ndaparehipertrofiacompensatorie.
Rinichiulesteunorganalungitcraniocaudal,aplatizatanteroposterior#iisedescriu
dou~ fe[e, anterioar~convex~ #i posterioar~plan~, dou~ margini, lateral~convex~ #i
medial~concav~#idoipoli(extremit~[i),superior#iinferior.Ceamaimareparteamarginii
medialeestereprezentat~dehilulrenal,lanivelulc~ruiaseg~se#tepedicululrenal.Prinhil
sep~trunde`nsinusulrenal,ocavitateprofund~careareaproximativjum~tatedindimen
siunilerinichiului.

Localizare
Rinichii sunt situa[i `n partea superioar~ a regiunii retroperitoneale laterale, `n
#an[urile paravertebrale limitate medial de corpurile vertebrelor coloanei toracolombare.
Inferior, profunzimea lor este redus~ prin existen[a mu#chiului psoas mare. Astfel, axul
marealrinichiuluiareodirec[ieoblic~inferolateral~,poluls~uinferiorfiindmaidep~rtatde
linia median~ dec]t polul superior. De asemenea, axul transversal este `ndreptat oblic
posterolateral,astfel`nc]tfa[aanterioar~esteorientat~anterolateral,iarceaposterioar~,
posteromedial.
Raporta[i la coloana vertebral~, rinichii sunt situa[i `ntre T12 #i L3, rinichiul drept
g~sindusedeobiceipu[inmaijosdec]tcelst]ng(1,5cm).Nivelulfiec~ruirinichidepindede
mi#c~rile respiratorii #i de postur~, f~r~ ca aceast~ varia[ie s~ dep~#easc~ 2,53 cm,
mobilitatea renal~ deosebit~ fiind determinat~ de: pozi[ia corpului (mai cobor]t `n orto
statism),mi#c~rilerespiratorii,stareadenutri[ie(ptozarenal~ap~rut~laceicarepierdmult
`ngreutate),sc~dereapreseiabdominale.Planultranspilorictreceprinparteasuperioar~
ahiluluirinichiuluidrept#iprinparteainferioar~ahiluluiceluist]ng.Proiectatepeperetele
abdominalanterior,hilurilerenalesuntsituateimediatmedialfa[~depunctul`ncareplanul
transpiloric intersecteaz~ rebordul costal. Posterior, hilurile se afl~ la 5 cm lateral de
procesulspinosalvertebreiL1(nivelullacaremarginealateral~amu#chiuluierectorspinae
`nt]lne#tecoastaaXIIa).Poliisuperiorisuntsitua[ifiecarela2,5cmdeliniamedian~,iarcei
3

TratatdeUrologie

inferiori la aproximativ 5 cm deasupra punctului cel mai `nalt al crestei iliace (planul
supracristal, corespunz~tor procesului spinos al vertebrei L4), la 7,5 cm de linia median~.
Datorit~situ~riilorsubrebordulcostal#ialmu#chilorparavertebrali,rinichiisunt,deobicei,
greu accesibili la palpare. Totu#i, la o persoan~ `n ortostatism, normoponderal~, polul
inferioralrinichilorpoateficuprins`ntrem]inileexaminatorului,unaplasat~anteriorime
diatsubrebordulcostal,iarcealalt~posterior,`ntreultimacoast~#icreastailiac~,manevr~
cepoatefiu#urat~deinspirulprofund.
Peoradiografiesimpl~,rinichiiseproiecteaz~pu[in`nafaraproceselortransversale
ale vertebrelor T11T12 #i a proceselor costiforme ale vertebrelor L1L2. `n general, polul
superior este `ncruci#at de coasta a 11a, iar mijlocul fe[ei posterioare de coasta a 12a,
rinichiul drept proiect]nduse, evident, pu[in mai jos. Polul inferior al rinichiului st]ng se
proiecteaz~pemargineasuperioar~aprocesuluicostiformalvertebreiL3,iaralceluidrept
`ntreproceselecostiformealevertebrelorL3L4(Fig.1).

Fig.1.Raporturileanatomicenormalealerinichiului
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Trebuie #tiut faptul c~, atunci c]nd coasta a XIIa are o lungime normal~ sau c]nd
estemailung~,`ncursullombotomiei,v]rfuleipoatefirezecatintraoperator,f~r~risculde
adeschidepleura.`nsitua[iauneicoasteaXIIascurte,rezec[iav]rfuluicoasteipoateduce
ladeschidereasinusuluipleural.
Practic, reperul chirurgului, pentru punctul cel mai de jos al recesului pleural, este
marginea superioar~ a ligamentului lombocostal (acesta une#te v]rfurile proceselor costi
formeL1,L2,cumargineainferioar~acoasteiaXIIa). Fiecarerinichi estesituat`ntroloj~
fibroas~ reprezentat~ de fascia renal~ a lui Gerota, rezultat~ din condensarea [esutului
4

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

conjunctiv retroperitoneal `n jurul rinichiului, al pelvisului renal #i al glandei suprarenale


(Fig.2). Aceast~ fascie formeaz~ o barier~ `n jurul rinichiului limit]nd `n acest fel extensia
proceselor patologice renale. Fascia are dou~ foi[e, anterioar~ #i posterioar~ (fascia lui
Zuckerkandl), aceast~ lam~ fiind legat~ prin tracturi conjunctive fine cu capsula proprie a
rinichiului#iav]ndunrolimportant`nfixareaorganului.Acestefoi[eseunescsuperior#ise
inser~ pe diafragm~, reuninduse deasupra glandei suprarenale, care r~m]ne separat~ de
rinichiprintrunsepttransversal,cuefectebenefice#iasuprafix~riirinichiului.

Medialelesecontinu~dealungulvaselormaricufoi[elecorespunz~toarealefasciei
renalecontralaterale,iarinferiorr~m]nseparate#isecontinu~dealungulureteruluip]n~
`n pelvis.Inferior,celedou~foi[enusereunesc, cumamv~zutmai sus,cisedisipeaz~`n
[esutulconjunctivretroperitoneal,exist]ndastfelunspa[iuprincarerinichiulpoates~cad~
p]n~`nfosailiac~respectiv~.
`ntrefasciarenal~#irinichiseg~se#tegr~simeaperirenal~(capsulaadipoas~)care
`nconjoar~elementelepedicululuirenal#i,prinhil,p~trunde`nsinusulrenal.`nafarafasciei
renale,`ntreaceasta,diafragm~#ipereteleposterioralabdomenului,seg~se#tegr~simea
pararenal~,ogr~simedens~,lamelar~,ce aparedup~v]rstade8ani.Spa[iulpararenal`n
careseg~se#teaceast~gr~simese`ntindedeladiafragm#ip]na`npelvis.`n[elegemastfel
deceocolec[iepurulent~pararenal~poatefuzap]n~`npelvis.

A.Sec[iunesagital~B.Sec[iunetransversal~

Fig.2.Dispunereafasciilorrenale
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Mijloacele de fixare ale rinichilor sunt reprezentate de: vasele pediculului renal,
presa abdominal~, masele celulogr~soase din jurul rinichilor, fascia retrocolic~ Toldt,
peritoneu, fascia retropancreatic~ a rinichiului st]ng #i fascia retroduodenal~ ce acoper~
fa[a anterioar~ a rinichiului drept, vena central~ suprarenal~ st]ng~ (fix]nd pediculul renal
st]ng la glanda suprarenal~, unit~ la r]ndul ei de diafragm) #i nu `n ultimul r]nd fascia
Gerota,men[ionat~deja,ligamentulhepatorenal#iligamentelesplenorenal.
Aten[ie:trac[iunilebrutaleasupraacestorligamente`ntimpulinterven[iilorchirurgi
caleperinichipotprovocaleziunihepatice#irespectivsplenice!

TratatdeUrologie

Raporturile rinichilor se realizeaz~ prin intermediul fasciei renale #i a capsulei


adipoase. Raporturile posterioare sunt comune pentru ambii rinichi, cele anterioare sunt
diferite,pedreapta#ipest]nga.
Posterior,prinintermediulfascieiluiZuckerkandl,rinichiivin`nraportcugr~simea
pararenal~ `n care se g~sesc ultimul pachet vasculonervos intercostal, nervii ilioinghinali,
iliohipogastrici#icutanatfemurallateral.`napoiagr~simiipararenale,raporturilerinichilor
cupereteleposterioralabdomenuluipotfi`mp~r[ite`nfunc[iedecoastaaXIIa,`ntrunetaj
superior,toracic#iunulinferior,lombar.
DeasupracoasteiaXIIa,rinichiivin`nraport,prinintermediuldiafragmei,cusinusul
pleural costodiafragmatic. La acest nivel, diafragma prezint~, mai des pe partea st]ng~,
triunghiullombocostal,dehiscen[~muscular~princaregr~simeapararenal~comunic~liber
cufasciaendotoracic~,iarrinichiulpoateveni`nraportintimcupleura.
Dedesubtul coastei a XIIa, rinichii vin `n raport succesiv cu urm~toarele planuri
musculare:
psoas mare situat medial #i p~trat lombar lateral, ale c~ror fascii prezint~
arcadele fibroase determinate de inser[ia fasciculelor posterioare ale p~r[ii costale a
diafragmei(ligamentelearcuate,medial#ilateral).
aponevrozaposterioar~amu#chiuluitransversalabdomenului`nt~rit~superior
deligamentullombocostalalluiHenle.Clasic,seafirm~c~elfaciliteaz~evitareadeschiderii
sinusuluipleural`nabordulchirurgicalalrinichiului
parteaini[ial~amu#chiuluierectorspinae,mu#chiuldin[atposteriorinferior#i
mu#chiul oblic intern al abdomenului. Ace#tia formeaz~ cu coasta a XII a patrulaterul lui
Grynfelt,unpunctslabalregiuniilombare
fasciatoracolombar~pecareseinser~fibrelec~rnoasealemu#chiuluilatissimus
dorsi. Marginea sa lateral~ delimiteaz~, `mpreun~ cu marginea posterioar~ a mu#chiului
oblicextern#icreastailiac~,patrulaterulluiJeanLouisPetit.
Toate aceste elemente sunt acoperite de [esutul celular subcutanat #i de pielea
regiuniilombarelaterale.

a.
b.
c.

Fig.3.Structuramuscular~apereteluilombar:
a)mu#chiuloblicextern;b)mu#chiuloblicintern;c)mu#chiultransversabdominal
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Raporturileanterioarealerinichilorserealizeaz~prinintermediulfoi[eiprerenalea
fasciei renale #i a gr~simii pararenale, care aici este sub[ire #i discontinu~, a peritoneului
parietalposteriorsauafasciilordeacolare.
Raporturilefe[eianterioarealerinichiuluidrept #ist]ngsuntdiferite,motivpentru
carelevomprezentaseparat.
Astfel,fa[aanterioar~arinichiuluidreptvine`nraportcu:
glandasuprarenal~dreapt~(omic~zon~,lapolulsuperiorrenal)
peritoneulparietalposteriorligamentulhepatorenal
fa[avisceral~aficatului(`ntreficat#irinichiseg~se#terecesulhepatorenal,unfund
desacperitoneal)
flexuracolic~dreapt~(extremitateainferioar~).
Raportul cu fa[a anterioar~ a rinichiului se face prin intermediul fasciei de coales
cen[~Toldt:
por[iuneadescendent~aduodenului(medialdealungulhiluluirenal).

Fa[aanterioar~arinichiuluist]ngvine`nraportcu:
glandasuprarenal~(lapolulsuperiorrenal,ozon~maimaredec]tlarinichiuldrept)
fa[avisceral~asplinei(raportulintimalcelordou~organeprinintermediulperito
neuluifaceposibil~rupturaasociat~alor).
Posterior, `ntre splin~ #i rinichi, exist~ o prelungire a cavit~[ii peritoneale (recesul
subsplenic):
curbura mare a stomacului, prin intermediul bursei omentalis, epiploonul gastro
splenic#iparteast]ng~aligamentuluigastrocolic
r~d~cinamezocolonuluitransvers
flexuracolic~st]ng~
anselejejunale.

Marginea lateral~ a rinichilor este locul `n care peritoneul parietal posterior se


reflect~pefa[aanterioar~aacestora#icontinu~laacestnivel#an[ulparietocolic.Marginea
lateral~ a rinichiului drept vine `n raport cu fa[a visceral~ a ficatului, iar cea a rinichiului
st]ng,cusplinasuperior,#icucolonuldescendentinferior.

Margineamedial~prezint~`nparteasamijlociehilul,lanivelulc~ruiarinichiuleste
abordatdepedicululs~uformat,`nsensanteroposterior,dinvenarenal~,arterarenal~#i
bazinetul(formul~memotehnic~VAB),precum#idinvaselelimfatice#inerviirinichiului.
Deasupra hilului rinichii vin `n raport cu glanda suprarenal~ respectiv~. Dedesubtul hilului
margineamedial~vine`nraportcumu#chiulpsoasmare#icuureterulcareesteata#atprin
ligamentulrenoureteralalluiNavaro.Ladistan[~seafl~pilieriidiafragmei#ivaselemari:pe
dreapta,venacav~inferioar~,iarpest]ngaaorta.
Polul superior al ambilor rinichi este acoperit de glanda suprarenal~ respectiv~, de
care este separat prin fascia intersuprarenorenal~ (expansiune a fasciei renale). Cel drept
estemaiaproapedevenacav~inferioar~dec]tcelst]ngdeaort~.
Polul inferior vine `n raport cu mu#chii psoasmare #i p~trat lombar, fiind situat la
distan[~variabil~decreastailiac~,34cmpedreapta#i5cmpest]nga#iestetangentla
marginea lateral~ a psoasului (important reper radiologic). Are medial ureterul #i mai la
distan[~venagenital~dreapt~.

TratatdeUrologie

Sinusulrenalesteocavitate`nparenchimulrenal,pemargineamedial~arinichiului,
cavitate `n care se p~trunde prin hilul renal. Profunzimea sinusului este de circa 3 cm #i
con[ine: [esut conjunctivoadipos, ramifica[iile vaselor renale, re[ea limfatic~ #i nervoas~
calicelemari#imici#iopartedinbazinet.

Splin

Duoden

Flexura
Flexura

hepatic
splenic

Colontranvers

Fig.4.Raporturilefe[eloranterioarealerinichilor
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Structuramacroscopic~arinichiului
Suprafa[a rinichiului este acoperit~ de o membran~ fibroas~, lucioas~ #i sub[ire,
numit~capsul~renal~care,odat~incizat~,poatefiu#or`ndep~rtat~,`ntruc]testelegat~de
rinichiprintracturiconjunctivefine.Capsulap~trunde,a#acumamprecizat,`nsinusulrenal
#i tapeteaz~ pere[ii continu]nduse cu p~tura conjunctiv~ a vaselor renale #i a calicelor.
Relativa inextensibilitate a capsulei face ca atunci c]nd se instaleaz~ rapid o hidronefroz~,
[esutulrenals~fiecomprimat,`ntruc]tcapsulanusedestindelafelderapid.Pesec[iune,
parenchimulrenalapareformatdindou~componente:
Zonamedular~format~din:
piramidelerenaleMalpighi,`nnum~rde7p]n~la14,piramideceaubazaspre
periferie #i aspect ro#iatic striat. Pentru neuitare #i `nv~[are facil~ consider~m nimerit a
reaminti c~ ele au #i fost comparate cu piramida aztec~ de la Teotihuacan (Mexic), de
exemplu! V]rful piramidelor se nume#te papil~ renal~ #i proemin~ `n sinusul renal, unde
este acoperit de un calice mic, fiecare rinichi av]nd 810 papile renale. Suprafa[a intra
caliceal~ a papilei este perforat~ de orificii `n care se termin~ tubii colectori. Aceste
piramidepotfi`mp~r[ite`ntrozon~periferic~(format~dinvase#itubicolectori)#iozon~
8

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

papilar~ prin care trec tubii colectori. O piramid~ renal~, `mpreun~ cu corticala care o
`nconjoar~formeaz~unlobrenal,`nfiecarerinichig~sinduse518lobi.
coloaneleBertinreprezint~prelungirialecorticalei`ntrepiramide.

Zonacortical~estesituat~laperiferie,areculoareabrung~lbuie#iaspectgranular,
dat de corpusculii renali. Este format~ dintro zon~ central~ (reprezentat~ de coloanele
renale)#iozon~periferic~situat~`ntrebazapiramidelor#isuprafa[arenal~.

Fig.5.Structuramacroscopic~arinichiului
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Structuramicroscopic~arinichiului
Stroma este reprezentat~ de [esutul conjunctiv intersti[ial, o re[ea dispus~ `n jurul
componentelorparenchimului,capabil~s~intervin~at]t`nproceseledevindecarealeziuni
lorrenale,c]t#iprinsecre[iadeprostaglandine`nprocesuldeformarealurinei.
Parenchimul este compus din tubi uriniferi sinuo#i, vase sangvine, vase limfatice,
nervi.Tubiiuriniferisuntforma[idindou~segmente:nefronul(segmentsecretor,deorigi
nemetanefrotic~)#itubulcolector(segmentexcretor,deoriginemezonefrotic~).
Nefronul este unitatea morfofunc[ional~ a rinichiului #i poate fi sub`mp~r[it `n
corpusculrenal#itubrenal.Tubiicolectorisedeschid`nductelepapilare(Bellini)carese
termin~lav]rfulpapileirenale,`ntrunmiccalice.

Laomexist~aproximativ11,5milioanedenefroni`nfiecarerinichi.
A.Corpuscululrenalesteoforma[iunesferic~cucare`ncepenefronul.Areundia
metrudeaproximativ0,2mm#iestesituatnumai`nparenchimulcortical,inclusiv`ncoloa
neleBertin.Uncorpusculesteformatdincapsulaglomerular~,glomerululcentral#imezan
giuglomerular.
9

TratatdeUrologie

Capsulaglomerular~Bowmannesteprimaparteatubuluirenal.Areoform~semi
lunar~#idoipoli,unulvascular#iunulurinar.Prinpolulvascular,p~trunde`ncapsul~arte
riolaaferent~cevaformaanseleglomerulare.Delapolulurinarpleac~tubulcontortproxi
mal.CapsulaBowmannesteformat~dindou~foi[e`ncontinuareunacualta,numitefoi[a
extern~(cuepiteliuscuamossimplu,reprezentatdeceluleaplatizatesaucubice,a#ezatepe
omembran~bazal~)#ifoi[aintern~sauvisceral~(`nraportcuanselevasculare).

Aceast~ foi[~ intern~ este format~ dintro membran~ bazal~ #i din podocite care
prezint~ extensii citoplasmatice terminale numite pedicele, care `nconjoar~ capilarele glo
merulare#iauraportintimcumembranelebazalecapilare.Spa[iileelectronomicroscopice
dintrepedicelesenumescporidefiltrare#iac[ioneaz~caobarier~defiltrarepentrumole
culeleproteice.Membranabazal~afoi[eiinternerealizeaz~,`mpreun~cumembranabazal~
aanselorcapilareglomerulare,ostructur~numit~membranabazal~glomerular~,realiz]nd
contactulintim`ntrevase#itub,contactnecesarprocesuluidefiltrare.Spa[iuldintrecele
dou~foi[ealecapsuleiBowmannsenume#tespa[iucapsular.Aiciseformeaz~filtratulglo
merular.

Glomerulul renal (cu aspect sferic) este reprezentat de o re[ea de anse capilare
con[inute`nconcavitateacapsuleiBowmann.
La nivelul polului vascular p~trunde o arteriol~ aferent~ capsulei glomerulare `n
concavitatea capsulei Bowmann. Aici se ramific~ `n 48 ramuri primare, care formeaz~ `n
finalcirca50deansecapilareglomerulare.Unlobulglomerularesteformatdintoateansele
capilaredependentedeoramur~primar~.Anseleglomerularedreneaz~,`nfinal,lanivelul
hiluluiglomerular,`ntroarteriol~eferent~.

Mezangiul glomerular este spa[iul intercapilar din centrul lobulului. Acest spa[iu
con[ine:celulemezangiale#imatriceamezangial~reprezentat~deosubstan[~intercelular~
amorf~.

Fig.6.Structuranefronului.

Bariera de filtrare hematourinar~ este format~ din: endoteliul capilar, membrana


bazal~capilar~,glicocalixul,formatdintrunstratdeglicoproteine`nc~rcatenegativ,curol
defiltrupentrumoleculele`nc~rcateelectric,poriidefiltraredintrepedicelelepodocitelor,
membranabazal~afoi[eivisceraleacapsuleiBowmann.Ultimeledou~membraneformea
z~`mpreun~membranabazal~glomerular~.
10

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Aparatuljuxtaglomerularesteunansamblustructuralformatdinmaimultegrupuri
celulare cu func[ii diferite, situat la polul vascular al glomerulului. Acest ansamblu celular
prezint~oinerva[ieadrenergic~(stimululsimpaticdetermin~secre[iaderenin~).Aparatul
juxtaglomerular este format din trei tipuri celulare: celulele mioepiteliale secretoare de
renin~,celulelelacisului,implicateprobabil`nmecanismeledefeedbackalemaculeidensa
#icelulelemaculeidensa,consideratecelulereceptor`nmecanismulsecre[ieiderenin~.

B.Tubulrenal
Esteformatdin:
tubulcontortproximal(situat`ncortical~)
tubdreptproximal
ansaHenleformat~din:unbra[descendentsub[ire,obucl~sub[irecesecontinu~#i
`nprimaparteabra[ului ascendent#iunbra[ascendentcare,dup~oprim~parte
sub[ire,secontinu~cutubuldreptdistal(gros)
tubdreptdistal
tubulcontortdistal(situat`ncortical~)
piesaintermediar~(tubulcolector)nufacepartedinnefron.

Histologic#ifunc[ionaltubulrenalse`mparte`ntreisegmente:
1. Segmentul proximal reprezentat de tubul contort proximal #i de tubul drept proxi
mal. `n acest segment se produc `n principal reabsorb[ia sodiului (printro pomp~
desodiu)#ireabsorb[iaproteinelor
2. Segmentulintermediar,reprezentatdeparteasub[ireaanseiHenle(510mm),
arerol`nconcentrareaurinei
3. Segmentuldistalreprezentatde:
partealarg~aanseiHenle,numit~#itubuldreptdistalav]ndcirca10mm.Aiciare
locunschimbactivdeioni(calciu#iclor),permeabilitatealaap~fiindsc~zut~
tubul contort distal este ultima component~ a segmentului distal cu o lungime de
circa5mm.
Zonaextern~amedulareiestehipooxigenat~chiar`ncondi[iinormale.`ncondi[iide
insuficien[~renal~acut~exist~dou~zonecaresuntpredominantafectate:segmentuldrept
al TCP, situat `n medulara extern~ (S3) #i por[iunea ascendent~, groas~, a ansei Henle
situat~`nmedular~(mTALmedullarythickascendinglimbofHenleloop).

Vasculariza[iarinichilor

`n mod obi#nuit, pediculul renal este constituit dintro singur~ arter~ #i o singur~
ven~, care p~trund `n rinichi prin hilul renal. Av]nd `n vedere raporturile diferite st]nga
dreapta,vomurm~rivaselerenaleseparat.
Vasculariza[iaarterial~
Arterarenal~dreapt~:
origine:dinaortaabdominal~,inferior de arteramezenteric~superioar~(discul
intervertebralL1L2)
direc[ie:u#ordescendent~
traiect:treceanteriordepilieruldreptaldiafragmei,coloaneivertebrale,lan[ul
simpatic lombar #i de mu#chiul psoas. Trece posterior devena cav~ inferioar~,
venarenal~ dreapt~,capulpancreasului,fasciaTreitz,segmentul descendental
duodenului.

11

TratatdeUrologie

Arterarenal~st]ng~:
origine:dinaortaabdominal~,nivelulmarginiiinferioareavertebreiL1(maisusdec]t
ceadreapt~)
direc[ie:u#oroblic~
traiect: trece anterior de mu#chiul psoas; trece posterior de vena renal~ st]ng~,
corpulpancreasului,venasplenic~.

Vasculariza[iarenal~estevariabil~bilateral,`ngeneralarterelebifurc]nduse`ntrun
trunchianterior(dincaresedesprindcele4arteresegmentareanterioareapical,antero
superior,anteroinferior#ipolarinferior)#iuntrunchiposterior(arterasegmentar~poste
rioar~).Arterelesegmentarese`mpart`nsinusulrenal`nramurilobare,carelar]ndullorse
`mpart`nramuriinterlobarecep~trund`nparenchimulrenallanivelulcoloanelorBertin;la
baza piramidelor Malpighi, arterele interlobare se continu~ cu arterele arcuate ce merg
paralel cu baza piramidelor #i emit numerose artere interlobulare cu traiect radiar spre
cortical~.

a.
b.
c.

Fig.7.Dispunereavasculariza[ieiintrarenale:a)Fa[aanterioar~arinichiuluidrept;b)Fa[aconvex~;
c)Fa[aposterioar~arinichiuluidrept
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Vasculariza[iaarterial~arinichiuluieste,`nprincipiu,ovasculariza[iedetipterminal
(obstruarea unei artere duce la moartea teritoriului vascularizat, `ntre arterele teritoriilor
vecineneexist]ndanastomoze).

`n25%p]n~la40%dinrinichise`nt]lnescvaria[iidelaschemaprezentat~.Celemai
frecvent`nt]lnitesuntarterelesupranumerarecareaparmaialespeparteast]ng~.Arterele
polareinferioarepeparteadreapt~autendin[as~`ncruci#ezeanteriorvenacav~inferioar~,
`n timp ce `n ambele situa[ii aceste artere pot `ncruci#a anterior sistemul colector renal,
provoc]ndobstruc[iajonc[iuniipieloureterale.Arterapolar~vascularizeaz~oanumit~zon~
#i ligaturarea ei duce la ischemia [esutului vascularizat. La rinichiul ectopic, prezen[a
arterelor supranumerare este #i mai frecvent `nt]lnit~, av]nd origine variat~ (trunchiul
celiac,arteramezenteric~superioar~etc.).
Artereleinterlobareurc~printrecoloaneleBertin#ilabazapiramidelorMalpighise
continu~cuarterelearcuate.Acesteamergparalelcubazapiramidelor#iemitnumeroase
12

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

artere interlobulare ce radiaz~ spre cortical~. O parte din arterele interlobulare str~bat
suprafa[arinichiului#isenumescartereperforante(sepotanastomozacuarterelere[elei
capsulare,juc]ndmaimultteoreticunrol`nstabilireauneicircula[iicolaterale).

Arterele interlobulare sunt sursa arteriolelor aferente (unele arteriole aferente pot
pleca direct din arterele arcuate). Acestea p~trund `n corpusculii renali la nivelul hilului
glomerular #i formeaz~ glomerulii renali. Ansele glomerulare se concentreaz~ `n final `n
arteriola eferent~ care p~r~se#te glomerulul la nivelul hilului #i se recapilarizeaz~ `n jurul
tubilorrenali.Aceast~ultim~re[eacapilar~vafidrenat~desistemulvenosalrinichiului.

Fig.8.Vasculariza[iarinichiului
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Dinarterelerenalesedesprindramuripentruglandasuprarenal~(unasaumaimulte
artere suprarenale inferioare), capsula renal~, partea superioar~ a ureterului #i gr~simea
perinefretic~. Ramurile capsulare se pot anastomoza cu ramuri ale arterelor suprarenale,
genitale #i lombare. Anatomi#tii au identificat o zon~ cu vasculariza[ie mai s~rac~ (pauci
vascular~)`ntrunplanrelativfrontalcaretrecela0,5cmposterior#an[uluilongitudinalde
pemarginealateral~arinichiului(liniapaucivascular~aluiHyrtl),plancearputeafifolosit
`nchirurgiarenal~pentruacceslacalice.

Vasculariza[iavenoas~

Din re[eaua capilar~ peritubular~ #i din re[eaua periferic~ venoas~ subcapsular~,


s]ngele venos este drenat `n venele interlobulare care `nso[esc arterele cu acela#i nume,

13

TratatdeUrologie

termin]nduse`nvenelearcuatesituatelabazapiramidelorMalpighi(vasculariza[iavenoas~
nuestedetipterminalcaceaarterial~!).

La nivelul coloanelor Bertin, venele arcuate se continu~ cu venele interlobare.


Acestea coboar~ printre piramidele Malpighi p]n~ `n sinusul renal. Aici, la nivelul calicelor
mici se unesc #i formeaz~ venele lobare. `n final, prin unirea venelor lobare se formeaz~
venelesegmentare(`ngeneraltrei,darput]ndajungep]n~lacinci).Acesteaseunescchiar
`nsinus(uneori`ns~imediat`nafarasinusului)#iformeaz~venarenal~.Venasegmentar~
inferioar~trece,deobicei,anteriordejonc[iuneapelviureteral~.

Superiordev~rsareaveneigenitaledrepte,venarenal~dreapt~(lung~de24cm)se
vars~peparteadreapt~aveneicaveinferioare.Venarenal~st]ng~(lung~de610cm)are
traiectposteriordecorpulpancreasului,ajungeanteriordeaort~#itreceprinpensaaorto
mezenteric~. Se vars~ `n vena cav~ inferioar~ mai sus de vena renal~ dreapt~. Drenajul
venos suprarenalian este diferit `n st]nga (unde vena suprarenalian~ se une#te cu vena
frenic~inferioar~st]ng~#isevars~`nvenarenal~st]ng~)fa[~dedreapta(venasuprarenal~
dreapt~sevars~direct`nvenacav~inferioar~),situa[iesimilar~cuceaavenelorgenitale.

Trebuiecunoscute#ianastomozelevenoasesituate`ngrosimeaperirenal~:anasto
mozaportocav~(`ntrevenelerenalecaresevars~`nvenacav~#ivenelecolicedrenatede
sistemul port) #i anastomoza cavocav~ (prin venele lombare care comunic~ cu venele
azygoscedreneaz~`nvenacav~superioar~).

C~ileexcretoriialerinichiuluisuntreprezentatede:
calicelemicisuntforma[iunimusculomembranoasecuaspectconic,ac~rorbaz~
muleaz~papilelerenale#ialec~rorv]rfuriseunesc#iformeaz~calicelemari.

Calicelemicisunt`nnum~rde612,maipu[inedec]tnum~rulpiramidelor(deoarece
uneledintrepiramidesuntcompuse#iauosingur~papil~).Auofa[~intern~(papilar~)#io
fa[~extern~(sinusal~).`ntrepapil~#ifa[aintern~acaliceluisedelimiteaz~unspa[iusemi
lunarnumitfornixcaliceal.

`nsinus,calicelemiciauraportcuvasele#i[esutuladipossinusal.
calicele mari sunt tuburi musculomembranoase ce se formeaz~ `n sinusul renal
prin unirea a 24 calice mici. Frecvent exist~ 23 calice mari (superior, mijlociu #i
inferior), cu o lungime de circa 13 cm. Prin unirea calicelor mari se formeaz~
bazinetul
pelvisul renal (bazinetul) este o forma[iune musculomembranoas~, dilatat~, rezul
tat~ prin unirea calicelor mari. Este frecvent comparat cu o p]lnie turtit~ antero
posterior.

Forma#im~rimeabazinetuluidepinddemoduldeunire#idimensiunilecalicelor.
Av]nd o form~ triunghiular~ de p]lnie turtit~ anteroposterior, bazinetul prezint~ o
fa[~anterioar~#iunaposterior~,obaz~sprecareconvergcalicelemari#iunv]rfcarese
continu~cuureterul.Bazinetulseproiecteaz~lanivelulapofizelortransversealevertebrelor
L1/L2 Cunoa#terea orient~rii spa[iale a bazinetului #i calicelor este necesar~ `n chirurgia
percutanat~renal~,iarcaleadeabordaacestoraesteesen[ial~pentruchirurgulurolog.

Pediculul renal cuprinde, al~turi de bazinet, vase sangvine, pozi[ia bazinetului `n


sinusul renal fiind variabil~. Cel mai frecvent, bazinetul prezint~ o parte intrasinusal~ #i o
parteextrasinusal~(de#isuntcazuri`ncarebazinetulseg~se#tedoarintrasinusal!).
Astfel, `n partea intrasinusal~ se identific~ pornind dinspre anterior spre posterior:
ramurile segmentare ale venei renale, ale arterei renale #i ale bazinetului. Dispozi[ia
14

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

elementelorpedicululuirenalrespect~,deobicei,dispunereaven~renal~arter~renal~
bazinet dinspre anterior spre posterior #i bazinet ven~ renal~ arter~ renal~ `n sens
craniocaudal.
`n partea extrasinusal~ posterior se afl~ capsula adipoas~ #i mu#chiul psoas, iar
anteriorpeparteadreapt~fasciaTreitz#i duodenuldescendent,iarpest]ngacorpulpan
creasului.

Limfaticelerinichiului`nso[escvaseledes]ngeprincoloaneleBertinform]ndc]teva
trunchiurilimfaticemaimari,caredup~reunirisuccesiveformeaz~plexullimfaticsituatsub
capsulafibroas~#iplexullimfaticalcapsuleiadipoase.Demen[ionatc~vaselelimfaticese
unescpemargineamedial~arinichiuluicuvaselecarevindelaureter#ibazinet.Drenajul
limfatic al rinichilor variaz~. Astfel, pe partea st]ng~ prima sta[ie limfatic~ o constituie
ganglionii paraaortici laterali st]ngi #i ganglionii pre #i retroaortici situa[i `ntre artera
mezenteric~inferioar~#idiafragm.Ocazional,samaiconstatatundrenajlimfaticadi[ional
porninddelarinichiulst]ngspreganglioniiretrocruralisaudirect`nductultoracic,deasupra
diafragmului.Peparteadreapt~,limfaajunge`nganglioniiinteraortici#iganglioniipericavi
anteriori #i posteriori. Ocazional #i aici sa constatat un drenaj limfatic spre ganglionii
retrocruralisauganglioniilateralist]ngiparaaortici.

Inerva[iarinichiului
Func[ionarea cu succes a rinichiului transplantat, practic lipsit de inerva[ie, face ca
spa[iul acordat acestui subcapitol s~ fie restr]ns. Se #tie c~ `n [esutul conjunctiv lax peri
arterial exist~ o re[ea de fibre nervoase care se constituie `ntrun plex renal de natur~
vegetativ~(av]ndocomponent~simpatic~predominant~).Conexiunileacestuiplexprovin
din:plexulmezentericsuperior,ganglioni#iplexulceliac,plexulaorticrenal#ilan[ulsimpa
ticlombar.

Fig.9.Re[eaualimfatic~renal~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

15

TratatdeUrologie

Glandelesuprarenale

Suntorganeretroperitonealesituatelapolulsuperioralrinichiului,av]nddimensiuni
cuprinse`ntre35cmlungime,2,53cml~[ime,46cmgrosime#iogreutateaproximativ~
de68grame.
Cele dou~ glande sunt situate `n gr~simea retroperitoneal~ `n dreptul vertebrelor
T11T12#isunt`nconjuratede[esutconjunctivlaxfiind`ncorporatedefasciarenal~.
Suprarenaladreapt~areform~piramidal~,fiindmai`ngust~#imailung~dec]tcea
st]ng~;seg~se#telapolulsuperioralrinichiuluidrept,fiind`ncontactstr]nscufa[aposte
rolateral~aveneicaveinferioare.Ceamaimareparteaglandeinuesteacoperit~deperito
neu,excep[ief~c]ndparteainferioar~afe[eianterioare,fa[~cevine`nraportcuficatulpe
carelas~impresiuneasuprarenal~.
Suprarenala st]ng~ are form~ semilunar~ #i este situat~ par[ial `n contact cu polul
superiorrenalst]ng#ipar[ialcumargineamedial~arinichiuluist]ng,put]ndajungep]n~`n
dreptulartereirenalest]ngi.Esteacoperit~deperitoneupefa[aanterioar~.Este`ncontact
cu por[iunea cardial~ a stomacului, cu splina #i pancreasul. Posterosuperior cele dou~
glandeauraportcudiafragmul.
Abordulchirurgicalalcelordou~glandepoatefianteriortransperitonealsaulombar
retroperitoneal(clasicsaulaparoscopic).
Suprarenalelesuntconstituitedindou~p~r[idistinctedinpunctdevederestructu
ral,func[ional#iembriologic:corticosuprarenala(stratulexterncarearepesec[iuneculoare
galben~caracteristic~,fiindu#orderecunoscut`ntimpulinterven[ieichirurgicale)#imedu
losuprarenala(stratulinternestedeculoaremaroniesauro#iatic~#i`nmodnormalnuse
vizualizeaz~).
Corticosuprarenala are origine embriologic~ mezodermic~, deriv]nd din epiteliul
celomic al mezonefrosului `n timp ce medulosuprarenala are origine neuroectodermic~,
proveninddincreastaneural~.Asociereamorfologic~a[esuturilorcorticoadrenal#icroma
finseexplic~prinvasculariza[ialorcomun~.
Absen[a congenital~ unilateral~ a glandei este o anomalie rar~. Dac~ rinichiul este
absent,suprarenalaesteprezent~`npozi[ienormal~,darareform~discoid~(Sinescu#icol,
2006).
Glandele sunt `nvelite de o capsul~ fibroas~ ce trimite ramifica[ii spre interiorul
glandei.
Cortexulsuprarenalianse`mparte,delaexteriorspreinterior,`ntreizonedistincte,
cuindividualitatemorfologic~,enzimatic~,hormonal~#inosologic~:zonaglomerular~,zona
reticulat~#izonafasciculat~.
Corticosuprarenala(cortexulsuprarenalian)secret~maimul[ihormonigrupa[i`ntrei
maricategoriisubnumeledecorticosteroizi:1)mineralocorticoizii(aldosteronul),2)gluco
corticoizii(cortizolul),3)hormoniisexuali(androgeni#iestrogeni)
Medulosuprarenalasecret~epinefrin~#inorepinefrin~.

Vasculariza[iaarterial~

Fiecaregland~areobogat~vasculariza[iearterial~ceprovinedintreisurse:
1)arterasuprarenalian~superioar~ramdinarteradiafragmatic~inferioar~
2)arterasuprarenalian~mijlocieramdinaortaabdominal~
3)arterasuprarenalian~inferioar~ramdinarterarenal~ipsilateral~.
16

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Arterele suprarenale formeaz~ un plex la nivelul capsulei din care se desprind


arterele corticale, iar din acestea pleac~ sinusoide ce `nconjoar~ cordoanele de celule din
cortex.Arterelemicipenetreaz~glandaav]nddispozi[iecircumferen[ial~#il~s]ndsuprafa[a
anterioar~#iposterioar~par[ialavascular~(Sinescu#icolab.,2006).
Medulosuprarenala prime#te s]nge arterial din dou~ surse: arterele capsulare #i
sinusoidele corticale; `n acest fel, celulele medulosuprarenalei primesc s]nge din cortico
suprarenal~cuomarecantitatedehormonicorticosteroizi,stimul]ndastfelenzimaPNMT
(feniletanolaminNmetiltransferaza)ceconverte#tenoradrenalina`nadrenalin~(Sinescu#i
colab.,2006).

Vasculariza[iavenoas~

S]ngeledelanivelulmedularei#icorticaleidreneaz~`nvenacentromedular~care
se vars~ `n vena cav~ pe partea dreapt~ #i `n vena renal~ pe partea st]ng~. Vena
suprarenal~st]ng~dreneaz~direct`nvenarenal~st]ng~,lacirca3cmdeorigineaacesteia
dinvenacav~inferioar~,adesealaacela#inivel(darpeparteaopus~)lacaresedeschide#i
venagenital~st]ng~.

Drenajullimfaticseface`nganglioniiperiaortici#ipericavi.

Inerva[ia provine din ganglionul semilunar, nervul splanhnic #i nervul frenic.


Medulosuprarenala este considerat~ a fi un ganglion simpatic periferic #i prime#te fibre
preganglionaresimpaticepecaleanervilorsplanhnici.

Fig.10.Pediculelevascularesuprarenaliene
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

17

TratatdeUrologie

Ureterele

Generalit~[i
Ureterele sunt conducte fibromusculare, situate retroperitoneal, prin intermediul
c~rorapelvisulrenalcomunic~cuvezicaurinar~.
Traiectullor`ncepedelaniveluljonc[iuniipieloureterale,fiind,defapt,continuarea
pelvisuluirenal,#isesf]r#e#telanivelulorificiilorureterale`nvezicaurinar~.
Lungimea medie la adult este `ntre 25 #i 35 de centimetri, ureterul st]ng fiind cu
aproximativ1cmmailungdec]tceldrept(pozi[iemai`nalt~arinichiuluist]ng).
Diametrulinteriorvariaz~dela3la9mm,exist]ndtreipor[iunicucalibru`ngustat:
primapor[iunecudiametruredusseafl~laniveluljonc[iuniipieloureterale,ceadeadouala
nivelul `ncruci#~rii ureterului cu vasele iliace #i cea dea treia (cea mai `ngust~) se afl~ `n
por[iuneaintramural~aureterului(jonc[iuneaureterovezical~).
Aceste trei zone `ngustate au importan[~ practic~ deosebit~, fiind locul cel mai
frecvent de impactare a calculilor ureterali #i por[iunile cele mai susceptibile perfora[iilor
ureterale`ncadrulmanevrelorurologiceendoscopice.
Clasic se descriu dou~ por[iuni ale ureterului: abdominal~ (de la jonc[iunea pielo
ureteral~ p]n~ la nivelul liniei terminale a pelvisului osos) #i pelvin~ situat~ `n bazin `n
[esutul conjunctiv pelvisubperitoneal. Por[iunea abdominal~ este sub`mp~r[it~ de creasta
iliac~`nsegmentullombar(911cm)#isegmentuliliac(34cm),aceast~sub`mp~r[irefiind
folosit~`nprezent#ipentrudescrierealocaliz~riicalculilorureterali.
De asemenea, `n scopul standardiz~rii descrierilor radiologice #i al op[iunilor de
tratamentureterulpoatefi`mp~r[it`nsuperior/proximal(delapelvisulrenallamarginea
superioar~ a sacrului),mijlociu (p]n~ la marginea inferioar~ a sacrului) #i distal (marginea
inferioar~asacruluip]n~lavezicaurinar~).
Peretele ureteral este alc~tuit din trei straturi, de la exterior spre interior acestea
fiind: adventicea [esut conjuctiv #i elastic `nglob]nd re[eaua vascular~, limfatic~ #i ner
voas~,muscularacufibredispuse`ntreistraturi(longitudinallainterior,circularlamijloc
#ilongitudinalcudispunerehelicoidalspiralat~laexterior),mucoasaceformeaz~pliuri
longitudinale d]nd aspect stelat lumenului ureteral `n sec[iune transversal~, alc~tuit~ din
corion#iuroteliuepiteliudetranzi[iecesecontinu~lanivelulveziciiurinare#iureterului
contralateral.

Anatomiechirurgical~
Ureterul continu~ pelvisul renal av]nd traiect retroperitoneal anterior de mu#chiul
psoas p]n~ la nivelul bifurca[iei vaselor iliace comune, c]nd `#i schimb~ traiectul spre
posteroinferiorodat~cup~trunderea`npelvis.
Laacestnivel,undeureterul`ncruci#eaz~anteriorvaseleiliacecomuneconformlegii
luiLuschka(la1,5cmsubbifurca[iepedreapta#ila1,5cmdeasuprabifurca[ieipest]nga)se
afl~locul`ncareureterulestecelmaiu#oridentificabil,put]ndfichiarpalpat.
Ureterul este o structur~ fibromuscular~ cu activitate peristaltic~, vizibil~ #i la
stimularea cu o pens~ atraumatic~; suprafa[a ureteral~ are o re[ea capilar~ #i arteriolar~
bogat~realiz]ndunaspectcaracteristiccefaciliteaz~recunoa#tereasa.
18

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Fig.11.Ureterele#iaportulvascularalacestoralab~rbat
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Por[iunealombar~aureteruluiareurm~toareleraporturi:

Posteriorraporturicu:
mu#chiulpsoas
apofizeletransverselombare(laaproximativ1cmlateraldeacestea)
ramurialeplexuluilombar(nervulfemurocutanat#igenitocrural)ceexplic~iradierea
durerii`ncolicarenal~(spreorganelegenitaleexterne#ispretrigonulfemuralScarpa).

Anterior,`ndreapta,vine`nraportcu:
vasele gonadale care `ncruci#eaz~ ureterul `n unghi ascu[it, dinspre medial spre
lateral,`ndreptulvertebreiL4
peritoneul parietal fiind aderent de acesta (mai pu[in primii 45 cm) #i prin
intermediulacestuia:
19

TratatdeUrologie

cuduodenul
fasciadecoalescen[~retrocolic~Toldt#ivaselecolicedrepte
r~d~cinamezenterului.

Anterior,`nst]nga,vine`nraportcu:
vasele gonadale care `ncruci#eaz~ ureterul `n unghi ascu[it, dinspre medial spre
laterallanivelulvertebreiL4
peritoneulparietal#iprinintermediulacestuia:
- cu fascia de coalescen[~ retrocolic~ Toldt II, vasele colice st]ngi #i vena
mezenteric~inferioar~
- r~d~cina mezocolonului sigmoid; ureterul se palpeaz~ la v]rful recesului
intersigmoidiandelimitatdeceledou~r~d~cinialemezosigmoidului.

Acesteraporturiexplic~deceprocesemalignesauinflamatoriialeileonuluiterminal,
aleapendicelui,alecolonuluiascendentsaudescendentpotafectadirectureterulipsilateral,
put]ndap~reahematurie,fistulesauchiarobstruc[ieureteral~complet~.

Medial,`ndreapta,ureterulareraporturicu:
flanculdreptalVCI
noduliilimfaticilaterocavi
lan[ulsimpaticparavertebrallombar.

Medial,`nst]nga,ureterulareraporturicu:
flanculst]ngalaorteiabdominale
noduliilimfaticilateroaortici
lan[ulsimpaticparavertebralst]ng
arculvascularTreitz.

Lateralureterulareraporturicu:
polulinferioralrinichiului
colonulascendent(`ndreapta)#icolonuldescendent(`nst]nga)
vaselegonadalece`ncruci#eaz~anteriorureteruldinspremedialsprelateral`n
dreptulL4.

Rareori ureterul drept trece posterior de VCI #i ulterior medial de aceasta (ureterul
retrocav)faptceproducecompresia#iobstruc[iaureterului`namonte.

`npor[iuneapelvin~ureterul`ncruci#eaz~anteriorvaseleiliacecomune,mergedea
lungul marginii inferioare a arterei iliace interne #i traverseaz~ ramurile anterioare ale
acesteia.
La femei ureterul terminal are traiect descendent la aproximativ 2 cm lateral de
cervixuluterin#iesteintersectatanteriordeartera#ivenauterin~.
Acesteraporturisuntdeoimportan[~deosebit~`nchirurgiauroginecologic~pelvin~,
ureterul put]nd fi afectat `n cursul histerectomiei sau ca urmare a proceselor inflamatorii
saumalignealeanexelorgenitale.

20

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital


Fig.12.Segmentulpelvinprofundalureteruluilafemeie;aspectlateral
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Lab~rba[iureterulpelvinterminaleste`ncruci#atanteriordec~trecanaluldeferent,
locul de p~trundere `n peretele vezicii urinare fiind situat `n imediata vecin~tate a polului
superioralveziculeiseminale.

Fig.13.Vedereposterioar~regiuneaprostatovezical~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

21

TratatdeUrologie

Vasculariza[ia#idrenajullimfatic

Ureterul are o vasculariza[ie arterial~ bogat~, sus[inut~ de multiple ramuri pe tot


traiectulacestuia.Ureterulsuperiorprime#teramuriarteriale`nprincipaldinarterarenal~;
ureterulmijlociuestevascularizatprinramurialeartereigonadale,aortei,arterelorcolice,
arterei iliace comune #i hipogastrice; ureterul inferior prime#te vasculariza[ie din artera
vezical~superioar~#iinferioar~,arterarectal~medie,arterauterin~#ivaginal~.Vasculari
za[iaureteruluiabdominalesteasigurat~deramuriceprovindinregiuneamedial~pec]nd
`ncazulureteruluipelvinramurilearterialeprovindinregiunealateral~.
La nivelul adventicei ureterale multiplele surse vasculare formeaz~ o re[ea anasto
motic~fin~,faptceareoimportan[~chirurgical~deosebit~,permi[]ndmobilizarea#iizola
reaaimportantepor[iunideureterdin[esutulretroperitoneal,f~r~aafectavasculariza[ia
acestuia.
Vasculariza[iavenoas~esteparalel~cuceaarterial~,s]ngelevenosdinre[eauaperi
ureteral~fiindcolectat`nveneleprincipale.
Drenajullimfaticesteasiguratdesta[iilelimfaticedinapropiereaureteruluiastfel:
ureterulabdominaldreptestedrenatdeganglioniiparacavi#iinteraorticocavi
ureterulabdominalst]ngdreneaz~primar`nganglioniiparaaorticist]ngi
ureterulpelvindreneaz~`nganglioniiiliaciinterni,externi#icomuni.

Fig.14.Ureterpelvinlafemeie
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

22

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Inerva[iaureteruluisuperiorprovine `nspecialdin plexurice`nso[escvaselegona


dale. Ureterul pelvin este inervat prin ramuri ale plexurilor hipogastric #i pelvin, av]nd `n
principalfibresimpatice.
Peristaltica ureteral~ normal~ nu necesit~ control extrinsec, locurile de generare a
impulsurilor av]ndu#i originea `n calicele minore ale sistemului colector renal; se pare c~
sistemulnervosautonomextrinsecarputeaexercitaunefectmodulator`nacestproces.

C~iledetransmitereadurerii#ipercep[iadurerii

Fibrele nervoase ce transmit durerea de la nivelul rinichiului, al bazinetului #i al


ureterului sunt stimulate de receptori sensibili la distensia capsulei renale, a sistemului
colector sau a ureterului. De asemenea, irita[ia mucoasei tractului urinar poate stimula
receptoriidurerii,impulsurilefiindtransmiseprinintermediulfibrelorsimpatice.

Fig.15.Inerva[iasomatic~#iautonom~asistemuluiurogenital
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

23

TratatdeUrologie

Vezicaurinar~

Vezicaurinar~esteunorgancavitarsituatsubperitoneal#isuprasimfizar`ncopil~rie,
ajung]nd`npozi[iepelvin~#iretrosimfizar~lapubertate.

Capacitateanormal~este`njurde450500ml,maimarelafemei(aproximativ700
ml)#icevamaimic~lab~rbat(300ml),`ns~`ncondi[iipatologicepoatevariadela1020ml
p]n~lac][ivalitri.

Formasaesteovoidal~`nmodclasic,lavezicagoal~,descriindusev]rful,baza#icei
doipere[ianterior#iposterior.

1) v]rful legat de ombilic prin intermediul ligamentului ombilical median (uraca).


Uracaesteocoard~musculofibroas~care,laadult,conecteaz~apexulvezicalcuombilicul.
Este rezultanta obliter~rii la na#tere a canalului alantoidian, iar defectul acestui proces
ontogenetic predispune la formarea de cloazonari diverticulare sau la apari[ia fistulei
vezicoombilicale. De asemenea, epiteliul lumenului acestui canal poate da na#tere unui
cancerrar`nt]lnitadenocarcinomdeurac~.
2) peretele posterior, care la b~rbat are raporturi cu rectul #i la femei cu vaginul,
esteparteaceamaipu[inmobil~.
3)pereteleanteriorcareestesituatretrosimfizaratuncic]ndvezicaestegoal~.
4)bazaveziciicarecon[inecolulvezical

Explorarea cistoscopic~ cu vezica plin~ consemneaz~: peretele anterior, peretele


posterior(cutrigonul#ibasfondulvezical)#idoipere[ilateralist]ng#idrept.

Mijloacedefixare

Peretele anterior corespunde por[iunii dintre apex #i colul vezical #i reprezint~


`mpreun~cuceidoipere[ilateralipor[iuneamobil~aveziciiurinare.

Peritoneul ce acoper~ peretele superior vezical se continu~ pe suprafa[a intern~ a


pereteluiabdominal.Atuncic]ndestedestins~,vezicaurinar~ascensioneaz~suprasimfizar,
separ]nd peritoneul de peretele abdominal anterior situ]nduse `n spatele mu#chilor pira
midal#idreptabdominal.Acestlucrufaceposibil~efectuareamanevreidemontareacisto
stomeisuprapubienef~r~risculdeaafectaintegritateacavit~[iiperitoneale.

Pel]ng~urac~,por[iuneamobil~aveziciiurinaremaiesteancorat~#ideligamentele
ombilicale mediale (por[iunea obliterat~ a arterelor ombilicale, acestea limit]nd lateral
fasciaombilicoprevezical~).

Por[iunea posteroinferioar~ reprezint~ por[iunea fix~ a vezicii urinare. Fixarea se


face prin intermediul ligamentelor puboprostatice la b~rbat #i pubovezicale la femeie.
Mu#chiul rectovezical (la b~rbat) #i ligamentul vezicouterin (la femeie) sunt mijloace de
fixaresuplimentar~atrigonuluivezical.

Un rol important `n fixare #i asigurarea conten[iei revine diafragmei urogenitale


(plan#eul pelvin) care men[ine tonusul uretrei proximale #i `mpiedic~ cobor]rea vezicii
urinare,precum#imodificareaunghiuluivezicouretral.

Raporturi

Peritoneul visceral vezical ce acoper~ fa[a superioar~ a vezicii urinare la b~rbat


coboar~ posterior p]n~ `n por[iunea terminal~ a veziculelorseminale#iapoi trece pe fa[a
anterioar~arectuluiform]ndrecesulrectovezical(funduldesacDouglas).
24

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Inferior de acest reces, raportul cu rectul se face prin intermediul aponevrozei


prostatoperitoneale Denonvilliers. `n partea superioar~ a acestui sept se afl~ ampulele
canalelordeferente#iveziculeleseminale.

Parteadecliv~apereteluiposteroinferioralveziciiurinareseafl~`nraportcubaza
prostatei.

La femeie peritoneul vezical posterior se reflect~ pe fa[a anterioar~ a uterului la


nivelul istmului form]nd recesul vezicouterin. Inferior de acest reces, peretele posterior
vezicalvine`nraportcufa[aanterioar~acoluluiuterin#iapereteluivaginal;acestraport
explic~ posibilitatea apari[iei fistulei vezicovaginale dup~ opera[ia de colpohisterectomie
total~.

Spa[iul prevezical anterior, extraperitoneal, situat `n spatele simfizei pubiene #i a


tecii posterioare a mu#chiului drept abdominal se nume#te spa[iul Retzius #i con[ine pe
l]ng~[esutcelulogr~sos,#iparteaanterioar~aplexuluivenosvezicoprostatic(Santorini)`n
caresevars~venadorsal~apenisuluisauclitorisului,precum#iganglioniilimfaticivezicali.
Extravazarea urinar~ cauzat~ de ruptura vezical~ extraperitoneal~ sau de perforarea
capsuleiprostaticesepoateextinderapid`nacestspa[iuput]ndfuza`nsenscranial.Spa[iul
Retzius este un reper anatomic important, fiind cale de abord chirurgical al prostatei
(adenomectomieprevezical~Millin,prostatectomiaradical~retropubian~).

Parteainferioar~apere[ilorlateraliaiveziciiurinare(subperitoneal~)vine`ncontact
par[ialcuplan#eulpelvinprecum#icucanaleledeferente(b~rba[i)sauligamentelerotunde
aleuterului(femei).C]ndvezicaurinar~seumple,p~r[ileinferioarealepere[ilorlateralivin
`n contact cu mu#chiul obturator, acest raport fiind foarte important `n chirurgia
endoscopic~ transuretral~ endovezical~: curentul de electrorezec[ie tip Faraday excit~
mu#chiulobturator,contrac[iaacestuiaput]ndducelaincidenteintraoperatorii:perforarea
peretelui vezicii urinare urmat~ de extravazarea lichidului de sp~l~tur~ sau s]nger~ri
importante.

Fig.16.Vezicaurinar~#iraporturileacesteialab~rbat(sec[iunesagital~)
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

25

TratatdeUrologie

Fig.17.Vezicaurinar~#iraporturileacesteialafemeie(sec[iunesagital~)
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Structuraintern~aveziciiurinare

Aspectulinterioralveziciiurinarevariaz~`nfunc[iedegraduldeumplere;c]ndeste
goal~ mucoasa prezint~ numeroase falduri care dispar odat~ cu destinderea vezicii. Zona
trigonuluivezicalfaceexcep[ie,mucoasafiindneted~,aderent~ladetrusorulsubiacent.

Exist~c]tevaelementeendoscopicedereper`ninteriorulveziciiurinare:

1)colulvezicalreprezint~por[iuneaceamaidecliv~aveziciiurinare#ifaceleg~tura
cuuretrasupramontanal~.

Lanivelulcoluluivezicalfibrelemuscularenetedeseunescform]nduninelmuscular
numitsfinctervezicalintern.`naceast~zon~,mu#chiuldetrusorestemorfologic#ifarma
cologicdistinctfa[~derestulveziciiurinare,av]ndoinerva[ieadrenergic~multmaiintens~.
Stimulareaacestorfibreproduce`nchidereacolului#i,lab~rbat,poateasiguraocontinen[~
perfect~`ncondi[iiledistrugeriisfincteruluiexternstriat(Walsh#icol,2002).

Distrugerea fibrelor simpatice ce inerveaz~ colul vezical (polineuropatia diabetic~,


limfodisec[ia`ncancerultesticular)poateficauz~aejaculariiretrograde.

La femeie fibrele musculare de la nivelul colului vezical nu sunt circulare, conti


nu]nduse oblic #i longitudinal la nivelul uretrei proximale; `n plus, inerva[ia adrenergic~
este mai s~rac~, astfel `nc]t aceast~ regiune joac~ un rol mai redus `n ceea ce prive#te
continen[a. `n 1986, Versi afirm~ c~ la 50% dintre femeile continente, urina p~trunde `n
por[iuneaproximal~auretrei`ntimpulepisoadelordetuse(Versi#icol,1986).
26

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Orificiulinternaluretreiareaspectvariabil,lafemei#icopiifiindrotund,`ntimpce
lab~rba[iareaspectsemilunar,cuobuz~anterioar~#iunaposterioar~.

2)trigonulvezical(Lieutaud)esteosuprafa[~neted~#itriunghiular~cuprins~`ntre
cele dou~ orificii ureterale #i orificiul intern al uretrei. Zona trigonului vezical con[ine trei
straturi musculare cu un aranjament specialce `mpiedic~ refluxul vezicoureteral `n timpul
umpleriivezicii.

3) plica interureteral~ este o proeminen[~ transversal~ a mucoasei, `ntins~ `ntre


celedou~orificiiureterale;`nprofunzimeseg~se#temu#chiulinterureteral.

4) recesul (fosa) retrotrigonal este depresiunea situat~ `n spatele plicii interure


terale; mai este numit #i basfond. `n hiperplazia prostatic~ prin ridicarea trigonului
vezicalbasfondulsead]nce#tefavoriz]ndstr]ngereaurinii#isecundarformareadecalculi.

5) orificiile ureterale sunt situate de o parte #i de alta a plicii interureterale la


aproximativ34cmdistan[~unuldecel~lalt.Loculdep~trunderealureterelor`nvezic~este
situat la 2 cm de linia median~ #i la aproximativ 2,5 cm posterosuperior de colul vezical.
Ureterelestr~batperetelevezical,oblic,peodistan[~deaproximativ1,52cm,termin]ndu
se la nivelul orificiilor ureterale; aceast~ por[iune de ureter intramural (jonc[iunea
ureterovezical~)estemult`ngustat~,fiindunlocfrecventdeimpactareacalculilorureterali.

Odat~cuumplereaveziciiurinareseproduce#ioocluziepasiv~aorificiilorureterale
cauzat~decompresiuneamu#chiuluidetrusoralec~ruifibrecirculare`nconjoar~incomplet
ureterul `n aceast~ por[iune, fiind prevenit astfel refluxul vezicoureteral. Cauza refluxului
pareafiuntraseuureteralsubmucospreascurt#iopreaslab~sus[inereadetrusorului.

Reten[ia cronic~ de urin~ #i presiunea intravezical~ cu dezvoltare cronic~ (`n


obstruc[iilesubvezicale)potcauzahernierialemucoaseivezicaleprinpunctulcelmaislab
al acestui hiatus ureteral, punct situat deasupra ureterului, duc]nd la apari[ia refluxului
vezicoureteral#iformareadediverticule(diverticulHutch)(Walsh#icol,2002).

Structurapereteluivezical

Din punct de vedere histologic, de la interior spre exterior, vezica urinar~ are
urm~toarelestraturi:

1)mucoasaesteformat~dintrunepiteliudetranzi[ienumituroteliu,alc~tuitdin57
straturidecelulesituatepeomembran~bazal~sub[ire#icorion.

Corionul (lamina propria) sus[ine epiteliul tranzi[ional #i este alc~tuit din [esut
conjunctiv lax care con[ine fibre elastice, o re[ea vascular~ bogat~, vase limfatice, fibre
nervoasesenzitive,dar#ifibremuscularenetedeizolate,cealc~tuiescmuscularismucosae.

La femeie, trigonul vezical este acoperit de un epiteliu scuamos nekeratinizat care


estesupusinfluen[elorciclicehormonaleca#imucoasavaginal~.

2) musculara (detrusorul vezical) este format~ din fibre dispuse pe trei straturi:
extern longitudinal, mijlociu circular #i intern longitudinal, descriind `n ansamblu un
traiectspiralatsauhelicoidal.

`n cazul obstruc[iei subvezicale, fibrele longitudinale se hipertrofiaz~ astfel `nc]t


mucoasavezical~proemin~d]ndna#terecoloanelorvezicale`ntrecareseg~sescdepre
siuninumitecelulevezicaleacesteareprezint~zonederezisten[~sc~zut~unde,`ncaz
depresiunevezical~crescut~,seformeaz~diverticulelevezicale.Diverticuleleausemnifica[ie
clinic~#ichirurgical~important~,cavitateadiverticular~fiindlocdestagnareaurinei,ceea
27

TratatdeUrologie

ceconducesecundarlainfec[iiurinarerepetate#ila formareadecalculivezicali.Peretele
diverticulardob]ndit,formatdoardinmucoas~,poatefiu#orperforat`ntimpulmanevrelor
endoscopice, de aceea tumorile vezicale dezvoltate intradiverticular au poten[ial invaziv
mare#iprognosticdefavorabil(Ciomu,2005).

3) adventicea este format~ din [esut conjunctiv fibros #i acoper~ `n `ntregime


peretelevezical.

4)seroasaacoper~numaipereteleposterosuperioralvezicii,iarprinreflexieperect
formeaz~funduldesacDouglas.

Fig.18.Vedereintern~aveziciiurinare,aprostatei#iapor[iuniiproximaleauretrei
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Vasculariza[iaarterial~

Vasculariza[ia arterial~ este format~ `n cea mai mare parte din ramuri ale arterei
iliaceinterne#i`nprincipalaretreiramuriimportante:
1.arteravezical~superioar~cereprezint~parteaneobliterat~aartereiombilicale,
irig~pere[iisuperiori#ilateraliaiveziciiurinare(fa[aposterosuperioar~,apexul,fa[aanteri
oar~#ife[elelaterale);estesituat~bilateralsubplicilelaterovezicalealeperitoneului.
2. artera vezical~ mijlocie este inconstant~ #i poate fi ramur~ a arterei vezicale
superioaresauaartereiiliaceinterne.
28

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

3.arteravezical~inferioar~esteramur~aartereiiliaceinterne#iirig~bazavezicii
urinare,veziculeleseminale#iprostata.

Dinpunctdevederechirurgical,vasculariza[iaveziciiurinaremaipoatefi`mp~r[it~
`n pedicule laterale #i posteromediale, clasificate astfel `n func[ie de situarea fa[~ de
ureterulipsilateralc]ndabordulveziciisefacedinsprespa[iulrectovezical.Acestepedicule
sunt con[inute `n ligamentele laterale #i posterioare vezicale la b~rba[i #i parte a
ligamentelor cardinal #i uterosacrat la femei. Ramuri arteriale mai mici provin din artera
rectal~medie#iarteraobturatoare,iarlafemeidinarterauterin~#iarteravaginal~.

Vasculariza[iavenoas~

`n grosimea peretelui vezical exist~ o re[ea de plexuri venoase din toate straturile
vezicalecedreneaz~`nplexulvenosperivezicalsituat`nspa[iulpre#ilaterovezical.

Plexul venos perivezical se anastomozeaz~ cu plexul venos periprostatic form]nd


plexulvenosvezicoprostatic(lab~rbat)#icuplexurilevaginale#iuterinelafemeie.`nacest
plexsevars~#ivenadorsal~profund~apenisului,respectivaclitorisului#ipoatefioimpor
tant~surs~des]ngerare`ncazulmanevrelordecistectomiesauprostatectomie.

Dintoateacesteplexuri,s]ngeleajunge`nvenailiac~intern~.

Limfaticeleveziciiurinare

Limfaticelelamineipropria#imusculareiformeaz~ore[eacaredreneaz~`ntrore[ea
perivezical~aflat~lasuprafa[aveziciiurinare.Apexul#ipereteleanteriordreneaz~`ngangli
oniiprevezicali#i,maideparte,`nganglioniiiliaciexterni.

Pere[iiposterosuperiori#ilateralivezicalidreneaz~`nganglioniiparavezicalilaterali
#i,deaici,`nganglioniiiliaciinterni#iobturatori.

Limfaticele fundului #i colului vezicii urinare dreneaz~ `n ganglionii iliaci interni,


obturatori,laterorectali#ipresacra[i.

Fig.19.Vasculariza[iaarterial~#ivenoas~aveziciiurinare
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

29

TratatdeUrologie

Inerva[iaveziciiurinare

Inerva[iaesteasigurat~defibresimpatice,parasimpatice,somatice#isenzitive.

Fibrele simpatice au originea `n segmentele medulare T1L2 #i ajung la vezica


urinar~prinintermediulplexurilorhipogastric#ipelvin.Acestefibresuntstimulate`ntimpul
procesului de umplere a vezicii urinare #i ac[ioneaz~ prin inhibarea tonusului mu#chiului
detrusor;deasemenea,stimuleaz~#icre#tetonusulsfincteruluivezicalintern.

Fibreleparasimpaticepreganglionareapar[inparasimpaticuluisacrat#i`#iauorigi
nea `n coloana sacrat~ S2S4 #i ajung la vezica urinar~ pe calea nervilor splahnici pelvini.
Acestefibrestimuleaz~contrac[iamu#chiuluidetrusor,ridic~trigonul#irelaxeaz~sfincterul
vezicalinternfavoriz]ndastfelgolireavezical~.

Inerva[iasomatic~esteasigurat~denervulru#inos,nervmixtcuoriginea`ncentrul
reflexsomaticS3S4;acestaproducecontrac[iasaurelaxareavoluntar~asfincteruluiextern
striat.

`n general exist~ o predominan[~ a fibrelor parasimpatice. La nivelul musculaturii


trigonului #i al sfincterului intern al uretrei, de#i predominan[a parasimpatic~ se men[ine,
exist~totu#iunnum~rmaimaredefibresimpaticedec]t`nrestulveziciiurinare,faptceare
aplica[iipractice`nadministrareatratamentuluicublocante`ncazulhiperplazieibenigne
deprostat~(HBP).

Prostata

Prostataesteunorganglandular#ifibromuscularsituatlanivelulpor[iuniiini[ialea
uretreimasculine,`ntrevezicaurinar~#idiafragmaurogenital~.
Herophylus din Alexandria (cca 325 `.Ch.) a folosit pentru prima oar~ termenul de
prohistanicedesemnaunorganprostataaflat`nfa[aveziciiurinare.
Prostatanormal~c]nt~re#te`njurde20g#im~soar~aproximativ3cm`ndiametrul
vertical,4cm`ndiametrultransvers#i2cmdiametrulanteroposterior.
Volumulprostateivariaz~cuv]rsta,ating]nddezvoltareacomplet~`njurulv]rsteide
1720deani;dup~4550deaniprostataestesupus~unuiprocesdehiperplazie.
`n mod normal sunt descri#i 5 lobi prostatici: anterior, posterior, median, st]ng #i
drept.
Celmaiadeseaclinicieniidescriu#iconsemneaz~faptulc~prostataesteconstituit~
din doi lobi separa[i de un #an[ median (palpabil la tu#eu rectal), iar examenul ecografic
poateconsemna#iexisten[aunuilobmedianceproemin~`nvezicaurinar~.Ace#tilobinu
corespundstructurilorhistologicedefinite`nprostatanormal~,#ifrecventm~rirealoreste
legat~dedezvoltareapatologic~azoneitranzi[ionale(lobiilaterali)sauaglandelorperiure
trale`ncazullobuluimedian.

Prostatanuareocapsul~propriuzis~,fiinddelimitat~deperetelepelvinprinmulti
plestraturitisularecarecon[infibremuscularenetededincolulvezical,fibremusculareale
diafragmei urogenitale, vase sangvine #i limfatice, nervi, paraganglioni, toate alc~tuind o
pseudocapsul~.

Capsulaprostatic~chirurgical~are`ns~oalt~semnifica[ie:c]nd[esutuladenomatos
devinevoluminos,elexercit~opresiuneconsiderabil~asupraelementelortisularedinjur,
form]nd, `n cele din urm~, o lam~ fibroas~ ce face posibil~ existen[a unui plan de clivaj;
aceast~capsul~con[ine`ns~elementeglandularenormalecare,`ntimp,sepothiperplazia
sautransformamalign.
30

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Lojaprostatic~

Reprezint~ o capsul~ inextensibil~, constituit~ din prelungiri ale aponevrozelor din


regiune; prostata se afl~ `n interiorul acestei capsule, `ntre cele dou~ exist]nd un plan de
clivaj.
Raporturi:
anterior #i lateral simfiza pubian~ #i lamapreprostatic~sau fascia endopelvin~
lateral~,dedublareafoi[eisuperioareaaponevrozeiperinealemedii.Majoritateacolatera
lelorveneidorsaleapenisului#iplexuluiSantorinisuntcon[inutedeaceast~fascie.
lateral fascia endopelvin~ se dep~rteaz~ de prostat~ #i acoper~ mu#chiul
ridic~toranal.
posterioraponevrozaprostatoperitoneal~aluiDenonvilliers;esteolam~sub[ire
de[esutconjunctivformat~dindou~foi[esituate`ntrepereteleanteriorrectal#iprostat~;
planuldeclivajestesituat`ntreceledou~foi[e.
inferiorfa[asuperioar~adiafragmeiurogenitalereprezentat~defoi[asuperioar~
aaponevrozeiperinealemedii.
superior ligamentele pubovezicale #i fascia intervezicoprostatic~, prelungire
sub[ire a aponevrozei pelvine ce separ~ incomplet loja vezical~ de cea prostatic~; aceast~
separare incomplet~ explic~ fuzarea flegmoanelor periprostatice `n spa[iul Retzius. `n
acela#imodabceseleprostaticesepotpropagacuu#urin[~retrovezical#imaideparte,pe
caleacanaluluideferentsauaureterului.

Raporturileanatomiceextrinsecialeprostatei

Fa[aanterioar~este`nraportcu1/3inferioar~asimfizeipubiene#iculigamentele
puboprostatice. Acest spa[iu conine, pe l]ng~ gr~sime, ramuri arteriale din arterele ru#i
noase interne, vezicale anterioare, retrosimfizare #i un important plex venos plexul
Santorinicucelmaiimportantafluent,venadorsal~apenisului.

Fe[elelaterale

Prinintermediulfe[elorlaterale,prostataareraporturicumu#chiulridic~toranal#i
cu aponevroza acestuia (aponevroza perineal~ superioar~); astfel, prostata vine `n raport
lateral cu prelungirile anterioare ale foselor ischiorectale, ceea ce explic~ disuria, durerile
vezicale#ichiarreten[iadeurin~cepot`nso[iflegmoaneleischiorectale#i,deasemenea,
posibilitateafuz~riiunuiabcesprostatic`nfosaischiorectal~.

Spa[iullateroprostaticestevirtualavascular,fiindu#ordeclivatp]n~laaponevroza
perineal~medie,vaselelateroprostaticefiindplasate`ngr~simealameiDelbet#iform]nd
plexullateroprostaticcontinuatcucellaterovezical.

Fa[aposterioar~

Prin intermediul aponevrozei prostatoperitoneale a lui Denonvilliers, fa[a poste


rioar~vine`nraportcufa[aanterioar~arectului,ceeaceofaceaccesibil~explor~riidigitale
printu#eurectal.

`ntre aponevroz~ #i gland~ exist~ un spa[iu retroprostatic decolabil ce corespunde


probabilintersti[iuluidintreceledou~foi[eceformeaz~aponevroza.

Acest raport cu peretele anterior al ampulei rectale explica tenesmele rectale din
prostatit~ #i, de asemenea, disuria #i polachiuria ce `nso[esc rectitele; de asemenea sunt
u#urate unele manevre chirurgicale cum sunt punc[ia prostatic~ ghidat~ ecografic trans
rectalsauinciziatransrectal~aunuiabcesprostatic.
31

TratatdeUrologie

Bazaprostatei(fa[asuperioar~)

Bazaprostateiareform~patrulater~,prezent]nddou~por[iuni:

1)por[iuneaposterioar~abazeiprostateiprezint~odepresiunecentral~ocupat~de
veziculeleseminale#iparteaterminal~acanalelordeferente;`naceast~por[iunelumenul
veziculeiseminalese`ngusteaz~progresiv,unindusecuductuldeferent#iform]ndductul
ejaculator.

Cele dou~ vezicule seminale au traiect ascendent pe fa[a posterioar~ a vezicii


urinare, fiind fixate de aceasta #i de canalele deferente printro lam~ de [esut musculo
conjunctivceseconsider~afiodedublaresuperioar~aaponevrozeiDenonvilliers.Aceast~
lam~ de [esut musculoconjunctiv, numit~ #i mu#chi interseminal Delbet, contribuie prin
contrac[ielaexprimareaprodusuluidesecre[iealacestorglande.

Proiec[ia traiectului veziculelorseminalepepereteleposterioral veziciiurinareare


forma unui unghi ascu[it cu v]rful la nivelul prostatei; `n interiorul acestui unghi se pro
iecteaz~celedou~canaledeferente.

2)por[iuneaanterioar~abazeiprostateivine`ncontactcupor[iuneaanterioar~a
trigonuluivezical.`naceast~por[iuneraporturilevezicoprostaticesuntstr]nse,musculatura
cervical~ afl]nduse `n continuitatea celei uretrale. `n aceast~ por[iune se afl~ zona
glandular~ periuretral~ ce `nconjoar~ uretra prostatic~, hipertrofia acesteia duc]nd la
apari[ialobuluimediancurolimportant`nobstruc[iacoluluivezical.

V]rfulprostatei

V]rful prostatei vine `n raport cu diafragma urogenital~, fiind fixat de aceasta prin
intermediul uretrei membranoase ce trece printre ligamentul transvers al perineului #i
aponevrozapropriuzis~.Acestraportexplic~dece,`ncadruluneifracturidebazin,aceast~
por[iuneauretrei estefrecventcointeresat~.Sfincterulstriaturetral situat`njuruluretrei
membranoase,subcioculprostatei,esteunaltimportantreperanatomiccepoatefilezat`n
cadrulmanevrelorendoscopicederezec[ietransuretral~aprostatei(TURP).

Fascia Denonvilliers

Fig.20.Vederemediosagital~aprostateicarearat~raporturilefasciilor
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

32

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Raporturileanatomiceintrinsecialeprostatei

Uretraprostatic~

Uretra prostatic~ are o lungime de aproximativ 2530 mm #i se `ntinde de la colul


vezicalp]n~laaponevrozamijlocieadiafragmeiurogenitale,fiindsituat~`napropiereafe[ei
anterioareaprostatei.

Uretra este tapetat~ de epiteliu tranzi[ional care se poate extinde #i `n ductele


prostatice;uroteliuleste`nconjuratdeunstratmuscularcufibrelongitudinalelainterior#i
circularelaexterior.

Dealunguluretreiprostatice,lanivelullinieimediane,sedezvolt~unpliulongitu
dinal numit creasta uretral~; de o parte #i de alta a crestei uretrale se g~sesc sinusurile
prostaticecuorificiilededrenajaleglandelorprostatice.

`npor[iuneamijlocie,uretrafaceocurbur~spreanterior(aproximativ350),aceast~
zon~diviz]nduretra`ndou~segmente:unulproximal(preprostatic)#iunuldistal(prosta
tic),cufunc[ionalitate#i`n[elesurianatomicediferite.

`n segmentul proximal se g~se#te sfincterul uretral intern involuntar (preprostatic)


format din fibre netede circulare ce continu~ musculatura p~r[ii anterioare a trigonului
vezical. Mici glande periuretrale, ce constituie mai pu[in de 1% din elementele secretoare
ale glandei, se afl~ `n jurul sfincterului preprostatic (sfincterul neted) printre fibrele
musculare netede; hipertrofia acestor glande st~ la originea form~rii lobului median
prostaticdinhiperplaziilebenigne(HBP).

`n zona curburii uretrale apare o proeminen[~ musculoerectil~ numit~ verum


montanum (colicul seminal), lung~ de aproximativ 1214 mm #i lat~ de aproximativ 34
mm.

Lanivelulverummontanumseg~se#teunorificiumediannepereche,reprezent]nd
deschidereautricululuiprostatic#idou~orificiipunctiformedeoparte#idealtaaorificiului
median,reprezent]ndorificiilededeschiderealeductelorejaculatoare.

Verum montanum este un reper important `n chirurgia transuretral~ a prostatei,


fiindc~laaproximativ1cmsubacestaseafl~sfincterulstriat.

Utriculaprostatic~

Utricula prostatic~ este un vestigiu embrionar al extremit~[ii inferioare a canalului


Mllerian care la b~rba[i se atrofiaz~, iar la femei d~ na#tere trompelor uterine, uter #i
vagin; de aceea a fost numit #i vagina masculin~. Poate persista la aproximativ 80% din
b~rba[i,av]ndaspectulunuicanalobliccestr~bateprostata`ntrelobiilaterali,termin]ndu
se `ntrun fund de sac `n vecin~tatea ductelor ejaculatoare. La b~rba[ii cu organe sexuale
ambiguepoateformaundiverticulmareceprolabeaz~dinspreparteaposterioar~aprosta
tei.

Canaleleejaculatoare

Se formeaz~ `n partea posterioar~ a bazei prostatei prin unirea ductelor deferente


cu veziculele seminale bilateral. Au un traiect lung de aproximativ 2 cm paralel cu uretra
prostatic~, de o parte #i de cealalt~ a utriculei, fiind `nconjurate de [esut conjunctivo
vascular#ifibremuscularenetedecirculare.Sedeschid`nuretraprostatic~lanivelulverum
montanumprindou~orificiipunctiformesituatedeoparte#idealtaafanteiutriculare.

Sfincterulstriat

`nvia[aintrauterin~mu#chiulsfincteruluistriatconstituieuntuborientatverticalce
se`ntindedelamembranaperineal~lacolulvezical.Peparcursulcre#teriiprostatei,p~r[ile
33

TratatdeUrologie

posterioare#ilateralealeacestuimu#chiseatrofiaz~,cutoatec~fibretransversalepersist~
pe `ntreaga sa fa[~ anterioar~. Drept urmare sfincterul are o dispunere particular~ `ncon
jur]nd complet v]rful prostatei, prelunginduse prin fibre musculare complete #i la nivelul
treimii inferioare, `ns~, la nivelul p~r[ii superioare a prostatei, datorit~ m~ririi `n volum a
glandei, dispozi[ia fibrelor `n sec[iune transversal~ descrie litera greceasc~ , fibrele
muscularefiindmaidispersatespreparteaposterioar~.

Sfincterul striat este elementul anatomic care poate realiza ocluzia vezical~ volun
tar~; sfincterul neted se opune sc~p~rii urinei din vezica urinar~, precum #i ejacul~rii
retrograde.

Fig.21.Uretraprostatic~#imembranoas~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Structuraprostatei

Prostata este compus~ din elemente glandulare (70%) #i stroma fibromuscular~


(30%). Stroma fibromuscular~ este compus~ din colagen #i fibre musculare ce `nconjoar~
glandele, contract]nduse `n timpul ejacul~rii, elimin]nd astfel produsul de secre[ie
(Soderberg,1995).

`nmodulcelmaifacil`n[elegeriicomune,prostatapoateficomparat~,`nansamblul
ei,cuunbloc`ncarearm~turiledeo[elsuntreprezentatedefibrelemusculare#ielastice,
cimentul este stroma conjunctiv~, iar `nc~perile sunt glandele prostatice care comunic~,
prin intermediul coridoarelor, cu scara principal~ uretra prostatic~ `n modelul nostru
anatomicoarhitectonic. Rezult~ c~ aceast~ cl~dire are trei materiale de construc[ie:
glande,fibremusculare#ifibreconjunctive.

Prostataesteformat~`nceamaimarepartedinzonaperiferic~#iceacentral~(Allen
#i col, 1989), acestea reprezent]nd `n cazul absen[ei hiperplaziei aproximativ 9095% din
masaprostatic~.Restulde510%estereprezentatdezonatranzi[ional~,zonafibromuscu
lar~anterioar~#izonaglandular~periuretral~.

34

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Zonaperiferic~reprezint~70%dinprostatab~rba[ilortinerifiind`ndirect~vecin~
tatecuperetelerectal,oferindastfelinforma[ii`ntimpultu#euluirectal (Sinescu#icolab.,
2006).

Fig.22.Structuralobar~aprostatei
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Zona central~ reprezint~ aproximativ 25% din [esutul prostatic, `nconjoar~ ductele
ejaculatorii #i se proiecteaz~ sub baza colului vezical. Aceasta pare s~ aib~ origine
embriologic~dincanaleleWolf;doarofoartemic~partedincancereproveninddinaceast~
zon~. Ductele excretoare ale glandelor acestei zone se deschid circumferen[ial `n jurul
orificiilorejaculatoaredelanivelulverummontanum.
Zona tranzi[ional~ `nconjoar~ uretra proximal~ p]n~ la canalele ejaculatorii #i
reprezint~510%dinmasaprostatic~.`nhiperplaziabenign~prostatic~dezvoltareaacestei
zonepoatefiobservat~endoscopic`nceidoilobilaterali.Dup~McNeal,aici`#iausediul
24% din cancerele prostatice. Cancerele g~site `n timpul rezec[iilor transuretrale ale pros
tatei pentru BPH sunt toate provenite din aceast~ zon~ (T1a sau T1b)(Sinescu #i colab.,
2006).
Zona glandular~ periuretral~ este reprezentat~ de un grup de glande `nconjur]nd
uretraprostatic~.Dezvoltareaacestorapoateducelaapari[iaa#azisuluilobmediancurol
`nobstruc[iacoluluivezical(Sinescu#icolab.,2006)

Zona periferic~ g~zduie#te cel mai frecvent maladiile etichetate drept prostatite
cronice.

35

TratatdeUrologie

Canalele ejaculatoare nu traverseaz~ [esutul glandular, ci apar `ntro diafragm~


fibroas~`ntrelobulmedian#icellateral.Sepotastfelenuclealobiiglandularihipertrofia[i
f~r~alezacanaleleejaculatoare(Walsh#icol,2002).

Fig.23A)Vederetridimensional~aprostatei.Prostataeste`ntoars~25%fa[~desec[iuneafrontal~.
B).Vederesagital~.C)Sec[iunecoronal~.D)sec[iunecoronal~cuprostatau#oroblic~;colulvezical
(bn)#iverummontanumpotfivizualizate.E)Hipertrofiebenign~`nzonatranzi[ional~.
F)Distribu[iaadenocarcinomuluiprostatic
Legend~:CZ=zonacentral~,bn=colulvezical,TZ=zonatranzi[ional~,PZ=zonaperiferic~,UP=uretra
proximal~,UD=uretradistal~,fm=stomafibromuscular~,S=Sfincterulpreprostatic;
E=ducteleejaculatoare,NV=bandeleteleneurovasculare,V=verummontanum

(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;Williams&
Wilkins1996cupermisiunea).

Vasculariza[iaprostatic~

Vasculariza[iaarterial~

Principalele surse arteriale ale prostatei (arterele prostatice) provin din arterele
vezicale inferioare ram al arterelor iliace interne. Ramuri arteriale mai mici provin #i din
arterarectal~medie#iarteraru#inoas~intern~.
Flocksastudiatdistibu[iaarterial~intratisular~concluzion]ndc~exist~dou~ramuri
arterialeimportantealeartereiprostatice:artereleuretrale#iarterelecapsulare.

Arterele uretrale penetreaz~ jonc[iunea posterolateral~ (orele 15 #i 711) av]nd


traseuspreinteriorulglandei,perpendicularpeuretr~,vasculariz]ndcolulvezical#ipor[iu
neaperiuretral~aglandei.
36

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

`nhiperplaziabenign~deprostat~,grupularterialuretralsedezvolt~pentruaputea
asigura vasculariza[ia `ntregului adenom. De aceea, indiferent de tipul adenomectomiei
(transvezical~/transuretral~), principalele surse de s]ngerare vor fi din acest grup arterial
posterolateral(orele4#i8);ligaturareasaucauterizareaacestorartere`nstadiileini[ialeale
opera[ieivaminimizapierderilesangvine(Cockett#icolab.,1995).

Arterele capsulare reprezint~ al doilea grup important de ramifica[ii ale arterei


prostatice; vascularizeaz~ zonele periferice ale prostatei av]nd traseu pe fa[a postero
lateral~ a prostatei, `mpreun~ cu nervii caverno#i (bandeletele neurovasculare) #i se
termin~ la diafragma pelvin~. Aceste ramuri arteriale nu sufer~ modific~ri importante `n
hiperplaziaprostatic~(Walsh#icolab.,2002).

Fig.24.Vasculariza[iaarterial~aprostatei
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Drenajulvenos

Venele formeaz~ un plex `ntins pe fa[a anterioar~ #i lateral~ a capsulei prostatice


(plexulSantorini)#i,`nmodparticular,labazaprostatei,lajonc[iuneavezicoprostatic~.
37

TratatdeUrologie

Principalulafluentalacestuiplexestevenadorsal~profund~apenisului;pel]ng~
aceast~ ven~, plexul prime#te aportul venelor retropubiene, venelor vezicale anterioare,
veneloruretreiprostatice#iperineale;acestplexdreneaz~inveneleiliaceinterne.

Exist~ numeroase variante anatomice ale venelor retropubiene: `n 60% din cazuri
exist~ o ven~ unic~, iar `n 10% din cazuri vena este absent~. Ligatura complexului venos
dorsal este recomandat~ `n prostatectomia radical~, fiind `n m~sur~ s~ reduc~ pierderile
sangvine at]t `n cazul prostatectomiei radicale, c]t #i `n cazul adenomectomiei pe cale
hipogastric~(Sinescu#icolab.,2006).

Fig.25.Vasculariza[iavenoas~aprostatei
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Drenajullimfatic

Drenajullimfaticprimarsefacec~treganglioniiobturatori#iganglioniiiliaciinterni.
Uneori drenajul limfatic poate ocoli ini[ial aceste grupe ganglionare, dren]nd `n ganglionii
presacra[isau`nganglioniiiliaciexterni(Walsh#icolab.,2002).

Inerva[iaprostatei

Inerva[iasimpatic~#iparasimpatic~(S2S4)dinplexulpelvinajungelanivelulpros
tateiprinintermediulnervilorcaverno#i.Ramurilenervoaseurmeaz~ramifica[iilearterelor
capsulare. Fibrele parasimpatice se termin~ la nivelul acinilor prostatici stimul]nd secre[ia
acestora;fibrelesimpaticedetermin~contrac[iamu#chiuluinetedalcapsulei#ialstromei.
Acest fapt explic~ eficacitatea tratamentului cu alfa 1blocante care diminu~ tonusul
stromeiprostatice#ialsfincteruluipreprostatic,ceeaceconducela`mbun~t~[ireafluxului
urinarlab~rba[iicuhiperplaziebenign~deprostat~(Walsh#icolab.,2002).

38

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Uretramasculin~

Este o structur~ fibroelastic~ care se `ntinde de la orificiul uretral intern al colului


vezical p]n~ la meatul uretral extern #i are menirea de a fi conductul prin care urina #i
spermaajunglaexterior.

Diafragma urogenital~ `mparte uretra `n trei p~r[i: prostatic~ (aproximativ 3 cm),


membranoas~(aproximativ1cm)#ispongioas~(aproximativ12cm).Deasemenea,`nscop
chirurgical, se descrie uretra posterioar~ fix~ (prostatic~ #i membranoas~) #i uretra
anterioar~(bulbar~#ipenian~)mobil~.
`ntraiectuls~u,uretradescriedou~curburi:
a)curburasubpubian~cuconcavitateaanterior#isuperioraflat~laaproximativ1,5
cmdemargineainferioar~asimfizeipubiene`nraportculigamentularcuat
b) curbura prepubian~ format~ de uretra spongioas~ este concav~ posterior #i
inferior;aceast~curbur~dispare`ntimpulerec[iei.

Calibruluretralesteneuniform,exist]ndpor[iuni`ngustate(orificiuluretralintern
colul vezical, uretra membranoas~, uretra spongioas~ #i meatul uretral extern) #i por[iuni
mailargi(uretraprostatic~,bulbuluretral#ifosanavicular~).

1)Uretraprostatic~esteparteaceamaidilatat~auretrei,av]ndtraseuapropiatde
fa[a anterioar~ prostatic~. `n segmentul proximal se g~se#te sfincterul intern involuntar,
format din fibre netede circulare ce continu~ musculatura p~r[ii anterioare a trigonului
vezical.
Lumenul uretral prezint~, dea lungul peretelui posterior, o plic~ longitudinal~
(creasta uretral~) ce se `ntinde de la buza posterioar~ a colului vezical (superior) p]n~ `n
regiunea uretrei membranoase (inferior). `n por[iunea mijlocie a crestei uretrale se afl~ o
proeminen[~fuziform~(colicululseminalsauverummontanum),`nv]rfulc~reiaseg~se#te
orificiul utriculului prostatic. Acesta este un canal lung de aproximativ 1 cm, terminat `n
funddesac`ninteriorulprostatei,reprezent]ndunrestembrionaralcanaluluiMller;poate
suferiproceseinflamatoriisaupoateformaundiverticulmareceprolabeaz~dinsprepartea
posterioar~aprostatei.
`ntre coliculul seminal #i pere[ii laterali ai uretrei se formeaz~ sinusurile prostatice
(#an[urilelaterale)`ncareseg~sescorificiileglandelorprostatice,orificiicesedeschid#ipe
pere[iianterior#ilateraliaiprostatei.
2) Por[iunea membranoas~ a uretrei este cea mai scurt~, av]nd `ntre 1 #i 1,5 cm;
str~batediafragmaurogenital~`ntreceledou~straturifascialealeacesteia.Aceast~por[i
une a uretrei con[ine sfincterul uretral extern format din fibre proprii, fibre circulare ale
mu#chiului transvers perineal profund #i fibre din ridic~torul anal; acesta este un mu#chi
voluntar controlat de ramura perineal~ a nervului ru#inos intern. Sfincterul uretral extern
areat]tfunc[ieurinar~,c]t#ifunc[iegenital~,contribuindlaexpulzareaspermei.
Uretra membranoas~ trece pe sub ligamentul transvers al perineului (format prin
unireaanterioar~acelordou~foi[ealediafragmeiurogenitale).Acestfaptexplic~dece,`n
cazulunorfracturicudeplasarealeoaselorpubiene,sepoateproducerupereapar[ial~sau
complet~aacesteia.Lateral,uretramembranoas~este`nraportcumu#chiulridic~toranal
carecontribuiedreptmecanismsecundarlaasigurareaconten[ieiurinare.
`n spatele uretrei membranoase, aproape de stratul inferior al diafragmei urogeni
tale,seafl~glandelebulbouretraleCowpercaresedeschid`nuretrabulbar~,deoparte#i

39

TratatdeUrologie

dealtaalinieimediane;produsuldesecre[iealacestorglandeintr~`nalc~tuirealichidului
spermatic`ntimpulexcita[ieisexualesecret]ndmucusclar`nuretrabulbar~.
3)Uretraspongioas~(penian~)estecelmailungsegmenturetralav]nd`ntre12#i
15cm;este`nconjurat~decorpulspongios#isetermin~lanivelulmeatuluiuretralextern.
Lav]rfulunghiuluisubpubian(concavanterosuperior)uretraareodilata[ienumit~
fundul de sac bulbar, la acest nivel deschiz]nduse cele dou~ glande Cowper amintite mai
sus.Petotpereteleuretreipenienesuntnumeroasemicilacune`ncaresedeschidglande
uretralesecretoaredemucus(glandeleLittr).
La nivelul glandului lumenul uretral prezint~ o dilata[ie numit~ fosa navicular~ #i
ulterior se continu~ cu meatul uretral, zona cea mai `ngust~ a acestei por[iuni uretrale,
av]ndodeschideredeaproximativ56mm.

Fig.26.Uretramasculin~sec[iunemediosagital~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Structurapereteluiuretral

`nansamblu,pereteleuretralarelainteriorotunic~mucoas~,iarlaexteriormuscu
lara(cufibremuscularelongitudinalelainterior#icircularelaexterior)`ns~fiecaresegment
ureteralarecaracteristicidiferite:
`n segmentul prostatic proximal, epiteliul mucoasei este de tip uroteliu p]n~ la
nivelulcolicululuiseminalcuimplica[iiimportante`ntratamentultumoriloruro
telialedinaceast~regiune;`nrestuluretrei, p]n~la fosa navicular~,seg~se#te
epiteliucilindricstratificat
`nsegmentulmembranosfibrelecircularenetedesunt`nlocuitecufibrelestriate
alesfincteruluiextern
40

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

`nfosanavicular~epiteliulestedetippavimentosnecheratinizat.

Vasculariza[iaarterial~

Uretra prostatic~ prime#te ramuri arteriale ale vaselor ce vascularizeaz~ prostata:


arterele uretrale, ramuri din artera vezical~ inferioar~ ce p~trund `n prostat~ `n zona
posterolateral~ a jonc[iunii prostatovezicale; ramuri arteriale mai mici provin din artera
rectal~medie#iarteraru#inoas~intern~.
Restul uretrei prime#te vasculariza[ie din ramuri ale ru#inoasei interne (arterele
bulbouretrale,artereledorsalealepenisului).

Vasculariza[iavenoas~

Plexulvenosdincorionulmucoaseidreneaz~`nvenadorsal~profund~apoi`npartea
anterioar~aplexuluivenosvezicoprostatic#ideaici`nveneleiliaceinterne.

Limfaticele

`nfunc[iedepor[iunileuretrei,drenajullimfaticseface`ngrupeganglionarediferite.
Uretraspongiosadreneaz~`nganglioniiiliacisuperficiali#iprofunzi,c]t#i`nceiiliaci
externi.
Uretrabulbomembranoas~#iprostatic~dreneaz~`nganglioniipelviniprintreic~ide
diseminare:
caleaparalel~cuvenadorsal~apenisuluicedreneaz~`nganglioniiiliaciexterni
calea paralel~ cu artera ru#inoas~ intern~ spre ganglionii obturatori #i iliaci
interni
caleaganglionilorpresacra[i.
Invaziaganglionar~este`ntotdeaunabilateral~,indiferentdesediultumorii,grupul
superointerninghinalfiindinteresatcupredilec[ie.

Inerva[ia

Fibreparasimpaticealeplexuluisacrat(S2S4)prinintermediulplexuluipelvinajung
`nplexulprostaticinerv]nduretraprostatic~.
Nerviiperineali#inerviidorsaliaipenisului,ramurialenervuluiru#inos,con[infibre
senzitivomotoriiceasigur~inerva[iauretreiperineale#iaceleispongioase.
Inerva[ia sfincterului striat este asigurat~ de fibre ale nervului ru#inos, `ns~ sa
constatatc~secionareafiletelornervoasealeacestuinervnuabole#teactivitateasfincte
rului#icontinen[avezical~.
Lawson (1974) #i Zavarra (1994) au identificat o ramur~ a plexului sacral aflat~ pe
fa[apelvin~amu#chiuluiridic~toranalcafiindsurs~secundar~deinerva[ieasfincterului
striat; lezarea acestei ramuri `n cursul prostatectomiei radicale poate afecta semnificativ
continen[a(Walsh#icolab.,2002).

41

TratatdeUrologie

Fig.27.Dispunereaelementelorvasculareuretrale`nstructurileperineului
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

GlandelebulbouretraleCowper(glandeleluiMery)

Sunt dou~ forma[iuni glandulare cu dimensiuni de aproximativ 5 mm aflate `n


grosimea aponevrozei perineale medii de o parte #i de alta a bulbului uretral, al c~ror
produsdesecre[ie,eliminat`ntimpulejacul~rii,pares~aib~rol`naglutinareaspermatozo
izilor#iaderarealordeperetelevaginal.

Raporturi

inferior cu foi[a inferioar~ a aponevrozei perineale medii ce le separ~ de bulbul


uretral
superiorcumu#chiultransversprofundcelesepar~deapexulprostatic
`n fa[~ se afl~ uretra membranoas~, comprimarea acesteia `n cadrul episoadelor
inflamatoriiglandulareput]ndexplicasimptomatologiairitativ~#iobstructiv~.
42

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

La nivelul acestor glande se pot dezvolta abcese de origine veneric~ sau tuber
culoas~, care pot fi confundate cu abcese urinoase, acestea din urm~ av]nd, de obicei,
dezvoltaremedian~.
Tumorilemalignelanivelulacestorglandesuntextremderare#iseextindrapidla
[esuturile`nconjur~toare(Testut#icolab.,1929).
Fiecaregland~prezint~lanivelulfe[eianterioareuncanalexcretorcesedeschidela
nivelulp~r[iianterioareabulbuluiuretral.
Canalul excretor este lung, av]nd aproximativ 3040 mm, por[iunea aflat~ `n sub
mucoasauretreiav]nd`njurde2025mm.

Structur~
Cele dou~ glande au structur~ de tip tubuloacinos. Produsul lor de secre[ie se
deschide`ntropor[iunedilatat~comun~,numit~sinusexcretor.Sinusurileseunesc#idau
na#tere canalului excretor. Produsul de secreie intr~ `n componen[a spermei #i este un
lichidtransparent#iv]scos.

Vasculariza[ie
Vasculariza[ia arterial~ este asigurat~ de arterele bulbouretrale, ramuri din ru#i
noasaintern~.Venelesevars~`nplexulSantorini#ideaici`nveneleiliaceinterne.

Inerva[iaprovinedinnervulru#inosintern,ramalplexuluisacrat.

Uretrafeminin~

Uretra feminin~ are o lungime de aproximativ 45 cm, `ncepe la colul vezical,


str~batediafragmaurogenital~av]nduntraiectoblicdesus`njos#idinspreposteriorspre
anterior#isetermin~lameatuluretralextern`nvestibululvaginal.

Structuraperetelui

Pereteleuretralesteformatdinadventicelaperiferie,tunic~muscular~(cuunstrat
longitudinalintern#iunulcircularextern)#itunic~mucoas~alc~reiepiteliudeacoperirese
modific~ treptat de la tranzi[ional `n partea superioar~ a uretrei la scuamos stratificat
necheratinizat`npor[iuneainferioar~.Submucoasacon[ineore[eavascular~bogat~.
Numeroase glande mucoase se deschid dea lungul uretrei, put]nd da na#tere
diverticuleloruretrale.`nparteadistal~acesteglandesegrupeaz~deoparte#idecealalt~
a uretreiform]nd glandeleSkene(ducteleparauretrale),alec~rororificiidedeschiderese
afl~`np~r[ilelateralealemeatuluiuretralextern.
Mucoasa#isubmucoasacompleteaz~mecanismulsfincterianalcontinen[ei;aceste
straturi sunt estrogendependente, atrofiinduse la menopauz~, fapt ce poate favoriza
apari[iaincontinen[eideefort(Walsh#icolab.,2002).

Mecanismulsfincterian

Unstratsub[iredemu#chilongitudinalse`ntindedelanivelulveziciiurinarep]n~la
nivelulmeatuluiuretralextern.Spredeosebiredeuretramasculin~,lacea feminin~nuse
constat~ prezen[a unui sfincter neted circular constituit, fibrele circulare `n strat sub[ire
`ntinz]ndusepetoat~lungimeauretreilaexteriorulcelorlongitudinale.
43

TratatdeUrologie

Fig.28.Organelegenitalefeminineexterne
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Sfincterulexternstriatacoper~dou~treimidistalealeuretrei.`npor[iuneasaini[ial~
se `ntinde de jur`mprejurul uretrei(realiz]nd zona cu presiunea uretral~ de `nchidere cea
mai mare) pentru ca, mai jos, fibrele striate s~ acopere fe[ele anterioar~ #i laterale ale
uretrei, spre posterior fix]nduse de peretele vaginal anterior prin intermediul septului
uretrovaginal; contrac[ia acestor fibre comprim~ uretra, apropiindo de peretele anterior
vaginalcareestefix(Walsh#icolab.,2002).

Raporturi#imijloacedefixare

Anterior are raport cu ligamentele pubouretrale, plexul venos perivezical #i vena


dorsal~aclitorisului.
Posterior se afl~ peretele anterior vaginal de care este separat~ prin intermediul
septuluiuretrovaginalcefaciliteaz~separareachirurgical~acelordou~organe,maiales`n
por[iuneasuperioar~.
Lateralseafl~mu#chiiridic~torianali#imu#chiultransversprofund;subdiafragma
urogenital~,lateraldeuretr~,seg~sesc#iextremit~[ileanterioarealemu#chilorbulbospon
gio#i.
Ligamentelepubouretralesuntprincipalelemijloacedefixareauretrei.
Ligamentulpubouretralanteriorcontinu~ligamentulsuspensoralclitorisului,solida
riz]nd uretra la fa[a anterioar~ a simfizei. Partea posterioar~ a ligamentului pubouretral
solidarizeaz~ uretra la periostul retrosimfizar. Ligamentul pubouretral intermediar este
dispuscaopunte`ntreceledou~ligamente.

Vasculariza[iaarterial~

Segmentul pelvin este vascularizat de ramuri ale arterei vezicale inferioare, arterei
vaginale lungi #i ale arterei vezicale anterioare (ram din artera ru#inoas~ intern~).
Segmentulperinealprime#teramuribulbare#ibulbouretralealeartereiru#inoaseinterne.
44

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Vasculariza[iavenoas~

Venele uretrei feminine `ncep `n plexul submucos, de aici s]ngele fiind drenat `n
plexulvezical,plexulvaginal#ivenelebulbare.

Limfaticele dreneaz~ `n ganglionii iliaci interni, ganglionii iliaci externi, dar #i `n


ganglioniiinghinali.

Inerva[iaestepredominantparasimpatic~,fibrelesimpaticefiindslabreprezentate
laacestnivel.Sfincteruluretralstriatesteinervat,ca#ilab~rba[i,pel]ng~nervulru#inos#i
defibresomaticepelvine.

Fig.29.Uretrafeminin~sec[iunemediosagital~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Penisul

Este organul masculin erectil nepereche, care ia na#tere `n partea anterioar~ a


perineului; are traiect pe sub marginea inferioar~ a simfizei pubiene #i se orienteaz~
superior#ianteriordevenindliberlanivelulpereteluiabdominal.Ceamaimareparteeste
format~din[esuterectildispussubformaatreicorpicaverno#i#iacorpuluispongios.`n
stareflasc~por[iuneapendulant~are`njurde1011cm#iocircumferin[~de89cm.
Anatomoclinic pot fi descrise trei por[iuni: baza (r~d~cina) penisului, corpul
penisului#iglandul.

1. R~d~cinapenisuluiesteformat~dinceledou~ r~d~cinialecorpilorcaverno#i#i
din r~d~cina corpului spongios; este fixat~ de peretele anterior al bazinului prin inser[ia
corpilor caverno#i pe ramurile ischiopubiene #i, pe de alt~ parte, prin dou~ ligamente:
ligamentulsuspensoralpenisului#iligamentulfundiform.
45

TratatdeUrologie

Ligamentulsuspensorse`ntindedelafa[aanterioar~asimfizeipubienep]n~lafa[a
dorsal~ a penisului. Este format din fibre elastice groase aflate `n prelungirea fasciei
superficialeabdominale#isetermin~printrefibrelealbugineei,ce`nconjoar~ceidoicorpi
caverno#i.
Ligamentul fundiform este o prelungire a liniei albe abdominale ce se extinde pe
p~r[ile laterale ale penisului, fibrele sale ajung]nd #i la nivelul scrotului printre fibrele
mu#chiuluidartos(Sinelnikov,1989).

2. Corpul penisului are forma unui cilindru u#or turtit anteroposterior #i prezint~
dou~fe[e:unasuperioar~care`nerec[ieesteorientat~dorsal#iunainferioar~cedevine
ventral~`ntimpulerec[iei.
Pefa[adorsal~seafl~ceidoicorpicaverno#isepara[iprintrunseptdiscontinuu`n
por[iuneadistal~,ceeacefacecaspa[iilelorvasculares~comuniceliber.
Corpul spongios este situat `n #an[ul ventral rezultat prin alipirea celor doi corpi
caverno#i. Posterior, la r~d~cina penisului, corpul spongios se m~re#te pentru a forma
uretrabulbar~acoperit~demu#chiulbulbocavernos.
`npor[iuneaanterioar~,corpulspongiosformeaz~glandulpenisuluicareacoper~#i
termina[iilecorpilorcaverno#i.
Corpul spongios este traversat pe toat~ lungimea de uretra anterioar~, care se
`ntindedeladiafragmaurogenital~p]n~lameatuluretralexternsituatlanivelulglandului.

3. Glandul este o proeminen[~ conic~ format~ prin dezvoltarea corpului spongios.


Diametrul glandului este superior celui al corpului penisului, la limita dintre cele dou~
exist]ndunreliefcircularnumitcoroanaglandului.
Posterior de coroana glandului se afl~ #an[ul coronal sau balanoprepu[ial; acest
#an[ este `ntrerupt pe fa[a inferioar~ de un pliu mucos fr]ul prepu[ial (frenul) ce leag~
unghiulinferioraluretreideprepu[(Kenneth#icolab.,1994).
Glandulesteacoperitdejur`mprejur,par[ialsau`ntotalitate,deunrepliucutaneo
mucos, continuare a tegumentului ce `nvele#te corpul penisului numit prepu[; la nivelul
#an[ului balanoprepu[ial mucoasa trece pe gland #i la nivelul meatului se continu~ cu
mucoasauretrei.
Glandul#ifa[aintern~aprepu[uluisuntacoperitedeomembran~semimucoas~ce
con[ine termina[ii nervoase #i glande sebacee care secret~ o substan[~ alb~ #i discret
mirositoare smegma. #an[ul balanoprepu[ial este, de asemenea, locul predilect de
apari[ieaulcera[iilorveneriene#ialCondilomaaccuminatum.
La copil, prepu[ul dep~#e#te cu mult v]rful glandului form]nd la acest nivel un
vestibul;laadultpoatepersistaacestaspect,celmaiadesea`ns~prepu[ulacoperinddou~
treimidingland.
Imposibilitateadecalot~riicompleteaglanduluidincauzaunuiorificiuprepu[ialprea
mic(uneorichiarpunctiform)senume#tefimoz~.
For[area decalot~rii poate duce la blocarea prepu[ului `n #an[ul balanoprepu[ial;
aceast~situa[ieclinic~poart~numeledeparafimoz~.

46

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

cavernos

Fig.30.Corpiierectili
aipenisului
(reproduceredup~:
ColourAtlasofUrologic
SurgeryAbrahamT.K.
Cockett,KenKoshiba;
Williams&Wilkins
1996cupermisiunea).

`nveli#urilepenisului

Tunicilepenisuluiaudistribu[ieconcentric~solidariz]ndusecucomponentelepeni
sului#icontinu]ndusecuplanurilesuperficialealeregiunilor`nvecinate.Lanivelulcorpului
penisuluidispunereadinspresuperficialc~treprofundesteurm~toarea:

1. tegumentul penianareostructur~special~,fiind elastic,pigmentat#icon[in]nd


rarefiredep~rsauglande,cuexcep[iacelorproduc~toaredesmegm~delabaza#an[ului
crononal.

Pefa[asainferioar~seremarc~unrafeurafelulpeniancereprezint~unvestigiu
embrionar rezultat din unirea repliurilor genitale ale f~tului, ceea ce explic~ de ce uneori
putemobservalaacestnivelprezen[aunorchisturidermoide.
2.tunicadartosesteformat~dinfibremuscularenetede`nmarealormajoritatecu
traiectlongitudinal,dar#ioblic#itransversal.
Dartosulestemobilfa[~deplanurilevecine:superficialtegumentul#i`npofunzime
fascia penian~. Dartosul penian se continu~ cu dartosul scrotului #i apoi, la nivelul peri
neului,cufasciaperineal~superficial~.
Contrac[ia acestor fibre reduce dimensiunile transversale ale penisului #i, prin
efectul de compresie asupra venelor profunde, accentueaz~ staza venoas~ men[in]nd
erec[ia.
3.[esutulceluloadiposalc~tuitdinfibreelasticeestebogat`nvasedes]nge#inervi
superficiali.
47

TratatdeUrologie

4.faciaBuck(fasciapenisului)`nconjoar~ambiicorpicaverno#i;pefa[aventral~i#i
pierde`ns~contactulintimcuace#tiapentruafixacorpulspongios.
Fibrele elastice #i colagene din teaca mu#chiului drept abdominal se amestec~
printrefibrelefascieiBuckalc~tuindligamentulfundiform.

Fig.31.Penissec[iunetransversal~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Fig.32.Fasciileaparatuluigenitalmasculinsec[iunesagital~
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

48

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Labazapenisului,fasciaBuckp~trunde`nperineu`nvelindr~d~cinilecorpilorcaver
no#i pe care `i fixeaz~ ferm de fascia perineal~ medie (Kenneth #i colab., 1994); distal
fuzioneaz~cubazaglanduluilanivelul#an[uluicoronarceeacefacecas]nger~riledincorpii
caverno#i(rupturacorpilorcaverno#i)s~nudep~#easc~,deobicei,fasciaBuck,echimozele
fiindlimitatelacorpulpenisului.
Lanivelulprepu[ului,fasciapenisuluidispare,tunicilesuperficialereflect]ndusepe
ele `nsele, prepu[ul `n sec[iune transversal~ av]nd urm~toarele tunici: tegument, dartos,
[esutceluloadipos,dartos,tegument.

Vasculariza[iaarterial~

Vasculariza[iaarterial~apenisuluiesteasigurat~primardearteraru#inoas~intern~,
ramur~aartereiiliaceinterne.Artereru#inoaseaccesorii,ramurialeartereiiliaceexterne#i
artereobturatoriiaccesoriicontribuie,deasemenea,lavasculariza[iaarterial~apenisului.
Arteraru#inoas~intern~seramific~`ntreiramuriimportante:
arterabulbouretral~
arteracavernoas~
arterelepenienedorsale.

1.Arterabulbouretral~vascularizeaz~uretra#icorpulspongios.
2. Arterele dorsale ale penisului au traiect pe fa[a dorsal~ a corpului penian `ntre
tunica albuginee #i fascia Buck. Sunt situate de o parte #i de cealalt~ a venei dorsale
profunde;nerviidorsaliaipenisuluiseafl~`nacela#iplan,lateraldeartereledorsale.Aceste
arterevascularizeaz~structurilesuperficiale#iglandulpenianlaacestnivelanastomoz]ndu
securamurialeartereibulbouretrale;deasemenea,prinintermediularterelorcircumflexe
vascularizeaz~#icorpulcavernos.
3. Artera cavernoas~ str~bate central #i `n axul longitudinal fiecare corp cavernos
d]ndna#terearterelorhelicinecevascularizeaz~spa[iilesinusoide.
Arterelepenienesuntfoartevariabile`nceeaceprive#tetraseul,ramurile#ianasto
mozelecelepotdezvolta.Suntdere[inutsitua[ii`ncareosingur~arter~cavernoas~asigur~
vasculariza[ia ambilor corpi caverno#i sau chiar situa[ii `n care s~ nu existe artere
cavernoase.Deasemenea,prezen[auneiartereru#inoaseaccesorii,ramur~dinarteraobtu
ratoaresauarteravezical~inferioar~,afostidentificat~laaproximativ70%dintrecadavrele
examinate, prezervarea ei av]nd un rol important `n men[inerea poten[ei dup~ prostatec
tomiaradical~(Walsh#icolab.,2002).

Vasculariza[iavenoas~

Sistemulvenospeniancuprindeungrupvenossuperficial#iunulprofund.

Venelesuperficialedreneaz~tegumentul#i[esuturilededeasuprafascieiBuckfor
m]nd o re[ea ce se une#te la nivelul venei superficiale dorsale; aceast~ ven~ se divide
ulterior`ndou~ramuridrept#ist]ngcaredreneaz~`nveneleru#inoaseinterneipsilat
ral.

Sistemul venos profund porne#te de la venelesubtunicale ce dreneaz~ sinusoidele


corpilor caverno#i; aceste vene se unesc form]nd vene emisare ce vor traversa tunica
albuginee, dren]nd `n venele circumflexe. Venele circumflexe se vars~ `n vena dorsal~
profund~situat~subfasciaBuck#iprinintermediulacesteia`nplexulvenosperiprostatic.

49

TratatdeUrologie

Corpulspongiosestedrenatdevenespongioase#ibulbarecareauramuricomuni
cantecucorpiicaverno#i.

`n timpul erec[iei, venele subtunicale #i emisare sunt comprimate, drenajul venos


devenindminim,lucrunecesar`nsus[inereaerec[iei.

Fig.33.Structurilesuperficialealeperineuluimasculin
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Drenajullimfatic

Limfaticelepenisuluisunt`mp~r[ite`ndou~marigrupe:superficiale#iprofunde.

Limfaticele prepu[ului formeaz~ o re[ea ce se anastomozeaz~ cu limfaticele tegu


mentare ale corpului penisului; aceast~ re[ea dreneaz~ `n ganglionii inghinali superficiali
(situa[ideasuprafascieilata).

Limfaticele glandului se unesc cu limfaticele corpilor caverno#i form]nd, `n final, o


re[ea ce dreneaz~ `n aceea#i ganglioni inghinali superficiali. Din ganglionii inghinali
superficiali limfa dreneaz~ `n ganglionii inghinali profunzi (situa[i sub fascia lata); de aici
limfaajunge`nganglioniipelvini(iliaciexterni,iliaciinterni#iobturatori)(Walsh#icolab.,
2002).
50

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Exist~multipleinterconexiunilatoatenivelurile,astfel`nc]tdrenajullimfaticpenian
estebilateralc~treambeleariiinghinale.

Studiilimfoangiograficedemonstreaz~unpatternconstantaldrenajuluicecuprinde,
ca prim~ sta[ie, ganglionii inghinali superficiali #i ulterior inghinali profunzi #i pelvini
neconstat]nduseevitareaganglionilorsuperficiali(Walsh#icolab.,2002).

Acesteteoriiauunrolesen[ial`nstabilireaatitudiniichirurgicalefa[~demetastazele
ganglionare`ncancerulpenian#isuntdiscutatedetaliat`ncapitolulrespectiv.

Fig.34.Drenajullimfaticpenotesticular
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

51

TratatdeUrologie

Inerva[iapenisului

a) Inerva[ia autonom~. Fibrele parasimpatice iau na#tere din centrul sacrat al


erec[ieiS2S4.Fibrelesimpaticeprovindinzonatoracolombar~T12L2#iajungprinplexul
preaortic`nplexulhipogastric.Fibrelesimpatice#iparasimpaticeconverg`nplexulpelvin#i
de aici, pe calea nervilor caverno#i, ajung la nivelul penisului; la nivelul trabeculelor iner
veaz~at]tmusculaturaneted~c]t#iendoteliul.Nerviicaverno#iausemnifica[iechirurgical~
important~ put]nd fi leza[i `n cursul prostatectomiei radicale sau rezec[iei transuretrale a
prostatei. Stimularea fibrelor parasimpatice elibereaz~ acetilcolin~, oxid nitric #i VIP (poli
peptid intestinal vasoactiv), ceea ce duce la relaxarea mu#chilor caverno#i #i relaxarea
musculaturiiarterialenecesareerec[iei;stimulareasimpatic~inhib~erec[ia.

b) Inerva[ia somatosenzitiv~. Este asigurat~ de nervul dorsal al penisului, ram


terminalalnervuluiru#inos.Nervulru#inoscon[ine,deasemenea,#ifibreeferentemotorii
care inerveaz~ muschii bulbocavernos #i ischiocavernos; `n timpul fazei rigide a erec[iei
ace#timu#chicomprim~corpiicaverno#icresc]ndpresiuneaintracavernoas~.

Scrotul#iconinutulscrotal

Scrotul este o proeminen[~ voluminoas~, impar~ #i median~, ce apare `n spa[iul


angular dintre cele dou~ coapse, format~ `n cursul procesului de descensus testis, c]nd
testiculele sunt `nvelitede o serie destraturi ale pereteluiabdominal, d]nd astfelna#tere
canaluluiinghinal#iscrotului.

Areoriginebilateral~,celedou~hemiscroturifuz]ndlanivelulrafeuluimedian(linia
de fuziune a tuberculilor genitali), fiind `ns~ complet separate la interior; scrotul con[ine
testiculele,epididimele#ipor[iuneaterminal~afunicululuispermatic.

Peretele scrotal este format din #ase tunici suprapuse: tegumentul, tunica dartos,
fasciaspermatic~extern~,fasciacremasteric~,fasciaspermatic~intern~#ivaginala.

1)Tegumentulscrotalestesub[ire,elastic,a#ezat`npliuri#icon[ineglandesebacee,
sudoripare#ifoliculipilo#i.

2)Tunicadartosesteunstratsub[iredefibremuscularenetede#i[esutconjunctiv,
bogat`nfibrenervoasesimpatice,cesecontract~lafrig#iserelaxeaz~lacald,tonicitatea
diminu]ndcuv]rsta.Contrac[iadartosuluiestelent~#idifer~decontrac[iacremasterului`n
urmadeclan#~riireflexuluicremasterianprinstimulareap~r[iiinterneacoapseisauapielii
abdomenului.Anterior,tunicadartossecontinu~cudartosulpenian#icufasciasuperficial~
a peretelui abdominal; lateral este ata#at~ ramurilor ischiopubiene; posterior se prelun
ge#tecufasciaperineal~superficial~Colles.

Subtunicadartosseafl~unstratformatdin[esutconjunctivlaxcare`lsepar~de
tunicile subiacente. Acest strat reprezint~ un bun plan de clivaj `n abordul chirurgical al
scrotului;reprezint~,deasemenea,loculdeacumularealcolec[iilorpatologicedelanivelul
pereteluiscrotal.Datorit~separ~riinetede[esutulsubcutanatalcoapsei(inser[iadartosului
peramurileischiorectale),hematoamele#ialteacumul~riscrotalesepotpropagalanivelul
[esutului subcutanat al perineului, penisului #i peretelui abdominal inferior, f~r~ `ns~ a
migralanivelulr~d~ciniimembrelor.

3) Fascia spermatic~ extern~ (fascia lui Cowper) deriv~ din aponevroza mu#chiului
oblicexternalabdomenului.
52

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

4)Stratulmu#chiului#ialfascieicremasterieneestecontinuareamu#chiuluioblic
intern.Princontrac[iaacestuimu#chi`nurmareflexuluicremasterian(prinstimulareascro
tuluisauacoapseiinterne),testicululesteaduslaorificiulinghinalsuperficial.Acestreflex
sufer~modific~ri`ndiverseafec[iunineurologice.

5) Fascia spermatic~ intern~ (tunica fibroas~ a scrotului) este o extensie a fasciei


transversalis; are form~ de sac, `nvelind at]t testiculul, c]t #i elementele funiculului
spermatic.Inferior,tunicafibroas~ader~intimpedeoparteladartos#ipiele#ipedealt~
parte de por[iunea posterioar~ a testiculului #iepididimului. Formeaz~ o lam~ fibroas~ce
con[ine fibre conjunctive, elastice, fibre musculare netede, `mpreun~ cu vase sangvine ce
leag~circula[iaprofund~#isuperficial~atesticulului;esteconsiderat~unrudimentembrio
naralgubernacululuitestis#ipoart~numeledeligamentscrotalaltesticulului.

6) Tunica vaginal~ este o membran~ seroas~ care acoper~ testiculul #i par[ial


epididimul.Esteformat~dindou~lame:olam~visceral~#iunaparietal~,delimit]nd`ntre
eleocavitatevirtual~.

Lamaparietal~estestr]nsaderent~lafasciaspermatic~intern~;lanivelulperetelui
scrotalposteriorsereflect~,continu]nduseculamavisceral~ceader~str]nsdealbugineea
testicular~. `n condi[ii obi#nuite, cavitatea virtual~ dintre cele dou~ lame con[ine o lam~
fin~delichidclar.

Vaginala reprezint~ o prelungire peritoneal~ antrenat~ `n timpul procesului de


descensus testis. Ea comunic~ cu cavitatea peritoneal~ p]n~ `n luna a noua de dezvoltare
intrauterin~ printrun canal numit canal peritoneovaginal. Odat~ `ncheiat procesul de
descensus testis, acest duct `ncepe s~ se `nchid~, d]nd na#tere ligamentului peritoneo
vaginal ce se va a#eza printre elementele funiculului spermatic (Testut #i colab., 1929).
Persisten[acanaluluiperitoneovaginalduce`ntimplaapari[iahidroceluluicomunicant.

Fig.35.Scrotul#iregiuneainghinal~
(ReproduceredupaColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea)

53

TratatdeUrologie

Vasculariza[iaarterial~superficialascrotuluiesteasigurat~deramurialearterelor
ru#inoaseexterne(ramuridinarterafemural~)#iartereleperinealesuperficiale.
Ramuri ale arterei cremasterice (ramur~ din artera epigastric~ inferioar~) se
distribuiefascieicremasterice,fascieispermaticeinterne#ivaginalei.

Vasculariza[ia venoas~ dreneaz~ pe traiectul venelor ru#inoase externe `n vena


safen~maresaufemural~#ipetraiectulvenelorperinealesuperficiale`nvenaru#inoas~
intern~.

Drenajul limfatic se face `n grupul superomedial #i cel inferior al ganglionilor


inghinalisuperficiali(Testut#icolab.,1929).Limfaticelescrotalenudep~#escrafeulmedian,
drenajulf~c]nduseipsilateral.

Inerva[iascrotului

Pereteleanteriorscrotalesteinervatdenerviiilioinghinal#igenitofemural.

Inerva[ia fe[ei posterioare este asigurat~ de ramura perineal~ inferioar~ a nervului


ru#inosintern(plexsacrat).

Ace#tinerviasigur~at]tinerva[iasenzitiv~,c]t#iceamotoriesomatic~#ivegetativ~.

Fig.36.Con[inutulscrotal
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

54

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

Testiculele,epididimul#icordonulspermatic

Testiculelesuntorganeovalare,pereche,ad~postitelanivelulburselorscrotalebila
teral.`nmodnormaltesticululst]ngestemaijossituatdec]tceldrept.

Dimensiunile medii la v]rsta pubert~[ii sunt 45 cm lungime, 3 cm l~[ime #i aproxi


mativ 2,5 cm grosime. La exterior, colora[ia normal~ este albalb~struie, pe sec[iune
aspectul[esutuluitesticularnormalfiindbrung~lbui.Lav]rste`naintate,celedou~testicule
`ncepsseatrofieze,pierz]ndu#itreptatfunc[iile.

Configura[ieextern~

Testiculul are form~ oval~, axul s~u longitudinal fiind oblic de sus `n jos #i dinspre
anteriorspreposterior,cuo`nclina[iedeaproximativ450fa[~deorizontal~;aredou~fe[e
laterale(exterioar~convex~#imedialplan~),dou~margini(anteroinferioar~#iposterosu
perioar~)#idou~extremit~[i.

Margineaanteroinferioar~esteconvex~#iacoperit~`ntotalitatedevaginal~.

Lanivelulmarginiiposterosuperioareseg~se#teepididimulcareader~intimlacele
dou~ extremit~[i (cap #i coad~), corpul fiind separat de ovoidul testicular; `n aceast~
por[iuneseg~se#teunfunddesacalseroaseivaginalefunddesacepididimar.

Vasele testiculare sunt situate posterior de capul epididimului, p~trunz]nd prin


parteamijlocieamarginiiposterioaretesticulare`nhilultesticular.Pachetulvenoscep~r~
se#tetesticululsesitueaz~medialfa[~deepididim.

Potexistamaimulteforma[iuniembrionareata#atetesticulului:

Apendicele testicular #i epididimar (hidatidele lui Morgagni) reprezint~ dou~


forma[iuniveziculare,unapediculat~,cealalt~sesil~,cesedezvolt~`nparteaanterioar~a
testiculului#iepididimului,torsiuneaacestoraput]ndmimaclinicotorsiunetesticular~.

1.Appendixtestis(hidatidapediculat~)esteunicsaumultiplu#ireprezint~vestigii
alerinichiului embrionarsau alecanaluluiWolf.Esteovezicul~lichidian~ata#at~lacapul
epididimului;nueste`nrela[iecucanaleleseminifere.

2.Appendixepididimis(hidatidasesil~)esteostructur~tubular~cuuncanalcentral
ce se inser~ pe capul epididimului sau extremitatea superioar~ a testiculului; deriv~ din
extremitateasuperioar~,peritoneal~aductuluiMller.

3. Paradidimul (organul lui Giraldes) reprezint~ un mic organ albg~lbui situat `n


partea anterioar~ a funiculului spermatic; provine din partea inferioar~ a ductului Wolf,
omologlafemeiefiindorganulluiRossenmller.

4.Vaseleaberantealeepididimuluiapardealungultraiectuluicanaluluiependimar
#iemergdinelpentruasetermina`nfunddesac.
Configura[iaintern~

Albugineeatesticular~`nconjoar~testicululpe`ntreagasasuprafa[~,fiindcontinu~
#iuniform~;laexterioresteacoperitdevaginalavisceral~,iarlainteriorvine`ncontactcu
[esutulpropriutesticular.

La nivelul marginii posterioare a testiculului, `n partea sa mijlocie, albugineea


prezint~ o `ngro#are numit~ mediastinul testicular sau corpul lui Highmore; aceasta are
form~ de trunchi de piramid~ cu baza mare spre periferie, fiind locul pe unde vasele #i

55

TratatdeUrologie

ducteletraverseaz~capsulatesticular~.Dinmediastinpornescradiarsepturiceseata#eaz~
suprafe[eiinterneaalbugineei,form]nd200300delobuliconici,fiecaredintreace#tilobuli
con[in]ndunulsaumaimul[itubuliseminiferi(Walsh#icolab.,2002);`nmedie,diametrul
unuitubseminiferestede150200microni,iarlungimea(de#irat~)variaz~dela30cmla
1,5m.

Celuleleintersti[ialeLeydigseg~sesc`n[esutulce`nconjoar~tubulii#isuntr~spun
z~toaredefunc[iaendocrin~atesticululuiproducereadetestosteron.

Tubii seminiferi drep[i se formeaz~ prin unirea a 23 tubuli seminiferi #i reprezint~


primulsegmentalc~ilorexcretoarealespermei;ace#tiap~trund`nmediastinultesticular#i
prinanastomozarecual[itubidrep[idauna#tereretetestis(re[eaualuiHaller).Retetestis
sesitueaz~`nparteainferioar~acorpuluiluiHighmore,parteasuperioar~fiind`n`ntregime
ocupat~devasedes]nge#inervi.

Din rete testis se formeaz~ `ntre 12 #i 20 de ducte eferente care trec `n por[iunea
ceamaidezvoltat~aepididimuluicapul(Walsh#icolab.,2002).

Ductulepedidimariana#teredincanaleleeferenteav]ndoriginealanivelulcapului
epididimului#i`ntinz]ndusep]n~lanivelulcoziiundesecontinu~,f~r~olimit~precis~,cu
ductuldeferent;areolungimedeaproximativ67cm,darocup~doaropor[iunede5cm,
traiectuls~uprezent]ndnumeroasesinuozit~[i.

`n cele mai multe cazuri, epididimul este situat pe fa[a posterosuperioar~ a testi
culului,av]ndtraseudescendentsprelateral.Exist~`ns~#ivarianteanatomice,dintrecare
cea mai comun~ (810%) este inversiunea anterioar~ `n care epididimul #i testiculul
realizeaz~omi#carederota[iecu180`njurulaxuluivertical,epididimulfiindsituatantero
superior.

Vasculariza[iatesticuloepididimar~

Trei surse arteriale asigur~ vasculariza[ia testiculoepididimar~: artera testicular~,


arteradeferen[ial~siarteracremasteric~.

1)Artereletesticulare

Au originea pe fa[a anterioar~ a aortei, `n dreptul L2L3, `ntre originea arterelor


renale(superior)#iceaaartereimezentericeinferioare(inferior).

Arteratesticular~dreapt~are,`ntraseuls~udescendent,urm~toareleraporturi:
laoriginecuduodenulD3anterior#iaortacuganglioniilomboaorticiposterior
venacavainferioar~posterior
anteriorcur~d~cinamezenterului#iaileonuluiterminal
posteriorureteruldrept(`ndreptulL4)
apoiajunge`ncomponen[afunicululuispermatic.

Arteratesticular~st]ng~are,`ntraseuls~udescendent,urm~toareleraporturi:
anterior ramuri colice ale arterei mezenterice inferioare #i fascia Told II, r~d~cina
secundar~amezocolonuluisigmoid
posteriorureterulst]ng(`ndreptulL4)
intr~`ncomponen[afunicululuispermatic.

Laie#ireadinfunicululspermatic,arteratesticular~sesitueaz~pemargineamedial~
a epididimului, d]nd o serie de ramuri colaterale dintre care cele mai importante sunt
56

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

ramurile epididimare anterioare #i posterioare; `n continuare are traiect descendent #i


ajungelanivelulmediastinuluitesticularundesedistribuie`nprincipalpor[iuniianterioare,
mediale#ilateralealepoluluiinferior#ipor[iuniianterioareapoluluisuperiortesticular.De
aceeabiopsiatesticular~trebuieefectuat~`np~r[ilelateral~saumedial~alepoluluisupe
rior,risculinjurieivascularefiindminim(Walsh#icolab.,2002).

2)Artereledeferen[iale

Sunt ramuri ale arterelor vezicale inferioare #i `nso[esc ductul deferent p]n~ la
origineasa,aicianastomoz]ndusecuramulposterioralartereitesticulare.

3)Arteracremasteric~

Esteramalartereiepigastriceinferioare.Coboar~lanivelulfascieicremastericeprin
canalulinghinalp]n~lanivelulcoziiepididimuluianastomoz]nduse,`naceast~regiune,cu
artera testicular~ #i artera deferen[ial~, ceea ce poate explica restabilirea vasculariza[iei
testicularedup~ligaturafuniculului`ncazul`ncarearteracremasteric~nuafostprins~`n
ligatur~.

Vasculariza[iavenoas~

Venele testiculare sunt organizate `n c]teva plexuri anastomotice grupate `n jurul


arterei testiculare sub numele de plexul pampiniform. Aceast~ dispunere permite r~cirea
s]ngelui din artera testicular~ cu rol important `n spermatogenez~. `n varicocel dilatarea
plexului pampiniform cu stagnarea s]ngelui la acest nivel nu numai c~ `ncetine#te fluxul
sangvin, dar cre#te #i temperatura local~ testicular~, put]nd duce la afectarea spermato
genezei.

Lanivelulcanaluluiinghinal,veneleseanastomozeaz~form]nd2grupurivenoase:
ungrupanterior(predeferen[ial),cesereduce progresivcanum~r de vene,dar cu
cre#tereaconsecutiv~acalibrului,ceeacevaconducelaapari[ia`nretroperitoneua
uneisingurevenespermaticecesevars~`nunghiascu[it`nvenacav~pedreapta#i
subunghidrept`nvenarenal~st]ng~
un grup situat posterior (postdeferen[ial) care se termin~ frecvent `n vena
epigastric~inferioar~.
Veneletesticularesepotanastomozacuveneleru#inoaseexterne#ivenelecrema
sterice,ceeacepoateexplicarecidivavaricocelului.

Limfaticeletesticulului

Limfaticele urmeaz~ vasele spermatice dren]nd direct `n ganglionii retroperitoneali


periaortici#ipericavi(aiciafl]nduseprimasta[ieganglionar~)apoi,prindrenajretrograd,`n
ganglioniiiliaciprimitivi#iiliaciexterni.

Nu exist~ conexiuni directe cu ganglionii inghinali, aceasta fiind o caracteristic~


important~, necesar a fi cunoscut~, `n tratamentul tumorilor testiculare. Invazia peretelui
scrotal sau abordul tumorilor testiculare prin incizii scrotale poate modifica aceste c~i de
drenaj.

Inerva[iatesticulului

Fibrelesimpaticealetesticulului#iepididimuluiprovindinplexulrenal#iaortic#iau
acela#i traseu ca #i artera spermatic~ #i canalul deferent. De asemenea, fibre din plexul
57

TratatdeUrologie

pelvindauramuriaferente#ieferente,acestefibreput]ndusedistribuitesticululuicontra
lateral, ceea ce explic~ de ce procesele patologice localizate la un testicul pot afecta
func[ionalitateaceluilalt(Walsh#icolab.,2002).

Ramurigenitalealenervuluigenitofemuralasigur~inerva[iasenzitiv~atuniciivagi
nale#iapereteluiscrotal.

Fig.37.Sistemulreproduc~tormasculin
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Funicululspermatic

Funiculul spermatic reprezint~ un pedicul la cap~tul c~ruia se g~sesc suspendate


testiculul#iepididimul.
Elementeleconstitutivealefunicululuispermaticsunt:

1.
2.
3.
4.

canaluldeferent`nso[itdearteradeferen[ial~,ramur~aartereivezicaleinferioare
arteratesticular~ramalaorteiabdominale
arteracremasteric~,ramalepigastriceiinferioare,cecoboar~`nfasciacremasteric~
pachetulvenosanterior,continuareaplexuluipampiniform,#ipachetulvenosposte
rior
58

Capitolul1.Anatomia#iembriologiaaparatuluiurogenital

5. vaselelimfaticealetesticulului#iepididimului
6. filetenervoasesimpatice.

`ntreelementelefuniculareseg~se#te[esutconjunctivlax#i[esutadipos,toatefiind
`nvelitedemaimultefascii;delainteriorspreexterioracesteasunt:
fasciaspermatic~intern~
fasciaspermatic~extern~
tunicadartos.
Toatesuntprelungirialeelementelormusculofascialeabdominale#isecontinu~la
nivelulscrotului(veziperetelescrotal).

Ductuldeferent#iveziculeleseminale

Traiectulductuluideferent`ncepedelacoadaepididimului,av]ndtraseuascendent
lanivelulcanaluluiinghinal,posteriordevaselecordonuluispermatic.Laie#ireadincanalul
inghinal,lanivelulorificiuluiinghinalprofund,sesitueaz~lateraldevaseleepigastriceinfe
rioare;aicisedespartedevaseletesticulareav]ndtraiectdescendentanterior#iapoimedial
devaseleiliacep]n~`nregiuneaposterioar~abazeiprostatei.
Por[iuneaterminal~aductuluideferentestedilatat~#itortuoas~(ampuladeferen
[ial~)#iestecapabil~s~`nmagazinezespermatozoizi.Pereteleductuluideferentcon[ineun
strat muscular neted sub[ire cu fibre longitudinale la exterior #i circulare la interior;
mucoasaesteformat~dinepiteliusecretorcolumnarpseudostratificat.
Veziculeleseminalesuntstructuritubularelungideaproximativ5cmsituatelabaza
vezicii urinare lateral de ductele deferente, superior de prostat~ #i anterior de peretele
rectal; locul de p~trundere al ureterelor `n vezica urinar~ se afl~ imediat medial de v]rful
veziculei seminale. Fiecare vezicul~ seminal~ este o structur~ tubular~ unic~, tapetat~ de
epiteliusecretor,ceare,atuncic]ndestedesf~cut~,olungimecuprins~`ntre10#i15cm.In
vivoeaareuntraiecttortuosfiindmen[inut~subaceast~form~deoadventiceformat~din
[esutconjunctiv#ifibremuscularenetede.
Veziculeleseminaleauocapacitatedeaproximativ34mlfiecare,av]ndcontribu[ia
principal~laalc~tuirealichiduluispermatic,ne`nmagazin]nd`ns~sperma.Cap~tuldeschisal
veziculei seminale se une#te la baza prostatei cu ductul deferent ipsilateral, d]nd na#tere
ductului ejaculator al c~rui orificiu de deschidere `n uretr~ se afl~ lateral de verum
montanum.
`n absen[a proceselor patologice, veziculele seminale #i ductele deferente nu sunt
palpabilelatu#eulrectal.

Vasculariza[ia arterial~ a celor dou~ structuri provine, `n principal, din artera


veziculodeferen[ial~,ramalartereivezicaleinferioare;deasemenea,arterarectal~medie
d~ colaterale pentru peretele posterior al veziculei seminale (Testut, 1929; Soderberg,
1995).

Drenajulvenosseface`nplexulvenosperiprostatic.

Drenajullimfaticseproducec~treganglioniiiliaciinterni#iexterni.

Inerva[iaesteasigurat~deramuridinplexulhipogastric.Fibrelesimpaticeprovinde
la nivelul segmentelor L2L3, stimularea lor produc]nd contrac[ia veziculelor seminale.

59

TratatdeUrologie

Fibrele parasimpatice provin din parasimpaticul sacrat (S2S4) stimularea lor determin]nd
erec[ia,av]nd`ns~#iocomponent~`ncoordonareaejacul~rii.

Fig.38.Ductuldeferent#iveziculeleseminale(aspectposterior)
(reproduceredup~:ColourAtlasofUrologicSurgeryAbrahamT.K.Cockett,KenKoshiba;
Williams&Wilkins1996cupermisiunea).

Bibliografie

1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.
14.

AllenKS,KresselHY,ArgerPH,etal.Agerelatedchangesoftheprostate:evaluationbyMRimaging.
AJRAmJRoentgenol1989;152:77.
CiomuN.Ureterul,Vezicaurinar~,Uretra.Bucure#ti.EdituraCermaprint2005;5272,8297.
CockettA,KoshibaKSurgicalAnatomyinColorAtlasofUrologicSurgery.Firstedition.Williamsand
Wilkins1996:110,7578,107111,200204,243245,283289,306312.
IagnovZ,RepciucE,RussuGViscere;Anatomiaomului.Edituradidactic~#ipedagogic~1958;334354
IonescuMihaiDic[ionardeanatomi#ti,Ed.Litera,Bucure#ti,1991.
KennethW,DevineCAnatomyofthePenisandMalePerineuminAUAUpdateSeries.VolumeXIII.
W.B.SaundersCompany1994;p.1021.
PapilianVSplahnologia.AnatomiaOmului.VolumulII.Edituradidactic~#ipedagocic~1974;p.198
258.
PaturetGAppareilcirculatoire.Traitedanatomiehumainetopographique.TomeIII.Masson&Cie
Editeurs1958;p.596632.
SinelnikovRDTheExternalMaleGenitalOrgansinAtlasofHumanAnatomy.MirPublisher1989.p.
189194.
SinescuI,GlckG,H]rzaMTumorileprostatice.Urologieoncologic~.Bucure#ti.EdituraUniversitar~
CarolDavila2006;p.306310.
SoderbergSAnatomyoftheLowerUrinaryTractandMaleGenitaliainGraysAnatomy.Thirtyeight
edition.ChurchillLivingstone1995;p18481861.
Testut L, Jacob O Abdomenbasin; Traite danatomie topographique avec aplications medico
chirurgicales.Tomesecond.Paris:GastonDoinEditeurs;1929;p291550.
VersiE,CardozoLD,StuddJWW,etal.Internalurinarysfincterinmaintenanceoffemalecontinence.
BMJ.1986;292;166173.
WalshP,RetikA,VaughanDAnatomyinCampbellsUrology.Eighthedition.WBSaundersCompany
2002;170,2952.

60

Capitolul2.Fiziologiaaparatuluiurogenital

Capitolul

FIZIOLOGIA
APARATULUIUROGENITAL

Prof.Dr.PETRI#ORGEAVLETE

Prof.Dr.MARIAGRAMA,
Dr.ANDREIHA#EGAN,Conf.Dr.VIORELJINGA

61

TratatdeUrologie

Cuprins:

Fiziologiarinichiului63
Prof.Dr.P.Geavlete,Prof.Dr.MariaGrama,Dr.A.Ha#egan
Rolulfunc[ionalalrinichilor63
Formareaurinei64
Func[iatubular~:reabsorb[ia#isecre[ia68
Reabsorb[iaapeimecanismuldeconcentrare#idiluareaurinei74
Echilibrulacidobazic80
Participarearinichiuluilahomeostaziaacidobazic~81

Fiziologiabazinetuluirenal#iaureterului89
Prof.Dr.P.Geavlete
Rolulsistemuluinervos`ndinamicaureteral~89
Transportulurinei91
Fiziologiajonc[iuniiureterovezicale92

Fiziologiaveziciiurinare#iauretrei93
Prof.Dr.P.Geavlete
Func[iileveziciiurinare93
Biomecanicaveziciiurinare93
Neuroanatomiefunc[ional~(dev~zutcapitolulVezicaneurologic~)

Fiziologiaglandeloranexealeaparatuluigenitalmasculin96
Prof.Dr.P.Geavlete
Secre[iileglandelorsexualaccesorii96
Fiziologiareproduceriimasculine(dev~zutcapitolulInfertilitatea)
Fiziologiapenisului(dev~zutcapitolulDisfunc[iaerectil~)

Fiziologiaglandelorsuprarenale101
Prof.Dr.P.Geavlete,Conf.Dr.V.Jinga
Corticosuprarenala101
Medulosuprarenala105

Bibliografie106

62

Capitolul2.Fiziologiaaparatuluiurogenital

Fiziologiarinichiului
Prof.Dr.P.Geavlete,Prof.Dr.M.Grama,Dr.A.Ha#egan

Rolulfunc[ionalalrinichilor

Principalafunc[ieaaparatuluiurinaresteaceeadeexcre[ie,deformareaurinei#ide
eliminareaeilaexterior.Cuajutorulrinichilorseelimin~dinorganismoseriedesubstan[e
nevolatileindezirabilepentrumediulintern:
produ#ifinaliaicatabolismuluicelular(uree,creatinin~,aciduric,ura[ietc.)
cantit~[ileexcesivedeap~#isolvi[idinmediulintern(Na+,Cl,K+,Ca2+,ioniisulfa[i,
fosfa[i)
substan[ele str~ine ajunse accidental sau incidental `n organism (Pb, Hg, medica
mente, substan[e de contrast injectate `n scop diagnostic radiologic, substan[e
utilizatepentrudiversetestefunc[ionaleetc.).
Prinexcre[iaselectiv~atuturoracestorsubstan[e,rinichiiauocontribu[ieesen[ial~
lamen[inereacompozi[ieiconstanteamediuluiintern,lamen[inereaechilibruluiacidobazic
al acestuia, la men[inerea constant~ a volumului lichidului extracelular, deci o parte
`nsemnat~ din mecanismele homeostazice revine aparatului urinar. De aceea rinichii sunt
organedeimportan[~vital~,extirparealorfiindincompatibil~cuvia[a.
`naldoilear]nd,rinichii`ndeplinesc#ifunc[iiendocrine.Eisecret~:
eritropoietin~: `n condi[ii de hipoxie renal~, celulele epiteliale ale tubilor contor[i
proximalisecret~acesthormon,carearecaefectbiologicstimulareaeritropoiezei`n
m~duvahematogen~
renin~: `n condi[ii de ischemie renal~, hipotensiune, sc~derea concentra[iei Cl `n
urinaaproapefinal~,stimularesimpatic~(prinreceptori1),celuleleaparatuluijuxta
glomerular secret~ renina, o enzim~ care catalizeaz~ formarea angiotensinei I, ce
este convertit~ enzimatic `n angiotensin~ II. Aceasta din urm~ este o substan[~ cu
puternicefectvasoconstrictorasupraarterioleieferente,dar#iasupraaltorteritorii
vasculare(cacelcutanat,splanhnic);totodat~,angiotensinaIIstimuleaz~eliberarea
de aldosteron. Prin aceste efecte se redreseaz~ presiunea efectiv~ de filtrare #i
presiuneaarterial~.
Conversia angiotensinei I `n angiotensin~ II se face sub ac[iunea ECA (enzima de
conversieaangiotensinei),careseg~se#tepesuprafa[aluminal~acelulelorendotelialedin
circula[ia pulmonar~, dar #i din arteriolele aferente, eferente #i capilarele glomerulare. La
nivel renal se converte#te 20% din angiotensina I `n angiotensin~ II. Nivelurile renale ale
angiotensineiIIsuntmultmaimaridec]tceleplasmatice.
alte substan[e presoare (`ntre care #i endotelina), ce par a fi responsabile de
hipertensiunearenal~cunivelplasmaticnormalderenin~
kininecuintens~ac[iunevasodilatatoare
1,25dihidroxicolecalciferol,formabiologicactiv~avitamineiD,curol`nmetabolis
mulcalciului
prostaglandinele PGE2, PGF2 #i PGI2, substan[e vasoactive, care moduleaz~ debitul
sangvinrenal#iconsecutivdiureza#inatriureza.
`naltreilear]nd,rinichii`ndeplinesc#ifunc[iimetabolice:
gluconeogenez~, `n completarea activit~[ii hepatice de sus[inere a glicemiei, atunci
c]ndrezerveledeglicogensuntepuizate

63

TratatdeUrologie

catabolizareaunorhormonipolipeptidici(insulin~,glucagon,PTH,gastrin~,vasopre
sin~ etc.); prin aceast~ activitate, rinichii contribuie la men[inerea unei concentra[ii
adecvateaacestorhormoni`ncircula[ie.

Formareaurinei

Formareaurineiserealizeaz~`ndou~etape.`nprimaetap~,prinprocesuldefiltrare
glomerular~seproduceurinaprimar~.`nadouaetap~seproducemodificareaimportant~a
volumului #i compozi[iei urinei primare pe m~sur~ ce aceasta parcurge tubul urinifer, prin
func[iiletubularedereabsorb[ie#isecre[ie,ceduclaproducereaurineifinale.
Seformeaz~astfellacap~tuldistalaltubilorurinafinal~,cuundebitzilnicde11,5
litri (rezulta[i din cei 180 litri de urin~ primar~). Din rinichi, urina estepropulsat~activ, pe
m~sur~ceseformeaz~,princ~ileurinare(calice,bazinet,uretere)#idepozitat~temporar`n
vezic~,deundeesteevacuat~intermitentprinuretr~laexterior,prinactulmic[iunii.

Filtrareaglomerular~

Reprezint~ o prim~ parte a func[iei renale, de selectare a solvi[ilor plasmatici care


trebuieconserva[i`norganism,dintotalulsolvi[ilorplasmatici.Lafiecaretrecereas]ngelui
pringlomerulsefiltreaz~20%dinplasm~prinmembranafiltrant~glomerular~,ultrafiltratul
(urina primar~) trec]nd `n spa[iul Bowman, `n timp ce macromoleculele proteice r~m]n `n
s]ngelecarep~r~se#teglomerululprinarteriolaeferent~.

Fenomenul de filtrare are o amploare deosebit~. Debitul sangvin renal este de 1,2
1,3 litri/min. (deci 2025% din debitul cardiac), valoare cu mult superioar~ necesit~[ilor
metabolicealerinichilor,care,`mpreun~,aumasadoarde300g. Consumuldeoxigendin
s]ngele circulant prin rinichi este redus, astfel, s]ngele din venele renale con[ine mai mult
oxigen dec]t s]ngele venos provenit de la alte organe (diferen[a arteriovenoas~ renal~ a
oxigenuluiestede1,4ml/100mls]nge,fa[~dediferen[aarteriovenoas~medie`norganism
de5ml/100mls]nge).

Dincei1,21,3litrides]ngecaretraverseaz~rinichii`ntrunminut,plasmareprezint~
700ml/min.=debitulplasmaticrenal.Dinaceasta,traverseaz~membranafiltrant~glome
rular~125ml/min.=debitulultrafiltratuluiglomerular.
Ultrafiltratul glomerular are o compozi[ie diferit~ de a plasmei doar prin absen[a
particulelorcoloidale(proteine#ilipoproteine),apa#isolvi[iimicromoleculari(ioni,glucoz~,
aminoacizi, uree etc.) av]nd concentra[ii sensibil egale. Se deduce c~ membrana filtrant~
glomerular~re[inedoarproteinele#isubstan[elecarecircul~`nplasm~legatedeproteine
transportoare,permi[]ndtrecerealiber~acelorlaltemolecule,fenomenexplicatdestructu
ramembraneifiltranteglomerulare.
Evident,nusefiltreaz~elementelefigurateales]ngelui,careaudimensiunimultmai
mari dec]t diametrul fenestrelor. Totu#i, prin existen[a unor mici leziuni inerente la nivel
glomerular,unnum~rredusdehematii#ileucocitescap~prinfiltrulrenal,reg~sinduse`n
urina final~. Normal, se admite o pierdere de maximum 2.000 hematii/ml x min. #i 4.000
leucocite/mlxmin.

Membrana filtrant~ glomerular~ este alc~tuit~ din endoteliul capilar, membrana


bazal~#iepiteliulfoi[eiinterneacapsuleiBowman.
Endoteliulcapilarestedetipfenestrat,prezent]ndnumeroaseorificiitranscelulare
fenestre.`nmicrostructuracelulelorendotelialeseg~sescfilamentedeactin~cuactivitate
contractil~,carepotmodificadiametrulfenestrelor.
64

Capitolul2.Fiziologiaaparatuluiurogenital

[esutulmezangialglomerular,`njurulc~ruiase`nf~#oar~capilarele,are`nstructura
sacelulemuscularenetedemodificate,carecon[inbenzideactomiozin~,cesecontract~sub
influen[a agen[ilor vasoconstrictori, produc]nd #untarea unor anse capilare #i reducerea
suprafe[eidefiltrare.

Factoriidecaredepindefiltrareaglomerular~sunt:
permeabilitateacapilarelorglomerulare
suprafa[adefiltrare
presiuneanet~defiltrareglomerular~.

Valoareaceamaijoas~araportului,de0,01,oaualbumineleplasmatice,cugreutate
molecular~de69.000daltoni#idiametrulde71.
Rezult~c~greutateamolecular~limit~amacromoleculelorcarear`nc~peaprinporii
membranei filtrante glomerulare este de cca 70.000 daltoni, iar diametrul de aprox. 70 .
Darporicuunasemeneadiametru,dep]n~la70,nuaufost`nc~identifica[i.
Fenestreleendoteliuluiglomerularaudiametrulde5001.000,decisuntmultprea
largicas~poat~faceselec[iasolvi[ilordup~greutateamolecular~/diametru.Fanteleepite
lialedintrepediculiipodocitelorepiteliuluicapsularsunt#ieleprealargi(diametru250).
Explica[iaacceptat~`nprezentesteaceeaaexisten[eiunorpori`nmembranabazal~,cares~
reprezinte de fapt ni#te canale hidratate `ntre lan[urile de colagen #i de proteoglicani
(Kanwar, 1984). Se asum~ c~ aceste canale au un traiect serpentinos #i nu sunt stabile
structural,ceeacearexplicadecenuaupututfieviden[iateprinmicroscopieelectronic~.
Proteinele plasmatice nonalbumine, cu greutate molecular~ mai mare de 70.000
daltoni,nusefiltreaz~.
Albuminele, cele mai mici proteine plasmatice, prin interven[ia respingerii electro
statice exercitat~ de glicocalix #i a formei lor, se filtreaz~ `n foarte mic~ m~sur~ (practic,
doar1% dinalbumineleplasmaticescap~prinfiltrulglomerular).Albuminuriapatologic~
poate fi cauzat~ #i numai de o reducere a sarcinilor electrice negative ale glicocalixului
(lezarefunc[ional~).
Hemoglobina este filtrabil~ `n propor[ie de 3%. Hemoliza excesiv~ elibereaz~ `n
plasm~ cantit~[i mari de hemoglobin~, care dep~#esc capacitatea de transport a hapto
globinei,sefiltreaz~#isereg~sesc`ntubiiuriniferi.`nmediulacid,cumesteadeseoriurina,
hemoglobinaprecipit~,bloc]ndcurgerea,#idetermin~insuficien[~renal~acut~.Prinalcali
nizareaurinei,acestprecipitatpoatefieventualredizolvat.
Mioglobina,cugreutatemolecular~de17.000daltoni,estedejamultmaifiltrabil~.
Dar aceast~ protein~ nu este circulant~ `n plasm~ `n mod normal. `ns~, `n situa[ia unei
rabdomiolizeextinse(zdrobireamusculaturiischeleticeprintraumatisme),sepotelibera`n
plasm~ cantit~[i `nsemnate ale acestei proteine, care se filtreaz~ #i se poate ajunge la
insuficien[~renal~acut~#imoarte.
Probleme de `nc~rcare electric~ sepun #i pentru microsolvi[i. Ionii `nc~rca[i pozitiv
+
+
(Na ,K etc.)suntatra#idec~treproteineleplasmatice`nc~rcatenegativ,pec]nd`nultra
filtratseg~sescmultmaipu[ineproteine.Sestabile#teastfelunefectGibbsDonnan,care
explic~ concentra[ia u#or mai mare a ionilor pozitivi `n plasm~ fa[~ de ultrafiltrat, #i con
centra[ia u#or mai ridicat~ a ionilor negativi (Cl, HCO3) `n ultrafiltrat fa[~ de plasm~. `ns~
acestediferen[eprivindioniisuntfoartemici#i,deobicei,suntneglijate`nfiziologiarenal~.

Suprafa[a de filtrare total~ este de 1,21,5 m2, la om to[i nefronii fiind `n activitate
permanent~. Reducerea suprafe[ei de filtrare poate fi determinat~ reversibil de contrac[ia

65

TratatdeUrologie

celulelormezangialesubac[iuneaangiotensineiIIsauatromboxanuluiA2,sauireversibilde
leziunianatomice:sclerozarenal~,tumori,chisturi,leziunispecificetuberculoase,nefrecto
miilepar[iale,rinichiuniccongenitalsauchirurgical.

Presiunea net~ de filtrare rezult~ din `nsumarea algebric~ a for[elor care `mping
lichiduldincapilar`nspa[iulBowman#iafor[elorcareac[ioneaz~`nsenscontrar.

Mi#carea lichidului prin peretele capilar, `ntre plasm~ #i intersti[iu, a fost elucidat~
de E.H. Starling (Blantz #i Pelayo, 1986). Acesta a descris echilibrul dinamic dintre for[ele
care`mpinglichiduldincapilar`nintersti[iu#ifor[elecarereabsorblichiduldinintersti[iu`n
capilar.

Pentru a estima presiunea net~ de filtrare `n capilarele renale glomerulare, pornim


dela`nsumareaacestorfor[e,particularizatelacazulcorpuscululuirenalMalpighi.Astfel:
Presiunea hidrostatic~ capilar~ glomerular~ (PhG) are o valoare mai mare dec]t `n
capilarele sistemice extrarenale (Blantz #i Pelayo, 1986). A fost m~surat~ direct la
diverseanimaledeexperien[~,ob[in]ndusevaloridestuldediferitedelaospeciela
alta.Laomnusauob[inutdatefoartecerte,seconsider~maiveridic~valoareade
45mmHg.Aceast~valoare,superioar~presiuniihidrostaticedelacap~tularterialal
capilarelor sistemice extrarenale, poate g~si unele explica[ii: arterele renale sunt
ramuridirectedinaort~,cucalibrumare#itraiectscurt,arterioleleaferentesunt#i
eleramuridirecte,scurtedinartereleinterlobulare
`nc~odeosebirefa[~decapilarelesistemiceextrarenaleconst~`nfaptulc~valoarea
einuscadesprecap~tulterminalalcapilarelorglomerulare.Explica[iaestedat~de
existen[alaacestcap~tterminalaarterioleieferente,vascareofer~rezisten[~prin
musculaturasa,#inuavenulelor,curezistent~multmairedus~,cumestecazul`n
microcircula[iasistemic~extrarenal~
Presiunea hidrostatic~ din spa[iul Bowman (PhB) se asimileaz~ presiunii hidrostatice
intersti[iale (Phi). Are o valoare pozitiv~ de 10 mmHg (necesar~ pentru a asigura
propulsiaultrafiltratuluiprintubiiuriniferip]n~`ncalicelemici,undepresiuneaeste
0mmHg)
Presiunea oncotic~ a proteinelor plasmatice (PoG) are valoarea de 25 mmHg la
`nceputul capilarului glomerular, dar cre#te spre sf]r#itul lui la 35 mmHg, datorit~
concentr~riiproteinelorplasmaticeprinplecareaunuidebitmaredelichid`nspa[iul
Bowman
Presiunea oncotic~ a proteinelor din spa[iul Bowman (PoB) se asimileaz~ presiunii
oncotice din intersti[iu, dar, pentru c~ nu se filtreaz~ dec]t foarte pu[ine proteine,
valoareaeiseconsider~practic0mmHg.

Se observ~ c~ filtrarea se produce `ncep]nd de la cap~tul ini[ial (dinspre arteriola


aferent~)alcapilarului,#i`nceteaz~sprecap~tulfinal(dinsprearteriolaeferent~)alcapila
rului.Spre deosebiredecapilarelesistemiceextrarenale,nu seproducereabsorb[ia, deoa
recelacap~tuleferentpresiuneanet~arevaloarea0mmHg.

Maitrebuieobservatc~valoareapresiuniinetedefiltrarenuestepreamare,de10
mmHg.#itotu#i,sefiltreaz~,printrosuprafa[~total~deperetecapilarnetmaimic~dec]ta
tuturor capilarelor sistemice extrarenale, un debit imens de lichid, de 125 ml/min., prin
compara[iecu2ml/min.delanivelulcapilarelorsistemiceextrarenale.Explica[iaconst~`n
existen[a milioanelor de fenestre din endoteliul capilarelor glomerulare, care cresc mult
coeficientuldefiltrare.Aceast~presiunenet~defiltrarepoatesuferivaria[ii`nplussau`n
minus,`nfunc[iedeparametriicareocompun.

66

Capitolul2.Fiziologiaaparatuluiurogenital

`n primul r]nd, presiunea hidrostatic~ intracapilar~ cre#te c]nd cre#te presiunea `n


amonte (presiunea arterial~ sistemic~), resim[it~ #i `n arteriolele aferente, #i scade c]nd
scadepresiuneaarterial~sistemic~.
Dar presiunea hidrostatic~ intracapilar~ mai depinde #i de intensitatea vasocons
tric[iei`narterioleleaferent~#ieferent~:
dac~ vasoconstric[ia `n arteriola aferent~ este mai puternic~ dec]t `n cea
eferent~, debitul de s]nge `n capilarele glomerulare scade, duc]nd la sc~derea
debituluideultrafiltrat
dac~ vasoconstric[ia `n arteriola eferent~ este mai puternic~ dec]t `n cea afe
rent~, presiunea hidrostatic~ `n capilarele glomerulare cre#te, duc]nd la
cre#tereadebituluideultrafiltrat
dac~vasoconstric[iaseintensific~`nmodegal`narterioleleaferent~#ieferent~,
presiuneahidrostatic~intracapilar~r~m]neaceea#i,darscadedebituldes]nge`n
capilare,deciscadedebituldeultrafiltrat.

Dependen[apresiuniinetedefiltraredetensiuneaarterial~sistemic~nuestea#ade
important~cumindic~formulademaisus.Strictmatematic,sc~dereadoarcu10mmHga
presiuniiarterialearanulafiltrarea.Totu#i,studiilef~cutepec]ine(ShipleyandStudy,1951)
au ar~tat c~, `n ciuda unor varia[ii ale TA sistolice `ntre 80 #i 180 mmHg, filtrarea
glomerular~ se men[ine aproape constant~ (variaz~ doar cu 10%), #i numai dincolo de
acestelimiteesteinfluen[at~.Laom,seconsider~c~limiteledevaria[ieaTAsistolice,fa[~
decarefiltrareaesteaproapeconstant~,suntde60130mmHg.Fenomenulseexplic~prin
existen[aunuisistemdeautoreglareacircula[ieirenale,caremen[inepresiuneaconstant~
`nglomeruli,chiaratuncic]ndTAvariaz~`ntrelimitelemen[ionate.Autoreglareanuseface
prin mecanisme nervoase, at]t timp c]t se men[ine la rinichiul denervat. Explica[iile larg
acceptateast~zisunt:
mecanismul miogen cre#terea TA `n arteriola aferent~ `ntinde musculatura
neted~dintunicasamedie,caresecontract~reactivprintrunmecanismintrin
sec,reduc]ndastfelfluxulsangvinlavaloareanormal~
interven[ia sistemului renin~ angiotensin~: sc~derea TA `n arteriola aferent~
estesesizat~debaroreceptoriicelulelorjuxtaglomerulare,ceeaceinducesecre[ia
de renin~ #i deci formarea de angiotensin~ II; aceasta are un efect
vasoconstrictorpredominantasupraarterioleieferente,cucre#tereaconsecutiv~
apresiuniihidrostatice`ncapilareleglomerulare#imen[inereafiltr~rii.
Cre#tereaimportant~aTAsistemice,peste130mmHg,ridic~presiuneahidrostatic~
glomerular~#idecidebitulfiltratuluicre#te.
`nschimb,pr~bu#ireaTAsistemicesub60mmHgreducep]n~lazerofiltrareaglome
rular~.
Oseriedefactorinervo#i#iumoralimodific~debituldeultrafiltrat:
stimularea nervoas~ simpatic~ (`n condi[ii de efort fizic, hipotensiune arterial~,
durere, traumatisme, stres neuropsihic etc.), prin ac[iunepe 1receptori adre
nergici,intensific~vasoconstric[ia`narterioleleaferent~#ieferent~`nmodegal,
cureducereadebituluides]nge`nglomeruli#isc~dereadebituluideultrafiltrat;
stimuleaz~ secre[ia de renin~ prin ac[iune direct~ asupra celulelor juxtaglome
rulare,pereceptori1adrenergici
angiotensinaII intensific~vasoconstric[iamaimult`narteriolaeferent~dec]t`n
arteriolaaferent~,cresc]ndpresiuneaefectiv~defiltrare#idebituldeultrafiltrat;

67

TratatdeUrologie

asupra[esutuluimezangialdetermin~contrac[ie,cusc~dereasuprafe[eidefiltra
re#iadebituluideultrafiltrat
vasopresinaareacela#iefectca#istimulareanervoas~simpatic~
histamina produce vasodilata[ie egal~ pe teritoriul arteriolar, f~r~ modificarea
presiuniiefectivedefiltrare,darcucre#tereadebituluides]nge#iadebituluide
ultrafiltrat
prostaglandinele E1, E2, I2 produc vasodilata[ie egal~ pe teritoriul arteriolar, cu
men[inereapresiuniiefectivedefiltrare,darcucre#tereadebituluides]nge#ia
debituluideultrafiltrat;auefectprotectorcar~spunslastimuliivasoconstrictori
renali(hiperreactivitatesimpatic~,catecolamine,angiotensin~II)
factorulnatriureticatrial(ANF)producevasodilata[iepreglomerular~,cucre#te
readebituluideultrafiltrat
glucocorticoizii`nadministrarecronic~crescdebituldes]nge#idebituldeultra
filtratprinvasodilata[ie`narterioleleaferent~#ieferent~
NOinhib~eliberareareninei#iinducevasodilata[ierenal~,cucre#tereadebitului
deultrafiltrat.

Presiunea coloidosmotic~ plasmatic~ scade `n hipoproteinemii de diverse cauze


(lips~ de aport, de sintez~sau pierderi proteice) determin]nd cre#terea filtr~rii, `n timp ce
cre#tereapresiuniicoloidosmotice(hiperproteinemiidedeshidratare)reducefiltrarea.
Presiuneahidrostatic~capsular~poatecre#te`nobstruc[iiureteralesauedemrenal,
reduc]ndsausuprim]ndfiltrarea.

Func[iatubular~:reabsorb[ia#isecre[ia

Se adreseaz~ `n general substan[elor utile economiei generale a organismului, dar


par[ial#iunorcataboli[i(uree,aciduricetc.),dincauzaapari[ieiunorgradien[ideconcentra
[ie;ultimiivorsuferi`ns~#iprocesuldesecre[ie,careaccelereaz~eliminarealor.

Glucoza se reabsoarbe cvasitotal din ultrafiltrat, `n urina final~ de 24 de ore r~m]


n]ndnumaic]tevamiligrame.Sediulreabsorb[ieia98%dinglucozafiltrat~esteprimajum~
tateatubuluicontortproximal(Grama,2004).
Mecanismul de reabsorb[ie este acela de cotransport cu Na+ la polul apical al
epiteliului tubular #i de difuziune facilitat~ lapolul bazal; este deci un mecanism secundar
activ,princonsumulenergeticalpompeideNa+K+,careexpulzeaz~dincelul~ioniideNa+.
Reabsorb[ia tubular~ a glucozei nu depinde de insulin~, cum este cazul difuziunii facilitate
careintroduceglucoza`nceluleleconsumatoaredeglucoz~.
Caoricetransportmediatdeunc~r~u#,#itransportulglucozeiareunnivelmaximce
nupoatefidep~#it(Reubi,1954).Pentruglucoz~,nivelulmaximdereabsorb[ieestede375
mg/min. la b~rbat #i de 300 mg/min. la femeie, cu mici diferen[e de la un nefron la altul
(debitulnormalalglucozei`nultrafiltratestede100125mg/min.,decisubnivelulmaximde
transport).Dac~debitulglucozei`nurinaprimar~dep~#e#teacestevalori,apareglicozuria.
Acest nivel maxim corespunde unei concentra[ii plasmatice a glucozei `n s]ngele venos de
180mg%,concentra[iecaresenume#tepragulrenalpentruglucoz~.
Labolnaviicudiabetzaharatglicozuriaseexplic~prindep~#ireapraguluirenal,#inu
prinsecre[iainsuficient~deinsulin~.
`ndiabetul renalexist~undefectgeneticaltransportorului#i,laglicemienormal~,
apareglicozurie.
68

Capitolul2.Fiziologiaaparatuluiurogenital

Exist~competi[iepentruacela#itransportor`ntreglucoz~#ialtehexoze(galactoz~,
xiloz~)saufluorizin~(glicozidvegetaldinscoar[a#ifrunzadecire#,cais,m~r)careproduce
glicozuriediabetulfluorizinic).Astfelseexplic~glicozuria#ipoliuriaceapardup~ingestia
deceaidecozidecire#e.

Aminoaciziisereabsorb#ieiaproape`ntotalitate,`nurinafinal~ajung]ndcantit~[i
infime.Sediulreabsorb[ieiestetubulcontortproximal,iarmecanismulestetotdecotrans
portcuNa+(Oken,1977).
Exist~treitipuridecotransportoripentrudiver#iiaminoacizi:unulpentruaminoacizii
neutri,unulpentruaminoacizi#iunulpentruprolin~#ihidroxiprolin~.
Exist~ persoane cu defecte ereditare ale transportorului pentru cistin~, cu apari[ia
cistinuriei#iacristalelordecistin~`nceluleletubulare,cristalin(cistinoza).

Proteinelescap~prinfiltruglomerular`ntrundebitde30g/24ore(dincirca400g,
c]t reprezint~ zestrea total~ plasmatic~). Din acestea, doar 0,0250,15 g/24 ore apar `n
urinafinal~,decireabsorb[iaesteaproapetotal~.
Mecanismul de transport const~ `n endocitoz~ la polul apical, urmat de descom
punerea `n aminoacizi `n citoplasma celulelor epiteliale #i de difuziune facilitat~ la polul
bazal.
Defecteledestructur~alemembraneifiltranteglomerularecrescdebitulproteinelor
`nultrafiltrat,cudep~#ireaposibilit~[ilordeendocitoz~#iapari[iaproteinurieipatologice.

Sodiul(Na+)esteprincipalulcationextracelular.Cantitateadesodiudinlichidulextra
celularestedeterminat~deechilibruldintreingestiadesodiu#ieliminareasarenal~,`nmod
normal,unominger~zilnic150mEqNa+,cantitatecareesteeliminat~urinar,men[in]nduse
astfelnatremia(Berliner,1961).

Na+esteprezent`nultrafiltratulglomerular`naceea#iconcentra[ieca`nplasm~(140
mEq/lsau320mg/100ml),zilnicfiltr]ndaproximativ25.000mEqNa+(136142mEq/Lx180
L/24ore)sau500600g,cantitatede6orisuperioar~`ntreguluicapitalsodatalorganismului
(Gottschalck#iLassiter,1974),`ncondi[iifiziologicedinaceast~cantitate99%sereabsoarbe
(aproximativ1mol/or~),`nurin~elimin]ndusezilnicdoar100200mEq(58g),`ncondi[iile
uneidietececon[inezilnic14gNaCl.

Excre[ia renal~ a Na+ este rezultatul unui mecanism complex care are la baz~
corela[ia `ntre filtrarea glomerular~ #i reabsor[ia tubular~, astfel `nc]t reglarea final~ a
excre[ieidesodiusedesf~#oar~`nnefronuldistal.
Astfel,lanivelultubuluicontortproximal(TCP)seproducereabsorb[iaa6070%din
filtratul glomerular. Acest proces are loc izoosmotic, cu consum energetic. ATPaza ofer~
energia necesar~, men[in]nd `n acela#i timp o concentra[ie redus~ a Na+ `n celulele
proximale renale. Prin acest mecanism se men[ine un gradient `ntre spa[iul intratubular #i
celintracelular,determin]ndtrecereapasiv~aionilordeNadinlumen`ncelule.
La nivelul ansei Henle se produce reabsorb[ia a circa 15% din Na+ filtrat. Datorit~
impermeabilit~[iirelativepentruH2Oasegmenteloranseiseproduceoreabsorb[ie`nexces
aNaCl,pebazaunuigradientdeconcentra[iemen[inutdeNa+/K+ATPaz~.
Deoareceresorb[iaNa+serealizeaz~printrunmecanismdecotransportcuK+Cl,iar
+
K estereciclat`nlumenultubular,apareodiferen[~depoten[ialcaredetermin~difuziunea
pasiv~aNa+`nspa[iulintercelular.
Se creaz~ astfel o cre#tere a osmolarit~[ii din intersti[iul medular care permite

69

TratatdeUrologie

cre#tereaconcentra[ieiurinii`nprezen[ahormonuluiantidiuretic.
La nivelul tubului contort distal se produce resorb[ia pasiv~ a circa 15% din NaCl
filtrat.
La nivelul tubilor colectori corticali, sub ac[iunea argininvasopresinei se produce
cre#terea permeabilit~[ii celulelor tubulare pentru H2O, fapt care determin~ o cre#tere a
resorb[ieideNa.Aceastaserealizeaz~datorit~uneiATPazeNa+K+,curol`nsecre[iaK.
Tubii colectori medulari contribuie la concentrarea maximal~ a urinii datorit~
permeabilit~[iipentruH20dependent~exclusivdeprezen[aADH.

Reglarearenal~aexcre[ieideNa
1.Filtrareaglomerular~(FG).Masafiltrat~deNa+depindedefiltrareaglomerular~
#i natremie. Varia[iile FG modific~ excre[ia urinar~ de Na+. Astfel, vasoconstric[ia arterial~
renal~esteurmat~desc~dereadispropor[ionat~anatriurezei`nraportcusc~dereaFG.
2. Interven[ia mineralocorticoizilor. Aldosteronul (ADS) scade eliminarea Na+ prin
stimulareareabsorb[ieilanivelulnefronuluidistal.`ncondi[iidehiperaldosteronismcronic,
mai`nt]iseinstaleaz~reten[iasodat~#iexpansiuneavolemic~,ulteriorserevinelanivelul
ini[ialalexcre[ieiurinaredeNa+.
3.Graduldeexpansiuneavolumuluidelichidextracelular.Expansiuneavolumului
extracelularmodific~reabsorb[iatubular~deNa+. Cre#tereapresiuniioncotice`ncapilarele
peritubulare prin microperfuzii cu dextran hiperton antreneaz~ o cre#tere propor[ional~ a
reabsorb[ieideNa+#iap~`nTCP.
4. Al[i factori modulatori ai elimin~rii sodiului. Prostaglandinele (PG) produse de
celulele intersti[iale din medular~ din apropierea tubului colector joac~ un rol `n reglarea
transportuluiNa+laacestnivel.
EfectulnatriureticalPGsarexplicaprinvasodilata[iarenal~,cucre#tereapresiunii
hidrostatice `n capilarele peritubulare #i reducerea consecutiv~ a reabsorb[iei de Na+.
Prostaglandinelenumodific~reabsorb[iaproximal~aNa+,cidoarpeceadistal~.
Parathormonulstimuleaz~adenilatciclaza,cuformareaAMPc,produc]ndhiperpola
rizareau#oar~amembraneicelulare.PTHscadereabsorb[iaNa+prininhibareacanalelorde
sodiudinmembranaluminal~(Bomsztzk,1986;Levy#icolab.,2005).
Hormoniitiroiodienistimuleaz~reabsorb[iaNa+#iaapeidinTCPprincre#tereaper
meabilit~[iipentrupotasiuamembraneibazolaterale.

Potasiul(K+)estecelmaifrecventcationalcorpuluiumancuundepozittotaldecirca
3.0004.000mEq.
Aproximativ98%dinK+totalseafl~intracelular,laacestnivelconcentra[iasafiindde
circa140mEq/l,fa[~deconcentra[iaextracelular~careestede4mEq/l.Acestecaracteristici
difer~ fa[~ de reparti[ia sodiului, care este distribuit `n principal `n spa[iul extracelular
(Gottschalck#iLassiter,1974).

`ncazulunuiindividnormalseexcret~aproximativ90%dinK+deaportcareajungela
rinichi. Procesele renale care guverneaz~ excre[ia de K+ includ: filtrare glomerular~,
reabsorb[ietubular~#isecre[ie.
Lanivelglomerularseproducefiltrarealiber~apotasiului(circa700mEqdeK+pezi).
Ca urmare a proceselor de resorb[ie tubular~ doar 1015% din K+ filtrat se excret~ urinar.
Astfel,lanivelultubuluicontortproximalseabsoarbecircaaproximativ70%dincantitatea
70

Capitolul2.Fiziologiaaparatuluiurogenital

de K+ filtrat~ prin c~ile paracelulare datorit~ unui gradient osmotic determinat de ATPaza
Na+K+bazocelular~.
La nivelul ramului descendent al ansei Henle se continu~ reabsorb[ia pasiv~ a K, `n
timp ce, `n segmentul ascendent aceasta se face activ, printrun sistem de cotransport
Na+/K+/2Cl(Leaf#iCotran,1976).
Tubulcolectorcorticalestesediulsecre[ieideK,reglareaacesteiafiindefectuat~prin
ac[iuneaasupraasupracanalelordinmembranaluminal~saubazolateral~.
Lanivelulmembraneiapicaleexist~#iunmecanismdecotransportK+Clcecontri
buielasecre[iadeK+`ntubuldistal,atuncic]ndconcentra[iaCllaacestnivelestesc~zut~.
Celulele intercalate secret~ H+ #i particip~ la resorb[ia K+ prin schimb activ H+K+ (Guyton,
1976).
Reglarearenal~aexcre[ieideKserealizeaz~prinmaimultemecanisme:
aldosteronul stimuleaz~ secre[ia de K+ de c~tre celulele principale ale tubului
colectorcortical#imedular
concentra[iadeNa+intraluminalreducereaacesteiasub15mEq/lreducer~spunsul
kaliureticlamineralocorticoizi,sc]z]ndsemnificativexcre[iadeK+sepr~bu#e#te
diureticeledeans~,celedetiptiazidic,inhibitoriideanhidraz~carbonic~#idiureti
celeosmoticeauefectkaliuretic,`ntimpcespironolactonaamiloridul#itriamterenul
determin~oeliminareredus~aionului.
aportuldeK+cre#tereaacestuiadetermin~stimulareasecre[ieiK+laniveltubular
echilibrulacidobazicsecre[iadeK+estestimulat~dealcaloz~#iredus~`nacidoz~
balan[adeMg+deple[iaacestuiion(diuretice,alcoolism,cetoacidoz~diabetic~)se
`nso[e#tededeple[iedeK+.

Calciul(Ca+)estecelmaifrecventcationbivalentalcorpului,reprezent]ndcirca2%
dingreutateacorporal~,fiindprezent`nlichideleextracelularecuoconcentra[iede10mg%
(5mEq/l).
Maipu[inde2%dinCa+filtratzilnicesteexcretatprinurin~.
Aproximativ 65% din Ca+ filtrat este reabsorbit la nivelul tubului contort proximal.
Aceasta se realizeaz~ pe baza unor gradiente elctrice #i chimice `n paralel cu Na+ #i ap~
(Hebert,1999).
`n ramul gros ascendent al ansei Henle se produce resorb[ia a circa 25% din
cantitateadeCa+filtrat~secundargradientuluielectric,dar#iaunormecanismeactivede
transport.
Lanivelulsegmentelortubularedistaleseproducereabsorb[iaactiv~acirca10%din
Cafiltrat.
Membranacelulelortubulareestepermeabil~laCa+,iarcompartimentulintracelular
este negativ electric (70 mV) fa[~ de spa[iul extracelular. Aceste mecanisme particip~ la
transportul ionilor de Ca+. La nivelul membranei bazolaterale exist~ #i Ca+ATPaza, care
contribuielatransportulactivalCa+,prinschimbcuNa+(Pitts,1974).
TransportuldeCa+estedependentdemaimul[ifactori:
Hormonulparatiroidian(PTH)esteprincipalulreglatoralexcre[ieideCa+.Elreduce
rata filtr~rii glomerulare #i cre#te reabsorb[ia acestuia `n special la nivelul ansei
Henle
VitaminaDlanivelrenalarelocactivareaacesteivitamineprintransformareaei`n
1,25 dihidroxiD3 care determin~ cre#terea reabsorb[iei de Ca `n segmentele
tubularedistale(Ganong,1977)
71

TratatdeUrologie

Volumullichidianextracelulardeoarecereabsorb[iadeCa+serealizeaz~`nparalel
cu cea a Na+, expansiunea volumului lichidian extracelular determin~ cre#terea
excre[ieiacestorioni
Diureticediureticeleosmoticedetermin~cre#eterea`nparalelaexcre[ieidedeNa+
#i Ca+ prin sc~derea reabsorbi[iei tubulare a acestora. Cele tiazidice determin~ o
cre#tere a Ca+ plasmatic ac[ion]nd asupra concentra[iei de Ca+ doar prin cuplarea
transportului acestuia cu Na+. Inhibitori de anhidraz~ carbonic~ inhib~ reabsorb[ia
tubular~f~r~acre#teexcre[iaurinar~deCa+.

Magneziulesteuncationbivalentpredominentintracelularcudistribu[ieprincipal~
la nivel osos #i `n [esuturile moi. El joac~ un rol metabolic important, activ]nd numeroase
enzime, inclusiv cele implicate `n metabolismul intermediar #i fosforilare. Concentra[ia
normal~plasmatic~deMgeste`ntre1,7#i2,3mg%.
Lanivelrenalseproduceultrafiltrareaa7080%dinMgplasmatic,restulfiindlegat
de albumin~ sau de alte proteine (Hebert, 1999). La nivel tubular se produce resorb[ia
acestuiaastfel:25%`nTCP,15%`npor[iuneadreapt~proximal~,65%`npor[iuneadreapt~
ascendent~ a ansei Henle #i 25% `n tubul distal. Similar calciului, reabsorb[ia de Mg se
realizeaz~`nparalelcuNa+#iCl,`nspecialdatorit~poten[ialelortransmembranare(Whang,
1985).

Fosfatul
Nivelulplasmatictotaldefosfatestede14mg%,dincarecelanorganicreprezint~3
4,5 mg% restul fiind reprezentat de complexe cu lipide sau alte substan[e. Circa 90% din
fosfatul anorganic plasmatic este ultrafiltrat la nivel glomerular, jum~tate din acesta fiind
subform~ionic~.80%dinfosfatulultrafiltratsereabsoarbelaniveltubular.
Reabsorb[ia se face p]n~ la o capacitate maxim~ de transport, excesul ajung]nd `n
urina final~. Circa 75% din resorb[ie are loc la nivelul TCP #i restul `n por[iunea dreapt~ a
acestuia.

Factoricareinfluen[eaz~excre[iadefosfatsunt:
PTHcre#tereaniveluriloracestuiascadereabsorb[iadefosfa[i`ntimpceparatiroi
dectomiaareroldestimulareaacestuia(Bushinsky#iLechleider,1987)
aportul de fosfat prin diet~ dup~ dep~#irea capacit~[ii maxime de transport,
excre[iaurinar~aacestuiacre#te
administrareadediureticecre#teeliminareafosfa[ilor.

Ureea rezultat~ din catabolismul proteic se filtreaz~ liber prin glomeruli #i se reab
soarbepasiv`ntrunprocentvariabillanivelultubuluicontortproximal(Grama,2004).
`nacestsegmentdetubsaureabsorbitactivomul[imedesolvi[i,careauatrasprin
osmoz~ #i apa corespunz~toare (la izotonicitate). Apare astfel o concentra[ie relativ mai
mare a ureei din tub fa[~ de cea din intersti[iu, cu difuziunea sa `n sensul gradientului de
concentra[iefenomenuldesolventdrug.
Procentuldeureereabsorbit~este foartevariabil(3090%)cudebitul#idensitatea
ultrafiltratului: la un debit mai mare #i densitate mai redus~ reabsorb[ia este mai mic~, #i
invers.`nmodnormalapare`nurinafinal~aprox.47%dinureeafiltrat~,cantitate aproxi
mativ egal~ cu cea care se produce `n organism, a#a `nc]t concentra[ia ei plasmatic~ se
men[ine laun nivel rezonabil. Por[iuneagroas~ a ansei Henle, tubulcontort distal #i tubul
colector `n zona sa cortical~ #i medular~ extern~ sunt impermeabile la uree. Dar `n

72

Capitolul2.Fiziologiaaparatuluiurogenital

por[iuneamedular~intern~,tubulcolectordevinepermeabillauree`nprezen[aADH.Fuga
apei din tub `n intersti[iul hiperosmolar este urmat~ de ie#irea ureei, care a ajuns prea
concentrat~ `n urin~. Ureea se acumuleaz~ `n intersti[iul medular intern datorit~ unui
mecanismdecontracurent`n vasarecta,carenu prea`ndep~rteaz~solvi[iidinintersti[iul
acestei zone. Ureea contribuie astfel la mecanismul de concentrare a urinei. O parte din
ureea din medulara profund~ intr~ `n por[iunea sub[ire a ansei Henle, fiind vehiculat~ din
noucuurina,pentruareie#ilanivelultubuluicolector(deciexist~orecirculareintrarenal~a
ureei,important~pentrumecanismuldeconcentrareaurinei).

Aciduluricesteunprodusdedegradarealpurinei.
Omul normal, supus unui regim alimentar lipsit de purine, elimin~ zilnic prin urin~
sub 590 mg acid uric, `n timp ce la un regim normal excre[ia zilnic~ este de 9001.000 mg
(Steele#iRieselbach,1975).
Studiilecuaciduricmarcatauprecizatc~2/33/4dintotalulaciduluiuricseelimin~
prinrinichi#irestulprinintestin,undeestedegradatsubac[iuneafloreibacteriene.
Concentra[iaplasmatic~aaciduluiuricestedeaproximativ4mg/100mllafemeie#i
5 mg/100 ml la b~rbat #i, deoarece pK acidului uric este de 5,75 la pH plasmatic de 7,40,
aproximativ 98% se afl~ sub form~ de urat. Este un acid slab, 98% fiind prezent ca urat
monosodic.Saturareaplasmeiaparelaoconcentra[iedeuratdeaproximativ6,57mg%.`n
modnormal,doar5%dinuratulplasmaticestelegatdeproteine.
Uratulestefiltratlanivelulglomerulului,reabsorbinduselanivelultubuluiproximal.
Prinmicropunc[iila#obolansaar~tatc~reabsorb[iaaciduluiuricpoateavealocpetoat~
lungimeanefronuluiproximal,dup~unelestudiirecenteexist]nddou~zonedereabsorb[ie
separatedeozon~desecre[ie,dup~al[iiav]ndlocoreabsorb[ie#isecre[ieconcomitentde
aciduric,f~r~separareafizic~aanumitorprocesedealungul`ntreguluinefron.Procesulde
transporttubularalaciduluiuric#i/sauura[ilornueste`nc~precizat,defaptnuse#tienici
m~cardac~sereabsoarbeaciduric,ura[isauambeleforme,darseadmitec~intervineun
mecanismactivmediatdeunc~r~u##iaraveaanumitecaracteristicicomunecureabsorb[ia
Na+. Secre[ia de urat poate ap~rea, de asemenea, la nivelul tubului proximal cu o rat~
propor[ional~cuconcentra[iaacestuia.Excre[iaurinar~deuratestemultsc~zut~dec~tre
inhibitoriaisecre[ieideurat(pirazinamid~).
Secre[iadeuratesteinfluen[at~de:
volumullichidelorextracelulareexcre[iadeuratestecrescut~`ncazulexpansiunii
lichidelorextracelularecaurmareafaptuluic~reabsorb[iacre#teodat~cucontrac[ia
volemic~#iscadeodat~cucre#tereavolumuluiacestora
pHulurinarsc~dereapHuluicre#tepropor[iadeaciduricneionozat,slabsolubil
(Emmett#icol.,1992)
altesubstan[epotinfluen[aexcre[iadeuratlanivelrenal:
Substan[e hiperuricemice se pot cita substan[e care inhib~ secre[ia: salicila[i
(dozesc~zute,510mg/dlser),pirazinamida,etambutolul,etanolul,furosemidul
etc.Deasemenea,sedescriu#isubstan[ecarestimuleaz~reabsorb[ia:diuretice,
intoxica[iacronic~cuplumbsaucuberiliu
Substan[e hipouricemice dintre substan[ele care inhib~ reabsorb[ia se pot
exemplifica: probenecidul, sulfinpirazona, salicila[ii (doze mari, mai mult de
15mg%`n ser),fenilbutazona,acidulascorbic(dozemari),manitolul,agen[iide
contrastradiologic.

73

TratatdeUrologie

Reabsorb[iaapeimecanismuldeconcentrare#idiluareaurinei
Selec[ia solvi[ilor micromoleculari dezirabili de cei indezirabili organismului a fost
posibil~numaivehicul]ndomarecantitatedelichidprintubiiuriniferi.
Dac~ am face o trecere `n revist~ cantitativ~ a volumelor de lichid care trebuie
epurate, am reaminti c~ lichidul extracelular are aprox. 15 litri, din care 3 litri sunt repre
zenta[ideplasm~(`ntreaceasta#ilichidulintersti[ialechilibr]ndusecontinuuconcentra[iile
tuturorsolvi[ilormicromoleculariprindifuziunetranscapilar~).Dincei3litrideplasm~,700
mltraverseaz~rinichii`nfiecareminut#i125ml/min.sefiltreaz~`nglomerul.Prinpasajul
repetatalplasmeipringlomerulisefiltreaz~zilnicocantitateenorm~deurin~primar~~180
litri,cifr~rezultat~dincalcule,pentruc~practicea`ntrececumultvolumultotaldelichideal
organismului,#i`nfaptaceea#iplasm~estefiltrat~#ireabsorbit~`nmodrepetat.
Diureza (debitul de urin~ final~) se m~soar~ mai frecvent #i mai comod pe durata
uneizile.Diurezafiind11,5litri/24ore`ncondi[iiobi#nuite,rezult~c~peste 99%dinapa
ultrafiltratuluisareabsorbit,ceeaceera#iimperiosnecesarpentrueconomiahidric~gene
ral~aorganismului.
Cantitatea de ap~ reabsorbit~ nu este fix~, ea se ajusteaz~ `ntre anumite limite `n
func[iedestareadehidratareaorganismului.`ncondi[iidenormohidratare,diurezaestede
11,5 litri/24 ore, dar `n condi[ii de deshidratare rinichiul economise#te apa `n organism,
reabsorbind 99,7% din apa ultrafiltratului #i reduc]nd pierderile la minimum posibil = 0,5
litri/24ore,cuacela#icon[inutdesolvi[i`ncantitateabsolut~,deciurinaesteconcentrat~la
maximum (1.200 mOsm/l). `n condi[ii de hiperhidratare, cantitatea de ap~ reabsorbit~ se
reduce la 88%, elimin]nduse din organism p]n~ la maximum 20 litri/24 ore, excret]nduse
deci o urin~ foarte diluat~ (70 mOsm/l), care con[ine aceea#i cantitate absolut~ de solvi[i,
darcareelimin~excesuldeap~dinorganism.
Tubul contort proximal este foarte permeabil pentru ap~. La nivelul s~u sau
reabsorbit(activ,secundaractivsaupasiv)omul[imedesolvi[i(electroli[i,glucoz~,amino
acizi,proteineetc.,dincare,`ntermendenum~rdeparticule,ceimainumero#isuntioniide
Na+ #i Cl). Sa creat astfel un gradient osmotic care determin~ reabsorb[ia a 65% din apa
urinei primare. Reabsorb[ia se face la izotonicitate, ultrafiltratul av]nd de la `nceput #i
p~str]ndu#i pe parcurs o presiune osmotic~ aproape identic~ cu cea a plasmei. Aceast~
cantitate mare de ap~ #i solvi[i este preluat~ de circula[ia peritubular~, care este foarte
bogat~`ncortical~.
Ramura descendent~ a ansei Henle este, de asemenea, foarte permeabil~ pentru
ap~,darimpermeabil~pentrus~ruri#ipu[inpermeabil~pentruuree.Lichidultubularintr~
`nansaHenleaproapeizotonic(320mOsm/l),dar,pem~sur~cecoboar~sprev]rfulansei,
pierde ap~, care iese datorit~ hipertonicit~[ii intersti[iului medularei, devenind #i el hiper
tonic(1.200mOsm/l).Astfelsereabsoarbe`nc~15%dinap~.
Ramura ascendent~ a ansei Henleeste impermeabil~ pentru ap~, pu[in permeabil~
pentru uree, #i permeabil~ pentru electroli[i. `n por[iunea groas~ a ramurii ascendente a
ansei Henle se produce un transfer activ de ioni de Cl, Na+ #i K+ din lumen `n intersti[iu,
neurmatdeie#ireaapei,ceeaceduceladiluareaurinei,careajunge`ncap~tulsuperioral
anseicuohipotonicitatede200mOsm/l.Totodat~,ioniitransfera[iactiv`nintersti[iusunt
ceicaredetermin~hipertonicitateacareaextrasapadinramuradescendent~aanseiHenle.
Tubulcontortdistalestedestuldeimpermeabilpentruap~,iarprincipaliielectroli[i
suntreabsorbi[iaiciactiv,subcontrolulaldosteronului(Na+,careatrage#iCl).Urinasemai
dilueaz~u#or`nprima jum~tateatubuluidistal(100mOsm/l),iarcantitateadeap~reab
74

Capitolul2.Fiziologiaaparatuluiurogenital

sorbit~estemic~`nc~5%dintotal.`ntubulcolectorurina`ntr~hipoton~100mOsm/l.
Epiteliul acestuia este impermeabil la ap~ #i numai prezen[a ADHului `l face permeabil la
ap~. Cantitatea de ADH secretat~ de nucleii supraoptici #i paraventriculari hipotalamici #i
eliberat~ de hipofiza posterioar~ este determinat~ mai ales de osmolaritatea lichidului
intersti[ial,apreciat~deosmoreceptoriiacestornucleisecretori(hipertonicitateadetermin~
cre#tereaeliber~riideADH),dar#idevolumulsangvin,apreciatdevoloreceptoriidinatrii#i
debaroreceptoriidejoas~presiunedinarterapulmonar~,venelecave(sc~dereavolemiei#i
apresiuniisangvinestimuleaz~eliberareadeADH).
Dac~ sa eliberat ADH, `n por[iunea cortical~ a tubului colector se mai reabsoarbe
10%dinap~,urinaajung]ndizoton~300mOsm/l.`npor[iuneamedular~atubuluicolector
semaipoatereabsorbimaxim4,7%dinap~,determin]ndantidiurezamaxim~(0,5litri/zi=
0,3%)#iaduc]ndurinalahipertonicitatemaxim~1.200mOsm/l.
#i`ntubulcolectorreabsorb[iaapeisefacetotprinosmoz~,datorit~hipertonicit~[ii
intersti[iului,maialesmedular.
Dac~nusaeliberatADH(hipotonicitateamediuluiinternsauhipervolemie),aceast~
ultim~ faz~ de reabsorb[ie a apei nu se face (dec]t `n foarte mic~ m~sur~, tubul colector
nefiind absolut impermeabil la ap~) #i se elimin~ cca 12% din filtratul glomerular, adic~
aprox.20litrideurin~/24ore.Urinahipoton~dela`nceputultubuluicolectordevine#imai
hipoton~ pe parcursul acestuia datorit~ reabsorb[iei active de Na+, `nc]t la cap~tul distal
poateaveaoosmolaritatede70mOsm/l=mecanismuldediluareaurinei.
Dac~es~c~ut~mcheiafenomenuluideconcentrareaurinei,atuncivomobservac~
primulsegmentaltubuluiurinifer`ncaresereabsoarbeap~f~r~reabsorb[iasolvi[ilor(deci
nulaizotonicitate)esteramuldescendentalanseiHenle.Aceast~reabsorb[ieaapeiareloc
prinfenomenuldeosmoz~,determinatdehipertonicitateaintersti[iuluimedularei,lar]ndul
eicreat~dereabsorb[iaactiv~aelectroli[ilor(Cl,Na+,K+),neurmat~dereabsorb[iaapei,ce
are loc `n ramul ascendent al ansei Henle. De asemenea o contribu[ie la hipertonicitatea
intersti[iuluimedularaduce#iureeareabsorbit~dintubulcolector#icare`nparter~m]ne
blocat~`nintersti[iu,`nparteesterecirculat~printubulurinifer.Formaparticular~aansei
Henle, de tub `n U, are o contribu[ie decisiv~, deoarece hipertonicitatea creat~ `n jurul
ramului ascendent este, de asemenea, plasat~ spa[ial `n apropierea ramului descendent.
Dac~celedou~bra[enuarfiparalele#iapropiateunuldealtul,#ideasemeneaparalele#i
apropiatedetubiicolectoridincaresereabsoarbeureea,hipertonicitateanuarextrageapa
dinramuldescendent.Acestmecanismdeconcentrareaurinei`nansaHenleaminte#tede
sistemul tehnic de multiplicare `n contracurent. Aceea#i hipertonicitate a intersti[iului
medular este cauza reabsorb[iei puternice a apei din tubul colector, `n prezen[a ADHului,
realiz]ndconcentrareafinal~,ajustabil~,aurinei.
Concomitent, o alt~ condi[ionare a concentr~rii urinei este conservarea hipertoni
cit~[iiintersti[iuluimedular.Aceastaserealizeaz~`nprimulr]ndpriniriga[iasangvin~mult
mairedus~amedularei`nraportcucorticala,ca#iprincurgereamultmailent~as]ngelui
prin vasa recta `n compara[ie cu vasele corticalei. `n acest fel sp~larea solvi[ilor din
intersti[iuestemultmai`ncetinit~.
`naldoilear]nd,vasarectaautotform~detuburiU,plasate`nparalel#iprintre
ansele Henle. `n ce prive#te schimburile de electroli[i, vasa recta func[ioneaz~ ca un
schimb~tor `n contracurent. `n ramul descendent s]ngele intr~ cu o presiune osmotic~ de
320 mOsm/l (provine din arteriolele eferente, `n care concentra[ia proteinelor este mai
mare).Pem~sur~cep~trunde`nmedularaprofund~,intersti[iulfiindtotmaihiperton,ionii
intr~`nvas,iarapaplasmeiiese`nintersti[iu,echilibr]ndusecontinuupresiuneaosmotic~a

75

TratatdeUrologie

plasmeicuceaalichiduluiintersti[ial;lav]rfulanseis]ngelearepresiuneaosmotic~de1.200
mOsm/l. Darpem~sur~ces]ngeleurc~ prin ramulascendent,electroli[iip~r~sescvasul#i
apaintr~`nvas,presiuneaosmotic~as]ngeluisc~z]ndcontinuu#iechilibr]ndusecuceaa
intersti[iului medularei externe; la p~r~sirea medularei s]ngele are o presiune osmotic~
aproapeegal~cuceadelaintrare.Aproapeto[iioniicareiesdinramulascendentintr~`n
ramuldescendent,deciparcurguncircuit`nmedular~,r~m]n]nd`naceast~zon~,`nlocs~
fie`ndep~rta[icus]ngelecirculant.Astfelsemen[inehipertonicitateamedularei.

Balan[ahidric~

Aportuldeap~
Apadinorganismprovinedindou~surse:apaexogen~,adus~dinmediulextern,#i
apaendogen~,produs~`norganismprinreac[iiledeoxidareanutrimentelor.
Apaexogen~provinedinlichideleingerate#idinalimentelesolide,carepotaveaun
procentfoartediferitdeap~.
Apaendogen~(aprox.300400ml/zi)#iapadinalimente(aprox.8001.000ml/zi)nu
suntvariabileimportante`nreglareaaportuluideap~.Numaiaportuldeap~consumat~ca
lichid,`nmedie12litri/zi,poatevariafoartemult,delamaipu[inde1litru/zila20litri/zi.
Deaceea,aportuldeap~estereglatmaialesprinreglareavolumuluidelichideingerate,prin
mecanismulsetei.
`ncondi[iideconforttermic#if~r~efortfizicsemnificativ,aportuldeap~aladultului
totalizeaz~2.1003.400ml/zi.

Elimin~riledeap~
Exist~5c~idepierdereaapeidinorganism:
prinaerulexpirat:400500ml/zi
prinperspira[ie(apacaredifuzeaz~prinpiele):400500ml/zi
printranspira[ie(pringlandelesudoripare):200ml/zi
prinfecale:100200ml/zi
prinurin~:1.0002.000ml/zi.
Valoriledatesuntvalabilepentruadultulaflat`ncondi[iideconforttermic,carenu
depuneefortfizicsemnificativ.
Totalulelimin~rilordeap~se`ncadreaz~`ntre2.1003.400ml/zi.Seobserv~c~acest
volumegaleaz~aportuldeap~.
Volumul de ap~ pierdut pe diverse c~i se poate modifica semnificativ `n anumite
condi[ii. Astfel, apa pierdut~ prin aerul expirat cre#te odat~ cu cre#terea debitului de aer
ventilat(efortfizic,polipnee`nst~rilefebrile).Apapierdut~printranspira[iepoateajungela
10litri/zi,dac~temperaturaambiental~estecrescut~sausedepuneefortfizicintens(prin
interven[iamecanismuluidetermoreglare).Reglareaelimin~rilordeap~,pentruamen[ine
echilibrat~balan[ahidric~,sefacemaialesprinreglareavolumuluideurin~,carepoatevaria
dela0,5litri/zilapeste20litri/zi.

Controlulbalan[eihidrice
Balan[ahidric~estecontinuuechilibrat~,a#a`nc]taportul#ielimin~riledeap~s~fie
egale. Aportul este modificat prin ajustarea cantit~[ii de lichide ingerate, sub controlul
mecanismului setei, iar elimin~rile sunt modificate prin ajustarea volumului urinar, sub
76

Capitolul2.Fiziologiaaparatuluiurogenital

controlulhormonuluiantidiuretic.At]tsetea,c]t#isecre[iadeADHseafl~subcontrolulunor
centrihipotalamici.Activareaprimar~acentrilorsetei(dinnucleiipreopticihipotalamici)#i
a neuronilor secretori de ADH (din nucleii supraoptici #i paraventriculari hipotalamici) se
realizeaz~`ndou~condi[ii:cre#tereaosmolarit~[iiLEC#isc~dereavolemiei.

Cre#tereaosmolarit~[iiLEC(produs~fieprin pierdereadeap~din organism,fie


prinlipsaaportuluide ap~, fie prinexcesuldeNa+#i Cl)reprezint~stimulul pentruosmo
receptoriicareintr~`ncomponen[aacestorcentrihipotalamici.HipertonicitateaLECinduce
osmozaie#ireaapeidincelule`nLECp]n~laegalizareaconcentra[ieisolvi[ilor`nceledou~
compartimente `nvecinate, av]nd drept consecin[~ mic#orarea volumului acestor celule
receptor.Caurmare,osmoreceptoriiseactiveaz~#idescarc~poten[ialedeac[iune.
Starea de excita[ie a centrilor setei se transmite prin anumite circuite la nivelul
scoar[eicerebrale,undeaparesenza[iacon#tient~desete#idetermin~ac[iunilemotoriide
c~utare#iingestiedeap~.
Starea de excita[ie a centrilor din nucleii supraoptici #i paraventriculari se concre
tizeaz~ `n transmiterea de impulsuri prin tractul hipotalamohipofizar c~tre neurohipofiz~,
de unde se descarc~, prin exocitoz~, moleculele de ADH stocate `n butonii terminali ai
acestoraxoni.Cantitateadehormondesc~rcat~estepropor[ional~cufrecven[aimpulsurilor
generatedeneuroniihipotalamici. Hormonulestepreluatdecircula[iaglandei#i,pecalea
circula[iei generale, ajunge s~ ac[ioneze pe organele [int~: rinichi (receptori V2) #i vase
sangvine (receptori V1). La nivel renal reduce diureza, concentreaz~ urina, return]nd astfel
unvolummaimaredeap~`nLEC.
Sc~derea volumului sangvin este perceput~ de receptorii de `ntindere situa[i `n
pere[iiatriilor(receptoridevolumreceptoridejoas~presiune)#iaisinusuluicarotidian#i
croseiaortei(receptoride`nalt~presiune)(Zerbe#iRobertson,1987).Reducereagraduluide
`ntindereapere[iloratriilor#ivaselormen[ionatedetermin~reducereafrecven[ei/suprima
rea impulsurilor generate de ace#ti receptori. C~ile aferente conduc aceste informa[ii `n
trunchiulcerebral,lacentriicardiovasomotori,caredeclan#eaz~reflexepresoare,dar#i`n
hipotalamus,undeseactiveaz~centrulsetei#inucleiisecretorideADH.R~spunsulvaconsta
`ningestiadeap~#ireducereapierderiideap~prinurin~,ambeleconduc]ndlacre#terea
volemiei.`nplus,prinac[iuneaputernicvasoconstrictoareaADHvasopresineisedetermin~
cre#tereapresiuniiarteriale.
`n condi[ii normale, setea #i secre[ia de ADH stau sub controlul osmoreceptorilor.
Ace#tireceptorisuntextremdesensibililacre#terifoartemicialeosmolarit~[iiLEC.Pragul
lordesensibilitateesteatinslaocre#tereaosmolarit~[iidoarcu1%(cre#tereaconcentra[iei
Na+ cu <2 mEq/l). Activarea centrilor setei determin~ ingestia de ap~. Volumul de ap~
ingerat este exact cel necesar pentru corectarea hipertonicit~[ii LEC (mecanism de
cuantificareincompletelucidat,dar`ncareseparec~seestimeaz~volumuldeap~ingerat
prinnum~ruldedegluti[ii#ipringraduldedistensiegastric~,ca#iprindispari[iasenza[ieide
usc~ciuneamucoaseicavit~[iibucale),`nc]taparesenza[iadesa[ietate,stingereasenza[iei
de sete. Astfel, nu se inger~ mai mult~ ap~ dec]t cea necesar~, nu exist~ riscul de
hiperhidratare,deinducereauneist~ridehipotonicitateaLEC.
`n condi[ii anormale, c]nd volumul plasmatic scade cu >10% (hemoragie, deshi
drataresever~,edemmasiv),receptoriide`ntinderedinsistemulcardiovascular(devolum#i
de presiune) sunt cei care se activeaz~ #i declan#eaz~ setea intens~ #i desc~rcarea
abundent~ de ADH (Robertson #i colab., 1976). Aportul unui volum mai mare de ap~,
reducereadrastic~adiurezei#ivasoconstric[iaputernic~#iprelungit~reu#escs~redreseze
semnificativpresiuneaarterial~.Ac[iuneavasoconstrictoareavasopresineiestemaiintens~
77

TratatdeUrologie

dec]t cea a angiotensinei. Importan[a interven[iei vasopresinei `n hemoragiile mari este


semnificativ~: ea redreseaz~ 75% din c~derea presiunii arteriale, men[in]ndo la o valoare
eventual suficient~ pentru o perfuzare cerebral~ satisf~c~toare. Deci are valoare `n
supravie[uirea pe termen scurt/mediu `n hemoragiile acute mari. De altfel, prin mecanism
feedbackpozitiv,angiotensinaareefectdirectdestimulareacentruluisetei#ianeuronilor
secretorideADHvasopresin~.
De#iosmoreceptoriisuntmaisensibilidec]tvolo#ibaroreceptorii`nactivareasetei
#iasecre[ieideADH,r~spunsullaactivareaultimilorestemaiputernic.Dac~celedou~tipuri
de stimuli ac[ioneaz~ `n opozi[ie, r~spunsul la volo #i baroreceptori primeaz~ asupra
r~spunsuluilaosmoreceptori.Astfel,laopr~bu#ireavolemiei#iapresiuniiarteriale,centrii
setei #i desc~rcarea de ADH se activeaz~ puternic, chiar `n condi[ii de hipotonicitate.
Corectareavolemiei#iapresiuniiarterialeprimeaz~asupracorect~riitonicit~[ii.
Estedenotat#iac[iuneaaltorcondi[iisausubstan[efarmacologiceasupracentrilor
setei #i a secre[iei de ADH, `n afar~ de osmo, baro #i voloreceptori (Zerbe #i Robertson,
1987).Astfel,efectestimulatoareasuprasecre[ieideADHmaiau:senza[iadegrea[~,dure
rea,emo[iile,stresul,nicotina,angiotensinaII,agen[iicolinergici,barbituricele.Efecteinhibi
toare asupra secre[iei de ADH au: etanolul, fenitoina. Efecte stimulatoare asupra centrului
seteiauangiotensinaII,agen[iicolinergici,barbituricele.

Balan[adesodiu

Aportuldesodiu
Const~ din sodiul con[inut `n alimente #i ap~. `n medie, un adult inger~ 100400
mmol Na/zi, dar aceast~ cantitate poate varia de la 10 nmol/zi, `n regimurile alimentare
hiposodate, la 600 nmol/zi, `n cazul celor care obi#nuiesc s~ m~n]nce mai s~rat. Exist~ #i
variabilitate`ncon[inutuldesodiualproduseloralimentarevegetale#ialapei,`nfunc[iede
zonageografic~,caracteristicilechimicealesolului.
`nregnulanimalexist~uncontrolalaportuluidesodiu(apetitselectivpentrusodiu),
deexemplulaoaie,darlaomacestmecanismnuapututfidemonstrat.Sepoateasumac~
praguldesensibilitatepentrugustuls~ratnuestelaacela#inivellato[ioamenii,#iceicuun
pragmairidicatadaug~sare`nexces`nalimente.Darseadmite#iexisten[aunorobiceiuri
alimentare diferite sau conservarea alimentelor cu exces de sare la anumite grupe de
popula[iecarenudispundealtemijloacedeaconservaalimentele.

Elimin~riledesodiu
Sodiul se elimin~ din organism pe trei c~i: urin~, secre[ie sudoral~ #i fecale; prima
caleesteceapredominant~.
Excre[iasodiuluiprinsecre[iasudoral~variaz~`nfunc[iedevolumulacesteia(cre#te
`n mediul ambiental cald, `n efort fizic) #i de adaptarea individului la mediul cald (concen
tra[ia sodiului scade `n secre[ia sudoral~ a celor adapta[i, prin cre#terea secre[iei de
aldosteron).Astfel,elimin~riledesodiuprintranspira[iepotficantitativneglijabilelapersoa
nele aflate `n repaus fizic #i `ntrun mediu ambiant rece sau cu temperatur~ de confort
termic, #i pot cre#te la c]teva sute de mmol/zi la persoanele neadaptate la cald, aflate `n
mediucald,eventualcuasociereadepuneriiunuiefortfizicintens.
Prinfecale,sodiulseelimin~`ncantit~[ineglijabile`ncondi[iinormale.Numai`nst~ri
patologice(diaree)pierdereadesodiupoatecre#tep]n~la1.000mmol/zi.
`nconcluzie,`ncondi[iinormale,sodiulseelimin~predominantprinurin~,`nmedie
100400mmol/zi.
78

Capitolul2.Fiziologiaaparatuluiurogenital

Controlulbalan[eisodiului
Deoareceaportuldesodiunuestereglatlaom(de#ianalizatorulgustativexercit~un
oarecare control), doar elimin~rile de sodiu pot fi reglate, pentru a echilibra balan[a de
sodiu.
Controlul elimin~rilor se realizeaz~ major la nivel renal, #i, `n mai mic~ m~sur~, la
nivelulglandelorsudoripare#isalivare.
Exist~ trei mecanisme reglatoare ale excre[iei de sodiu: mecanismul ADH centrul
setei,aldosteronulADS,angiotensinaII(AII).

MecanismulADHcentrulsetei.Acestmecanismsemanifest~lacre#tereaapor
tuluidesodiu.

Verigilefiziologicesunturm~toarele:cre#tereaaportuluidesodiudetermin~cre#te
rea osmolarit~[ii LEC, ceea ce determin~ activarea osmoreceptorilor din centrul setei #i
centriihipotalamicisecretorideADH.Activareacentrilorseteidetermin~ingestiadeap~,iar
ADH cre#tereabsorb[iaapei `n tubul colector. Se ajunge la cre#terea volumului plasmatic,
sangvin#iapresiuniiarteriale.
Dac~ presiunea arterial~ a crescut peste 160 mmHg, se dep~#e#te mecanismul de
autoreglareacircula[ieirenale#icre#teratafiltr~riiglomerulare#i,consecutiv,diureza.Se
elimin~ astfel excesul de sare #i ap~ din organism, se corecteaz~ presiunea arterial~ #i
osmolaritatea. Importan[a acestui mecanism de reglare reiese #i din experimentul `n care
blocareasistemuluiADHcentrulsetei,`nparalelcucre#tereaaportuluidesare,determin~
cre#terea drastic~ a natremiei. Prin contrast, cu acest mecanism operant, natremia se
men[ineremarcabildeconstant~,`nciudacre#teriimarcateaaportuluidesare.

ADS, hormon steroid produs de zona glomerular~ a corticosuprarenalei CSR,


esteimplicatsemnificativ`ncontrolulbalan[eidesodiu.
Sc~dereaaportuluidesodiuareunefectdirect,darnufoarteputernic,asupraCSR,
decre#tereasecre[ieideADS.Ac[iuneaADSasupratubuluicontortdistal#icolectorconst~
`n cre#tereareabsorb[ieidesodiu,maipu[inurmatdeap~(tubulcontortdistalestepu[in
permeabillaap~),ceeaceducelacorectarea,`nsensulcre#terii,anatremiei.
CSRmaiestestimulat~s~secretecantit~[icrescutedeADSdec~tre:cre#tereaAII,
sc~dereaANF,cre#tereapotasemiei,cre#tereaniveluluiplasmaticdeACTH.Dintreace#tia,
maisemnificativ~estecre#tereapotasemiei,av]ndcaefectreglatorcre#tereaexcre[ieideK
`nurin~.`ns~ultimeletreimecanismeintervin`naltecircumstan[e,nu`nsitua[iac]ndscade
natremiaprinsc~dereaaportuluidesodiu.
Formarea de A II cre#te c]ndscade natremia. Concentra[ia de Na+ sc~zut~ #i `n
urna primar~ va conduce, dup~ absorb[ia obligatorie de Na+ din tubul contort proximal #i
ansa Henle ram ascendent, la apari[ia, `n tubul urinifer din structura aparatului juxta
glomerular,auneiurinecuconcentra[iepreamic~desodiu.Aceastastimuleaz~eliberarea
derenin~,cre#teformareadeAII,careareefectdirectasupratubilorproximalidecre#terea
areabsorb[ieidesodiu(Liu#iCogan,1987),dar#iefectindirect,princre#tereasecre[ieide
ADS,care,lar]nduls~u,stimuleaz~reabsorb[iadesodiu.Astfelsecorecteaz~hiponatremia
`nsensulcre#teriiconcentra[ieisodiului`ns]ngesprevaloareanormal~.Insuficien[aCSR,cu
hiposecre[ie de A ADS (boala Addison), se manifest~ cu hiponatremie, ceea ce conduce la
hipovolemie,hipotensiunearterial~,chiarp]n~lalipotimie.

79

TratatdeUrologie

Echilibrulacidobazic
Generalit~[i
Men[inerea pHului mediului intern `ntre 6,8 #i 7,4 (16016 mEq/L de H+) este o
condi[ie esen[ial~ pentru desf~#urarea proceselor biologice normale, celulele organismului
fiind foarte sensibile la varia[iile de pH. Controlul pHului sangvin dispune de mecanisme
fiziologiceeficientecareneutralizeaz~continuuagresiuneaacizilor#ibazelorprovenitedin
metabolismulcelularsaudinaportulexogen.
Acizii sunt substan[ele care aduc un aport de H+ fluidelor organismului, iar bazele
sunt cele care consum~ H+. Aceast~ balan[~ acidobazic~ este men[inut~ prin interven[ia
sistemelortamponintra#iextracelulare,`ncarer~spunsulrespirator#imecanismelerenale
ocup~unrolcentral.

Distribu[iasistemelorcelularetampon
Cre#terea acidit~[ii determin~ ini[ial o distribu[ie a ionilor de H+ `n lichidul extra
celular(LEC),unde45%sunttampona[ideHCO3`nprimele30minute(DuBose,2000).
Totu#i, atunci c]nd acest sistem tampon rapid este insuficient, intervine un sistem
tamponadi[ionallanivelintracelular.Pondereatamponamentuluiintracelularpoatecre#te
p]n~ladublulceluiextracelulardac~`nc~rcareaacid~estepersistent~.(Schwartz,1957).
`n cadrul acestui sistem, osul reprezint~ un sistem tampon intracelular major, de
aceeaacidozacre#teresorb[iaosoas~cupierdereacalciului#ipotasiului,iartamponamentul
necesit~untransporttransmembranardeNa+,K+#ischimbulclorbicarbonat(Hamm,1992).

Compensa[iarespiratorie
Principalii constituen[i ai dietei sunt carbohidra[ii #i lipidele. C]nd perfuzia tisular~
este adecvat~, cu aport suficient de O2 #i prezen[a insulinei, carbohidra[ii #i lipidele sunt
metabolizate`nCO2#iH2O.`ntimpuluneizile,1520molideCO2suntgenera[iprinacest
proces. CO2 constituie componenta volatil~ acid~ av]nd capacitatea de a genera H+ prin
combinareacuH2O.Aceast~cantitatemaredeCO2esteeliminat~prinpl~m]nif~r~amodi
ficaechilibrulacidobazic.
Sc~dereapHuluisangvin`ntimpul`nc~rc~riiacidestimuleaz~chemoreceptoriicare
controleaz~respira[ia(KazemiH,Hitzig,1992) Acestprocescompensator,caredureaz~14
ore,determin~cre#terea ventila[ieialveolare#isc~derea PCO2 cuaproximativ1,25 mmHg
pentru fiecare sc~dere a HCO3 cu un mEq/l, `n a#a fel `nc]t raportul HCO3/ CO2 s~ se
normalizeze(Bushinsky,1982).
Respira[iacompensatorienupoateasiguraechilibrulacidobaziclao`nc~rcaremeta
bolic~ mare cu acizi, motiv pentru care este necesar~ interven[ia altor mecanisme `n care
rinichiulde[inerolulprincipal.
Acizii care nu sunt deriva[i prin hidratarea CO2 sunt denumi[i acizi nevolatili (ex.
acidullactic)#irezult~`nspecialdinmetabolismulaminoacizilor.Opartedintreace#tiacizi
nevolatilisuntneutraliza[idebicarbonatulcarerezult~dinmetabolismulaspartului#igluta
matului. Sisteme tampon extracelulare #i intracelulare contribuie la neutralizarea ionilor
aciziingera[isausintetiza[i`norganism.
Sistemultamponbicarbonat
Unul dintre cei mai importa[i parametri fiziologici, pHul sangvin (7,357,45), este
determinat de rela[ia dintre HCO3 #i PCO2 `n conformitate cu ecua[ia Henderson
80

Capitolul2.Fiziologiaaparatuluiurogenital

Hasselbach:

0,03=coeficientuldedifuzieaCO2`nplasm~

`naceast~reac[ie,bicarbonatulcasistemtamponarelabaz~ionulbicarbonatHCO3
care func[ioneaz~ ca acceptor de protoni H+, deci ca o baz~ #i acidul carbonic H2CO3, ca
donor de protoni. Rela[ia dintre componentele sistemului tampon bicarbonat poate fi
exprimat~`ntermeninonlogaritmicidup~cumurmeaz~:

UndepentruunpH=7,4;H+=40mmol/L;PCO2=40mmHg;HCO3=24mM(Blumfeld
#iVaughan,2003).
Ocaracteristic~important~aacestuisistemtamponestefaptulc~men[inereacon
centra[iei componentelor se face independent: concentra[ia HCO3 este men[inut~ la 24
mmol/dldec~trerinichi,iarPCO2estemen[inut~la40mmHgprinmecanismcompensator
lanivelulpl~m]nilor.PentrufiecareiondeH+secretatdetubiirenali,omolecul~deHCO3
estereabsorbit~#ise`ntoarce`nLEC.Dup~cetotbicarbonatulfiltratafostreabsorbit,este
regenerat~ocantitatesuplimentar~debicarbonatdac~excre[iaH+continu~.
Aproximativ1.200mmoldeCO2suntprodu#izilnicprinmetabolismulcarbohidra[ilor
#i lipidelor alimentare. Acest CO2 este transportat la pl~m]ni sub form~ de carboxihemo
globin~ #i hemoglobin~ generatoare de bicarbonat, unde este eliminat prin respira[ia
alveolar~`na#afel`nc]tPCO2estesc~zut~prinhiperventila[ie#icrescut~prinhipoventila[ia
(Rose,2000).

Participarearinichiuluilahomeostaziaacidobazic~
Echilibrul acidobazic al umorilor oganismului este controlat de rinichi prin modi
ficarearaportuluidintresecre[iadeH+#ireabsorb[iaregenerareadeHCO3,elimin]ndacizi
alc~rorpHvariaz~`ntre4,5#i8`nfunc[iadeizohidrie.
`n condi[ii fiziologice, rinichii trebuie s~ excrete excesul de H+ legat de acizii tari
nevolatili#is~recuperezeaproape`ntotalitateHCO3dinfiltratulglomerular#inumaifoarte
rartrebuies~intervin~pentrucorectareaunuiexcesdebaze,elimin]nd`nurin~cantit~[ile
excedentare de HCO3 #i recuper]nd H+. Men[inerea `n limite normale a echilibrului acido
bazic este rezultatul corel~rii permanente #i adecvate a secre[iei de H+ cu reabsorb[ia de
HCO3(Geavlete,2003).
Produc[iazilnic~dehidrogenioni,caredepindedealimenta[ie,estelaadultdeapro
ximativ1mEq/kgc(Harrington,1970).Excre[iaH+esteefectuat~derinichi.Darinterven[ia
mecanismelorrenale`mpotrivaacidozeinuesteimediat~.Sistemeletamponintracelulare#i
extracelulare ocup~ un loc primordial, asigur]nd neutralizarea rapid~ a sarcinii acide, cu
producereauneicantit~[icrescutedeCO2,carevafieliminatprinhiperventila[iealveolar~.

81

TratatdeUrologie

Rinichiulintervine,`nmodsecundar,pentrucorectareadezechilibruluiacidobazicprinrege
nerareabicarbonatuluiutilizat,cumen[inereaconstant~aconcentra[ieiacestuia`nlichidul
extracelular#icontrolulpHului.
Metaboli[iiacizinevolatiliproveni[idindietaalimentar~saudinmetabolismulcelular
(fosfa[ii,sulfa[ii#ial[iaciziorganici)trebuieelimina[iprinurin~,pentrumen[inereahomeo
staziei acidobazice. Transportul lor de la celule la rinichi se face sub form~ tamponat~ cu
Na+.Lanivelultubilorrenaliace#timetaboli[iacizisuntelimina[i,iarNa+#i,secundaracestu
ia,HCO3suntreabsorbi[idatorit~secre[ieitubularedeH+.
Pentrumen[inereaechilibruluiacidobazic,excre[iaacid~renal~trebuies~fieegal~
cu acizii nevolatili produ#i sau ingera[i (normal: 50100 mEq/24 ore). Acest echilibru se
p~streaz~prinfunc[iarinichiuluideasecretaioniideH+,prinmecanismelecareconcur~la
reglareaconcentra[ieibicarbonatuluiextracelular#iexcre[iaexcesuluidebaze.Mecanismul
carest~labazacelortreiproceseestereabsorb[iaNa+`nschimbulsecre[ieiK+(Blumfeld#i
Vaughan,2003).

Excre[iaacid~net~

Rinichiulesteresponsabildeexcre[iaa50100mEqaciziprodu#izilnicdeorganism#i
de recuperarea bicarbonatului filtrat. Ambele procese se realizeaz~ prin secre[ia H+ din
celuleletubulare`nlumentubular.Procesularelocpredominant`ntubiicontor[iproximali
(8090%dintotal),restulH+fiindsecreta[i`nanseleHenle#itubiicontor[i.H+provinedin
disocierea apei sau a H2CO3, rezultat din CO2, produs prin metabolismul celular sau extras
dins]nge.Anhidrazacarbonic~esteenzimacarecatalizeaz~formarea#idisociereaionic~a
H2CO3 cu formarea H+. Genera[i `n celulele tubulare, ionii de H+ sunt secreta[i activ `n
lumenultubularprinschimbcuNa+;pentrufiecareH+secretatestereabsorbitunNa+,dea
lungul unor gradiente electrochimice #i de concentra[ie; concomitent cu Na+, se resoarbe
pasiv #i un HCO3. Secre[ia de H+, maxim~ `n tubii proximali, continu~ #i `n tubii distali #i
colectori,ajung]nd,atuncic]ndpHurinaraatinsvaloareaminim~de4,5limitacapacit~[ii
tubularedeasecretaH+laoconcentra[ieurinar~de800orisuperioar~celeidinlichidele
peritubulare.
Dac~ nu ar exista tampoanele din lichidul tubular care s~ lege H+ secreta[i, capaci
tatea maxim~ tubulocitar~ de a secreta H+ ar fi atins~ rapid #i secre[ia ar `nceta. Dar
prezen[a`nultrafiltratabicarbonatului#iafosfatuluidisodic#iamoniogenezatubulocitar~
permit tamponarea imediat~ a H+, pe m~sur~ ce sunt secreta[i `n lumen, concomitent cu
transportul`nsensinversalNa+#ialHCO3.Excre[ianet~aH+`nurin~poatefiexprimat~
prinrela[ia:[aciditatetitrabil~+amoniurie]bicarbonaturinar(Gennari#iMaddox,1992).
Factorii care influen[eaz~ secre[ia acid~ sunt concentra[ia intraluminal~ de HCO3;
volumul lichidului extracelular, K+, CL; concentra[ia peritubular~ a HCO3, PCO2 #i pHul;
aldosteronul;angiotensinaII;parathormonul;factoriiadrenergici;peptidulatrialnatriuretic.
Concentra[iaintracelular~crescut~deH+stimuleaz~activitateaH+ATPazei.
Factorulprimordialcareinfluen[eaz~secre[iadeH+lanivelulnefronuluiestemodifi
careaechilibruluiacidobazicsistemic.Astfel,acidozaprodus~prinsc~dereaconcentra[ieide
bicarbonat `n plasm~ sau cre#terea concentra[iei PCO2 au ca rezultat cre#terea pHului
celuleinefronului#iapari[ia unuigradientcelul~fluidtubular care stimuleaz~ secre[iaH+de
alungul`ntreguluinefron.
`nmodinvers,alcalozainhib~secre[iadeH+(Hernandez,1987).

82

Capitolul2.Fiziologiaaparatuluiurogenital

Reglareaconcentra[ieibicarbonatului

Cele trei mecanisme care regleaz~ cancentra[ia bicarbonatul sunt: 1) reabsorb[ia


bicarbonatuluifiltrat;2)regenerareabicarbonatuluiprinexcre[iaacidit~[iititrabile;3)rege
nerareabicarbonatuluiprinexcre[iadeamoniac.

Reabsorb[iabicarbonatului
M~surareasimultan~aFG#iaconcentra[ieiplasmatice#iurinareaHCO3apermis
calcululcantit~[ilorfiltrate,reabsorbite#iexcretatedeHCO3.Laindividulnormalcuorat~a
filtr~rii glomerulare de 180 l/24 ore, cu un nivel al bicarbonatului seric de 24 mEq/l se
filtreaz~zilnic4.300mEqdeHCO3,dincaredoar0,1%sereg~sesc`nurinanormal~excre
tat~. Bicarbonatul este recuperat `n propor[ie de 80% la nivelul tubului contort proximal
printrun proces activ, mediat de H+ ATPaz~, de schimb `ntre ionii de H+ #i Na+ sub
controlul anhidrazeicarbonice (Cogan, 1981). Restul bicarbonatului filtrat care asc~pat de
reabsorb[ialanivelultubuluicontortproximalvafireabsorbitlanivelulanseiHenle#itubii
contor[i distali prin acela#i mecanism, dar care nu necesit~ prezen[a anhidrazei carbonice
(Gennari#iMaddox,1992).`nfinal,bicarbonatulfiltratestereabsorbit`npropor[iede99,9%
dea lungul tubilor uriniferi la concentra[ii plasmatice ale HCO3 sub 2628 mmol/L; peste
aceast~valoare(pragulrenalalbicarbonatului),reabsorb[iaHCO3estelimitat~#iconstant~,
egal~cu28mmolperlitrudefiltratglomerular,excedentulfiindexcretat`nurin~.
Laom,`ncondi[iinormale,bicarbonatulfiltratestereabsorbitaproape`n`ntregime,
deoarecepragulplasmaticestediscretsuperiorconcentra[ieiplasmaticenormaleaHCO3.`n
pofida reabsorb[iei `ntregii cantit~[i de HCO3 ultrafiltrat (4.300 mEq), acidoza metabolic~
apare dac~ bicarbonatul consumat pentru tamponarea acizilor nevolatili puternici nu este
regeneratconstant(DuBose,2000).
Reabsorb[ia tubular~ a HCO3 depinde de anhidraza carbonic~ (CA), o enzim~ care
ac[ioneaz~`nurm~toareareac[ie:

CA
CO2+H2OH2CO3

Anhidrazacarbonic~nuinfluen[eaz~transformareaaciduluicarbonic`nHCO3#iH+:

+
H2CO3 HCO3 +H

Aceast~etap~estespontanrapid~.Seconsider~c~CAfaciliteaz~conversiareversi
bil~ a CO2 `n HCO3. Se cunosc mai mul[i inhibitori ai CA, dintre care cit~m acetazolamida.
Inhibi[iaanhidrazeicarbonicereduceratasecre[ieiH+la80%dinvaloareaeinormal~(Cogan,
1979).
Se descrie urm~torul mecanism al reabsorb[iei bicarbonatului: Na+ difuzeaz~ pasiv
dinlumenultubular`ncelulatubular~pebazagradientuluielectrochimie;Na+esteexpulzat
dincelul~`nlichidulperitubulargra[ieuneipompecepermiteconservareauneiconcentra[ii
intracelulareredusedeNa+.
H+trecedincelul~`nlumenultubular`mpotrivagradientuluielectricprinmecanism
activ. `n lumenul tubular H+ se combin~ cu HCO3 spre a forma acidul carbonic, care se
descompune`nap~#ibioxiddecarbon.`ncelulatubular~,CO2formeaz~onou~molecul~
deH2CO3prinac[iuneaAC.Acidulcarbonicsetransform~`nH+destinattrecerii`nlumenul
tubular#i`nHCO3cedifuzeaz~pasivsprelichidulperitubular.
83

TratatdeUrologie

`n lumenul tubular HCO3 este reabsorbit indirect prin conversie `n CO2. Schimbul
Na /K prin membrana luminal~ pare a fi elementul central al reabsorb[iei bicarbonatului,
dartermenuldeschimbnuarimplicadec]tdou~deplas~rilegatedeuntransportorcomun.
InhibitoriiCAreduccantitateadeionideH+forma[i`ncelulatubular~,diminueaz~secre[ia
deH+`nlumenultubular#ireabsorb[iaNa+`ncelul~.Acetazolamidacre#teexcre[iaurinar~
aHCO3#iaNa+,`nfelulacestaalcalinizeaz~urina#icre#tediureza(Rose,1989).
Studiile prin micropunc[ii au concluzionat c~ reabsorb[ia HCO3 este efectiv conse
cin[asecre[ieiH+:
+

1.Lanivelultubuluicontortproximal(TCP),90%dinHCO3filtratestereabsorbit,dar
concentra[iaHCO3`nlichidultubularr~m]nedeaproximativ10mEq/L.pHultubularscade
moderat(varia[iadepH=0,20,3)`nTCP,m~rturiefiindacidifierealocal~aurinei.Anhidraza
carbonic~,situat~`nmarginea`nperieamembraneiluminale,`mpiedic~acumulareaH2CO3
`nlumenultubular.

2. 10% din HCO3 filtrat este reabsorbit `n canalul colector #i tubul contort distal
(TCD);totbicarbonatulr~mas`nfluidultubularpoatefireabsorbitdac~concentra[iaHCO3
plasmaticestesc~zut~saunormal~.Acidifiereanet~aurineiseproduce`ncanalulcolector;
pentruasecretaH+contraunuigradientcresc]nd,trebuieimaginatc~schimbulNa+/H+este
cuplat str]ns, `n sf]r#it, `n TCD, anhidraza carbonic~ nu este prezent~ la polul luminal al
celuleitubulare.
3. Acidifierea lichidului din ansa Henle este discutat~, demonstrat~ de Rector, dar
neacceptat~deGottschalk.

Mul[i factori sunt capabili s~ modifice reabsorb[ia tubular~ a HCO3 (modific]nd


pragulrenalalbicarbonatului):

a.Volemia.Sc~dereavolemieieste`nso[it~decre#tereareabsorb[ieiapei#isodiului,
pec]ndexpansiuneavolemic~areefectopus.Deoareceaproximativ25%dinsodiulfiltratse
reabsoarbe`nTCP`mpreun~cubicarbonatul,estelogiccafactoriiceinfluen[eaz~transpor
tulsodiuluis~aib~unefectsimilarasuprareabsorb[ieiHCO3.

b.Concentra[iaplasmatic~aClnuexercit~unrolindependentasupraregl~riidirecte
areabsorb[ieiHCO3,modific~rilevolemieiafect]ndreabsorb[iaHCO3independentdemodi
fic~rile concentra[iei plasmatice. M~surarea direct~ a transportului HCO3 `n TCP arat~ c~
acestadepindedeconcentra[iaNa+,darnu#ideconcentra[iaCl.Constatareac~expansiu
nea volemic~ izoton~ corecteaz~ alcaloza metabolic~ confirm~ faptul c~ volemia #i nu
concentra[iaClestedeterminantulcriticalreabsorb[ieiHCO3`nTCP.
De#i este pu[in probabil ca deple[ia cloremic~ s~ creasc~ reabsorb[ia HCO3 `n TCP
prin efect direct, totu#i contribuie probabil la men[inerea alcalozei metabolice printrun
efect hemodinamic important. Hipocloremia produce cre#terea eliber~rii de renin~ (chiar
f~r~ deple[ie volemic~) #i `n acest mod stimuleaz~ produc[ia de AT II, care prin vaso
constric[ie scade FG. Reducerea FG `n condi[iile alcalozei metabolice previne cre#terile
importantealeHCO3filtrat,caredep~#e#tecapacitateaTCPdealreabsorbi.`nacestmod,
hipocloremiapoatemen[inealcalozametabolic~prinefectulindirectpeFG.

c.Filtratulglomerular#icantitateafiltrat~debicarbonat.Modific~rileHCO3filtratau
carezultatschimbareapropor[ional~areabsorb[ieiacesteia.FGnuesteunregulatorinde
pendent al reabsorb[iei HCO3, dar influen[eaz~ reabsorb[ia acestuia prin efectul asupra
cantit~[ii filtrate de HCO3. La pH sangvin constant, reabsorb[ia HCO3 depinde separat de
fiecaredeterminantals~uFG#iHCO3sangvin.
84

Capitolul2.Fiziologiaaparatuluiurogenital

d. Presiunea par[ial~ a CO2 din s]nge influen[eaz~ reabsorb[ia HCO3. Hipocapnia


scade reabsorb[ia HCO3, pe c]nd hipercapnia o cre#te. Modific~rile pCO2 sangvin exercit~
influen[easuprareabsorb[ieiHCO3#iprinefectehemodinamice.Hipercapniaacut~produce
vasodilata[ie#isc~dereaFG,cucre#tereamarcat~areabsorb[ieiHCO3peunitateadeFG,
Dac~sc~dereaFGesteprevenit~,hipercapniaacut~areunefectfoartereduspereabsorb[ia
HCO3. Modific~rile tensiunii C02 sangvin influen[eaz~ reabsorb[ia HCO3 prin dou~ meca
nisme:
modificareapHuluiextracelular,curepercusiuniasuprapHuluicelular
efectulhemodinamicalhipercapniei.
e. Potasiul. Deple[ia potasic~ este `nso[it~ de alcaloza metabolic~. Pitts consider~
concentra[iaK+dinceluleletubularecapeunfactorcriticcecontroleaz~reabsorb[iaHCO3;
caren[a `n K+ (pierderi digestive sau hiperaldosteronism) ar domina concentra[ia intracelu
lar~aacestuication#iarcre#tepeceadeH+,ceeacearducelacre#tereasecre[ieiH+#ia
reabsorb[iei HCO3. Trebuie remarcat c~ `n aceast~ situa[ie urina este acid~, de#i nivelul
plasmaticalHCO3esteridicat(Blumfeld#iVaughan,2003).
Dup~ Schwartz, 4/5 din Na+ filtrat este reabsorbit `mpreun~ cu Cl, restul fiind
reabsorbitlaschimbcuK+.Lasubiectulhipcloremic,ofrac[iecrescut~dinNa+filtrattrebuie
conservat~princre#tereaschimbuluicationic;at]ttimpc]tdeficituldeClpersist~,schimbul
Na+/K+ #i Na+/H+ este crescut #i reabsorb[ia HCO3 ridicat~, men[in]nd alcaloza. Corectarea
deficituluideclorpermitereparareaalcalozei#iadeple[ieipotasice.
f.Anhidrazacarbonic~.ScindareaH2CO3`nH20#iCO2sarproducefoarte`ncetdac~
CA ar lipsi din marginea `n perie a celulelor TCP. `n absen[a CA, secre[ia H+ ar produce un
excesdeH2C03,careardezechilibrapHul.Enzimacatalizeaz~nunumaiscindareaH2C03,ci
faciliteaz~ #i difuziunea CO2 prin membrana luminal~, din lumen `n celula tubular~. Prin
aceste efecte, concentra[ia H2CO3 din lumenul TCP se men[ine la nivel sc~zut. Ca urmare,
concentra[iaH+`nlumenultubularestemen[inut~lanivelsc~zut,minimaliz]ndgradientulde
pH generat de secre[ia continu~ de H+ `n lumenul tubular. `n concluzie, CA permite
reabsorb[iauneimaricantit~[ideHCO3(prinsecre[iaH+)cumodific~riminimealepHului
dinTCP.
g. Factorii urinari exercit~ un rol minor `n reabsorb[ia HCO3 la nivelul TCP. Dintre
ace#tifactorimen[ion~m:calcemia,PTHseric,vitaminaD,hormoniitiroidieni,glucoza.PTH
scadereabsorb[iaproximal~abicarbonatului.AdministrareavitamineiDproducecre#terea
concentra[ieiplasmaticeaHCO3prinefecterenale#iextrarenale.

Regenerareabicarbonatuluiprinexcre[iadeaciditatetitrabil~
Aciditateatitrabil~reprezint~cantitateadebazecareartrebuiad~ugat~`nurinadin
24deore,pentruaaducepHulacesteia(5,5)lavaloareapHuluisangvin.
Valoarea normal~ este de 1040 mEq/zi, dar poate cre#te la sute de mEq, `n cazul
elimin~riimasivedeacizi(cetoacizi).
`n condi[ii normale, fosfa[ii, creatinina #i acidul uric nu influen[eaz~ aciditatea
titrabil~.Aciditateatitrabil~sedistingedeaciditateaionic~exprimat~prinpH,caredepinde
decon[inutuluneisolu[ii`nH+reali,imediatliberi#iactivi.
Rinichiul excret~ zilnic 11,5 mEq H+/kg la adult. La nivel tisular, acizii rezult~ din
metabolismulintermediar:dinmetabolizareaglucideloracidlactic#iacidpiruvic;dinacizii
gra#itrigliceride,cetoacizi;dinaminoaciziisulfura[iacidsulfuric,iardinaciziinucleici
acidfosforic.
85

TratatdeUrologie

Eliberareaacizilordincelulegenereaz~H+#ianioni(Geavlete,2003).
Hidrogenionul leag~ HCO3, iar anionul se leag~ de Na+ de care era legat anterior

HCO3 .
Cantitatea de bicarbonat legat corespunde cantit~[ii de acizi organici #i anorganici.
Pentruamen[ineechilibrulacidobazic,rinichiultrebuies~p~strezeHCO3filtrat.
Reabsorb[ia `n totalitate a HCO3 filtrat nu ar asigura eliminarea integral~ a sarcinii
acideimpuserinichiului.
`n plus, rinichiul trebuie s~ asigure regenerarea bicarbonatului, schimb]nd cationul
(deobiceiNa+)pentruunH+secretat,rezult]ndastfelaciditateatitrabil~.
Eliminareasarciniiacidedec~trerinichi,men[in]ndconcomitentechilibrulsodiului#i
alpotasiului,serealizeaz~prinformareaunuicationorganic(amoniu),carepoatefieliminat
cuanionulfiltrat.
Produc[iazilnic~deaciziliberisedetermin~prinm~surareaacidit~[iitotale`nurina
zilnic~,rinichiulfiindsingurulorganimplicat`neliminareaacestorprodu#i.
`ntruc]t `n condi[ii normale produc[ia de acizi este egal~ cu cantitatea de acizi
eliminat~,m~surareaexcre[ieiacidetotale`nurinadin24orepermiteapreciereaproduc[iei
acide.
Aciditateaurinar~secalculeaz~ casum~`ntre aciditateatitrabil~#iamoniulurinar,
dincaresescadepierdereadebicarbonat(Levy#icolab.,2005).
Pentrufiecaremolecul~defosfatdisodic(Na2HP04)transformat~`nfosfatmonosodic
(NaH2P04),unH+esteexcretat,ceeacecorespunderegener~riiunuiHCO3#iaunuication
desodiu.
Pittspropunetreimecanismeposibilepentruaexplicaexcre[iafosfa[ilormonosodici:
1.

numai fosfa[ii disodici sunt reabsorbi[i, fosfa[ii monosodici r~m]n]nd `n urina


definitiv~
2. fosfatuldisodicsecombin~cuacidulcarbonicpentruaformabicarbonatuldesodiu,
careestereabsorbit,#ifosfatulmonosodic,careesteexcretat
3. unH+con[inut`ncelulatubular~esteschimbatcuunNa+dinfosfatuldisodic.

Primeledou~mecanismesuntsuficientepentruajustificaexcre[iaacidit~[iititrabile
`n mod normal. Numai c]nd aciditatea titrabil~ eliminat~ este mult crescut~ (`n acidoza
metabolic~ sau `n timpul unei perfuzii cu fosfat neutru de Na+), este necesar~ interven[ia
celuidealtreileamecanism.
Generarea acidit~[ii titrabile se petrece dea lungul `ntregului nefron. `ntradev~r,
sc~derea pHului `n TCP permite (gra[ie pHului favorabil al fosfa[ilor), formarea unei
cantit~[iimportantedeacizi;`nnefronuldistal#icanalulcolector,undepotfiatinsepHurile
celemaijoase,altesistemetampon(creatinina,aciduric)alc~rorpHestemaijos,asigur~
eliminareaacidit~[iititrabile(Ursea,1999).
Regenerareabicarbonatuluiprinexcre[iaamoniacului
Amoniaculesteobaz~deoarecesepoatecombinacuH+pentruadaunacid,ionul
deamoniu;acestsistemtamponareunpHridicat(Halperin,1992).NH3 nuare`nc~rc~tur~
electric~, este liposolubil, deci traverseaz~ u#or membrana celular~. NH4+ este electropo
zitiv,hidrosolubil#idifuzeaz~slab`ncelule.
Amoniacul difuzeaz~ pasiv din celula tubular~ unde este format, fie spre lumenul
86

Capitolul2.Fiziologiaaparatuluiurogenital

tabular, fie spre capilarele peritubulare; este o difuziune neionic~ pentru c~ NH3 nu este
`nc~rcatelectric.Difuziuneaseface`nsensulgradientuluideH+,delafazaceamaiacid~la
ceamaialcalin~.
C]ndurinaesteacid~,deplasareasefacedelacelulatubular~sprelumen.`nlichidul
tubularacid,NH3setransform~rapid`nNH4+carenupoatep~r~silichidultubular.Excre[ia
deamoniacse`nso[e#tedereabsorb[iaNa+,secre[iadeH+#iregenerareaHCO3.Sarputea
faceoschem~analog~pentruexcre[iaacidit~[iititrabilesubformadeNaH2P04,careajunge,
deasemenea,laregenerareabicarbonatului.
Micropunc[iileauar~tatc~amoniaculestesecretatlamamiferedealungultubului
renal, inclusiv tubul contort proximal, unde fluidul tubular este u#or acidifiat; `n cazul
acidozeicronice,secre[iaproximal~deNH3estecrescut~.
Amoniacul este format `n rinichi; `ntradev~r, concentra[ia venoas~ renal~ este
superioar~concentra[ieiarterialerenaledeNH3.Produc[iadeNH3dec~trerinichiestesuma
amoniacului excretat urinar cu a celui deversat `n s]ngele venos renal; poate fi calculat~
plec]nddelavalorileFSR,amoniemieiarteriale#ivenoaserenale#idinamoniurie.
Poolulrenaldeamoniacaredou~surse:
amoniaculsangvin,carereprezint~1/3dinNH3excretat
amoniaculformat`nrinichi(amoniogeneza).
CantitateaceamaimaredeNH3dinpoolulrenalrezult~dinNH3produsderinichi.
Sursa predominant~ pentru produc[ia renal~ de NH3 este glutamina; o cantitate mai mic~
poaterezultadinmetabolismulaltoraminoacizi,ca:asparagina,alanina,histidina.Rinichiul
mamiferelor dispune de dou~ c~i majore prin care preparatele amidice #i aminice ale
glutaminei sunt eliberate pentru a produce NH3. Sa sugerat c~ #i ciclul nucleotidelor
purinicepoatecontribuilaamoniogenezarenal~.
Primacaleserealizeaz~prinac[iuneaglutaminazeil,ceproducedezaminareagluta
minei,rezult]ndNH3#iglutamat.Glutamatulpoatefidezaminatoxidativlaacetoglutarat#i
NH3,dec~treglutamatdehidrogenaz~.
A doua cale este ini[iat~ de c~tre glutamincetoatidaminotransferaz~, care catali
zeaz~ conversia glutaminei la acetoglutamat, enzim~ care poate ac[iona asupra unui larg
spectru de acetoacizi. Alfacetoglutamatul este dezaminat de o dezamidaz~ specific~, la
amoniac #i acetoglutarat. Aceast~ cale poart~ numele de calea glutaminazei II #i este
responsabil~numaipentruomic~frac[iunedinactivitateaglutaminazeirenale`ncondi[iide
echilibru acidobazic normal. Mai multe studii au ar~tat c~ metabolizarea glutaminei pe
calea glutaminazei II nu este responsabil~ de cre#terea form~rii de amoniac `n acidoza
metabolic~cronic~.
Exist~dou~izoenzimerenalealeglutaminazeiI.Unaesteactivat~defosfatulanor
ganic #i este numit~ glutaminaza dependent~ de fosfat (PDG), iar cea dea doua este
activat~deioniimaleat#icarbonat#ipoart~numeledeglutaminazaindependent~defosfat
(PIG). Distribu[ia acestor dou~ izoenzime la nivelul nefronului este complementar~. Astfel,
PDGseg~se#te`nconcentra[ie`nalt~`npor[iuneadreapt~#iconvolut~atubuluidistal,`n
concentra[ieintermediar~`ntubulcontortproximal#i`nconcentra[iejoas~`nglomeruli#i
parsrectaaTCP.NumaiactivitateaPDGr~spundelamodific~rileEAB,r~spunsceestelimitat
la tubul cotort distal. Activitatea PIG nu este influen[at~ de acidoz~ sau alcaloz~. La nivel
subcelular,PDGestelocalizat~lanivelulmembraneimitocondrialeinterne.
PIG reflect~ activitatea glutaminazic~ a yglutamiltranspeptidazei din marginea `n
perieamembraneicelularetubulare.
Glutamatdehidrogenaza (GDH) catalizeaz~ reac[ia reversibil~ care `ncepe la nivelul

87

TratatdeUrologie

renalcutransformareaglutamatului`nacetoglutarat,NADH,NH3#iH+:

Glutamat+NADalfacetoglutarat+NADH+NH3+H+

Ciclul nucleotidelor purinice este localizat la nivelul citoplasmei #i utilizeaz~ drept


substrat nucleotidele purinice #i guanozintrifosfatul (GTP) ca surs~ de energie pentru a
transformaaspartatul`nNH3#ifumarat.Aspartatulnuestesubstratulprimarpentruamo
niogenezarenal~,ciesteunprodusalc~iidependentedePDG.Activitateaadenilsuccinat
sintetazei,careesteenzimalimitant~acicluluinucleotidelorpurinice,estesuficient~pentru
a produce cantit~[i semnificative de NH3. Activitatea acestei enzime cre#te cu 60% dup~
dou~ziledeacidoz~metabolic~.Acidozametabolic~este`nso[it~deom~rireadaptativ~a
produc[ieirenaledeNH3,urmat~deocre#terecorespunz~toareaexcre[ieiurinaredeNH4+.
Excre[ia renal~ de amoniac #i reparti[ia sa `ntre urin~ #i s]ngele venos depinde
`ndeosebidepHulurinei#ials]ngelui#idefluxurilerespective`ntubi#icapilareleperitu
bulare.Cuc]turinaestemaiacid~,cuat]tNH3difuzeaz~maiu#orsprelumenultubular#icu
at]tamoniuriaesteridicat~.Cumurinaestecelmaiadeseamaiacid~dec]ts]ngele,ceamai
mare partea amoniacului este `n mod normal excretat~ `nurin~, `ncazul acidozei severe,
excre[iaamoniaculuipoatefimultiplicat~de10ori;`nacidoz~cronic~,produc[iadeamoniac
estecrescut~,f~r~caaceastas~aib~oexplica[iesatisf~c~toare.
Dac~pHulurinar#icelsangvinsuntidentice,fluxurileurinare#isangvineperitubu
lare devin determinante; `ntradev~r, cu c]t debitul este mai ridicat, cu at]t difuzia este
favorizat~,deoareceechilibruldedifuzieestedificildeatins,`naceast~`mprejurare,`ncare
produc[ia de amoniac este sc~zut~, mi#carea amoniacului se face mai ales c~tre s]ngele
peritubularpentruc~fluxulsangvinestesuperiordebituluiurinar.
Gra[ievaria[iilorproduc[iei#isecre[ieideamoniac,rinichiuldispunedeunmecanism
esen[ial pentru a lupta contra supra`nc~rc~rii acide. Exemplul urinelor arat~ cum excre[ia
urinar~deNH3permiteorganismuluis~reconstituierezervelesaledebicarbona[i#isodiu;
acidul sulfuric format prin metabolismul proteinelor este neutralizat imediat `n lichidele
extracelularedeuntampon,bicarbonatuldesodiu:

H2SO4+2NaHCO3Na2SO4+2H2O+2CO2
CO2esteeliminatprinpl~m]ni;`nfluidultubularrenalopera[iaurm~toareesteefec
tuat~plec]nddelasulfatuldesodiu:

Na2SO4+2H2CO3+2NH3(NH4)2SO4+2NaHCO3
ExcretatReabsorbit

SistemulNH3NH4+estetamponulmajoralurineipentruc~asigur~regenerareade
23 ori mai mare a bicarbonatului dec]t excre[ia acidit~[ii titrabile; normal, 3050 mEq de
acizisuntelimina[ipezi`nurin~combina[icuamoniac.
Secre[ia urinar~ de H+ de celula tubular~ este fenomenul ini[ial: suma (aciditatea
titrabile+amoniurie)reprezint~muncarinichiuluipentruarefacerezerveledeHCO3.
Trebuiedeosebite:
reabsorb[iabicarbona[ilor,carenufacedec]ts~recuperezebicarbona[iifiltra[i
regenerareabicarbona[ilor,carerezult~dinexcre[iaNH4+#iaacidit~[iititrabile#i
furnizeaz~organismuluinoianionibicarbonici(Blumfeld#iVaughan,2003).
88

Capitolul2.Fiziologiaaparatuluiurogenital

Secre[iaexcesuluidebaze
`nc~rcareaorganismuluicucomponentealcalinedeclan#eaz~mecanismeledeelimi
nareaexcesuluidebazeprindistribu[ia#itamponamentul`ncomponenteleintra#iextra
celulare,r~spunsrespirator#irenaladecvat.
Bicarbonatul`nexcesestedistribuitcompartimentuluiextracelularundeestetampo
nat `n propor[ie de 70% `n primele 30 minute. Restul este tamponat de sistemele intra
celulare. Pentru tamponamentul bicarbonatului `n exces este necesar~ o produc[ie supli
mentar~deCO2#imodificareaventila[ieialveolare.R~spunsulrespirator,careseinstaleaz~
`n primele ore, const~ `n hipoventila[ie cu cre#terea PCO2 #i compensarea concentra[iei
crescuteabicarbonatului.
Interven[ia rinichiului se produce mai rapid dec]t la `nc~rcarea acid~ #i const~ `n
cre#tereafiltr~riiglomerulareabicarbonatuluicudiminuareareabsorb[ieiacestuia.Intimp
ce cre#te concentra[ia plasmatic~ a bicarbonatului, cre#te #i filtrarea HCO3, acidifierea la
nivelul TCP este redus~ datorit~ alcalemiei crescute, iar reabsorb[ia bicarbonatului este
sc~zut~ comparativ cu cantitatea filtrat~. `n consecin[~, bicarbonatul distribuit nefronului
distalcre#te#iacidifierealaacestnivelscade,urmat~deexpoliereaorganismuluideexcesul
de baze. `n plus, secre[ia direct~ a bicarbonatului la nivelul tubilor colectori contribuie
eficientlamen[inereaechilibruluiacidobazic`nsitua[iilede`nc~rcarealcalin~.
Modific~rileHCO3`nlichidulextracelularvorgeneradezechilibremetaboliceacido
bazice (acidoza #i alcaloza metabolic~), iar cele care rezult~ din perturb~ri ale PCO2 sunt
denumitedezechilibrerespiratoriiacidobazice(acidoza#ialcalozarespiratorie).

Fiziologiabazinetuluirenal#iaureterului
Prof.Dr.P.Geavlete

Ureterulasigur~transportulurineidelarinichilavezicaurinar~.Unitateafunc[ional~
primar~ a ureterului este reprezentat~ de celula muscular~ neted~. La nivelul por[iunii
proximale a sistemului colector exist~ celule cu rol pe pace maker a c~ror activitate
electric~ contribuie la ini[ierea undelor peristaltice urterale (Lammers #i colab., 1986).
Impulsurileelectricesunttransmisedistal#idetermin~apari[iafenomenelormecanicecare
genereaz~ undele peristaltice necesare progresiei bolusului ureteral spre vezica urinar~.
Eficien[acontractilit~[iiureteraleinflen[eaz~`nmoddirectpropulsiabolusuluiurinar.

Rolulsistemuluinervos`ndinamicaureteral~

Ureterul se comport~ ca un mu#chi neted de tip sinci[ial, a c~rui persistaltic~ se


poate men[ine dup~ denervare. Totu#i, transportul bolusului urinar dea lungul ureterului
esteinflen[atdesistemulnervosvegetativ,`nspecialprincontrolulfrecven[eicontrac[iilor
ureterale.Activitateaureteral~estecontrolat~at]tdesistemulnervosparasimpatic(mediat
deacetilcolin~),c]t#idecelsimpatic(mediatdenoradrenalin~)(DelTacca,1978).

Sistemulnervosparasimpatic

Persitaltica ureteral~ poate fi influen[at~ de sistemul nervos parasimpatic, acesta


av]nd mai ales un rol modulator (Prieto #i colab., 1994). Controlul activit~[ii ureterale se
realizeaz~ prin intermediul receptorilor muscarinici colinergici, principalul mediator fiind
reprezentatdeaceticolin~.Eliberareaacesteiaestestimulat~deimpulsulelectric#iinhibat~
detetrodixin~(otoxin~neuronal~).
89

TratatdeUrologie

Agoni#tiicolinergici
Agoni#tii colinergici (acetilcolina, methacolina, carbamilcolina) cresc frecven[a #i
for[acontrac[iilor,av]ndunefectexcitantasuprafunc[ieiureterale.
Agoni#tii nicotinici (nicotina, tetrametilaminium) ac[ioneaz~ asupra receptorilor
nicotinici determin]nd stimularea ini[ial~ a acestora, urmat~ de desensibilizarea situsurilor
receptoarecublocajultransmiteriiimpulsuluinervos#iinhibi[iaactivit~[iiureterale.Efectul
estedependentdedoz~(Vereecken,1973).

Anticolinesterazele
Anticolinesterazele cresc intensitatea #i durata ac[iunii acetilcolinei pe receptorii
muscarinici#inicotinicidatorit~inhibi[ieihidrolizeiacesteiadec~trecolinesteraze.`ndoze
maripotrealizadesensibilizareareceptorilornicotinicibloca[i.

Agen[iblocan[iparasimpatici
Principalii blocan[i parasimpatici sunt reprezenta[i de atropin~, metacolin~ #i
propantelin~. Atropina este un antagonist competitiv al efectelor muscarinice ale acetil
colinei, inhib]nd efectele stimulante ale agoni#tilor parasimpatomimetici. Chiar dac~ atro
pina particip~ la inhibarea activit~[ii ureterale, efectele sale sunt `n general minime #i
inconstante. De aceea,eanuesteindicat~ `ntratamentulcoliciirenale.Ceilal[iparasimpa
ticoliticinuinflen[eaz~`nmodsemnificativactivitateaureteral~(Reid#icolab.,1976).

Sistemulnervossimpatic
Lanivelulureteruluiaufosteviden[ia[ireceptorialfaadrenergici (excitan[i) #ibeta
adrenergici (inhibitori) prin intermediul c~rora sistemul nervos simpatic moduleaz~ activi
tatea ureteral~. Receptori alfaadrenergici sunt stimula[i de noradrenalin~ (principalul
agonistadrenergic),determin]ndcre#tereafor[eicontrac[iilorureterale(Edyvane#icolab.,
1994).Administrareaconcomitent~cufentolaminadetermin~sc~dereafor[eidecontrac[ie
ureteral~ ca urmare a efectului alfablocant al acesteia din urm~. Ac[iunea noradrenalinei
estepoten[at~depropranololdatorit~efectuluiantagonistbetaadrenergic.Acesteconsta
t~ri, al~turi de eviden[ierea prezen[ei adenilciclazei, confirm~ existen[a receptorilor
adrenergici (alfa #i beta la nivelul peretelui ureteral, explic]nd contractilitatea spontan~ a
segmentelor ureterale in vitro (Deane, 1967). Aplicarea unui stimul electric de intensitate
ridicat~peodurat~scurt~detimpdetermin~eliberareaneurotransmi[~torilordelanivelul
[esutuluineuronalintrinseclocalizatlanivelulpereteluiureteral(Longrigg,1975).

Agoni#tiiadrenergici
Adrenalina#inoradrenalinastimuleaz~activitateaureteral~prinac[iunealordirect~
asuprareceptoriloralfaadrenergici.Izoproterenolul#iorciprenalina,ac[ion]ndpereceptorii
betaadrenergici, inhib~ contractilitatea ureteral~. Tiramina stimuleaz~ eliberarea noradre
nalinei la nivelul termina[iilor nervoase, av]nd un efect agonist adrenergic. Cocaina #i
imipraminainhib~recaptareaneuronal~anoradrenalinei,poten[]ndastfelac[iuneaacesteia
(Tomiyama#icolab.,1998).Monoaminoxidaza#icatecolmetiltransferazaproducdegradarea
noradrenalinei,cureducereaefecteloreifiziologice.

Antagoni#tiadrenergici
Antagoni#tiialfaadrenergici(fentolamina,fenoxibenzamina)inhib~ac[iuneaexcitan
t~ a noradrenalinei. Antagoni#ii betaadrenergici (propranolol) reduc sau chiar blocheaz~
ac[iuneaagoni#tilorbadrenergici(izoproterenol)(Gillenwater,1974).

90

Capitolul2.Fiziologiaaparatuluiurogenital

Transportulurinei

Fiziologiajonc[iuniipieloureterale
Datorit~bloc~riirelativeaactivit~[iielectricelaniveluljonc[iuniipieloureterale(JPU),
`ngeneralfrecven[acontrac[iilorcaliceale#ibazinetaleestemaimarecomparativcuceade
la nivelul ureterului superior. Umplerea progresiv~ a bazinetului cu urin~ determin~
cre#terea presiunii la acest nivel urmat~ de expulzia urinii la nivelul ureterului proximal,
care,careini[ialestecolabat.Contrac[iileureteralecareasigur~avansareabolusuluideurin~
determin~ o presiune mai mare comparativ cu cea bazinetal~, `nchiz]nd jonc[iunea
pieloureteral~#i`mpiedic]ndtransmiterearetrograd~apresiunii,cuefectprotectivasupra
rinichiului. `n condi[iile unui flux urinar crescut frecven[a contrac[iilor bazinetale poate
deveniegal~cuacelorureterale(Griffiths#iNotschaele,1983).
Stenozele JPU determin~ reducerea lumenului, `mpiedic]nd astfel fluxul normal al
urinii(Maizels,1980).Obstruc[iafunc[ional~aJPUpoatefisecundar~transmiteriianormale
a impulsurilor peristaltice la acest nivel. Majoritatea autorilor au descris modific~ri histo
patologice care `nso[esc stenozele de JPU: alterarea configura[iei benzilor musculare la
nivelul JUP (Murnaghan, 1958) sau reducerea muscularei la acest nivel (Foote, 1970);
anomalii ale musculaturii pelvisului renal (Hanna, 1978); `ntreruperea propag~rii activit~[ii
peristaltice.Exist~situa[iicustenozedeJPUlacareobstruc[iapoatefiobiectivat~numai`n
cazulunuifluxurinarcrescut(Weiss,1998).

Propulsiabolusuluiurinar
Mecanimele propulsiei bolusului ureteral la nivelul ureterului au fost descrise de
Griffiths#iNotschaele(1983).Asfel,cre#tereapresiuniibazinetaledetermin~expulziaurinii
la nivelul ureterului superior, care ini[ial este colabat. La nivelul por[iunii proximale a
ureterului se genereaz~ unde de contrac[ie determin~ mi#carea frontului de urin~ `n
direc[ie distal~, sub forma unui bolus urinar. Pentru a conduce `n mod eficient bolusul de
urin~, undele de contrac[ie trebuie s~ asigure coaptarea complet~ a pere[ilor ureterali.
Tonusulureteralasigur~opresiunederepausde25cmH2O`ntimpce,`ncursulcontrac[iei
ureterale, aceasta cre#te p]n~ la circa 80 cmH2O (Ross, 1972). Frecven[a contrac[iilor
ureteraleestecuprins~`ntre26peminut.Undacontractil~avanseaz~p]n~laniveluljonc[i
uniiureterovezicale,asigur]ndtransportulurinii`ntrunsingursens.
Caoricestructur~tubular~,ureterulpoatetransportaocantitatemaxim~defluidpe
unitateadetimp.`ncondi[iileunuifluxnormalcantitateadeurin~transportat~`nunitatea
de timp este semnificativ mai mic~ dec]t capacitatea total~ de transport a ureterului. `n
cazulcre#teriifluxuluiureteral,pere[iiureteralinusemaialipescform]nduseocoloan~de
urin~rezultat~prinunireamaimultorbolusuri(Withaker,1973).Dac~mecanismelefiziolo
gice de transport sunt alterate apare staza urinar~ cu dilata[ia ureteral~ consecutiv~.
Dilata[ia ureteral~ secundar~ este dependant~ at]t de gradul obstruc[iei c]t #i de fluxul
urinar.Astfel,oobstruc[ieminim~poatedeterminaodilata[ieimportant~`ncazulexisten[ei
unuifluxureteralmarepeunitateadetimp.
Modific~rile ureterale consecutive obstruc[iei altereaz~ transportul urinii, chiar `n
condi[iile men[inerii for[ei de contrac[ie a fibrelor musculare. Astfel, cre#terea diametrului
ureteral poate determina sc~derea presiunii intraluminale determin]nd o ineficien[~ a
transportului de urin~ (Weiss, 1998). Rela[ia dintre diferitele variabile care influen[eaz~
presiunea intraluminal~ #i implicit propulsia bolusului ureteral este exprimat~ de ecua[ia
Laplace:

91

TratatdeUrologie

Presiunea=(TensiuneaxGrosimeaperetelui)/Raz~

Efectuldiureticelorasuprafunc[ieiureterale
Lacre#tereafluxuluiurinar,r~spunsulini[ialalureteruluiestereprezentatdem~rirea
frecven[eiundelorperistaltice.Dup~atingereafrecven[eimaxime,cre#tereaserealizeaz~pe
seama volumului bolusului urinar. `n condi[iile unui flux urinar sc~zut, modific~rile minime
aleacestuiadetermin~cre#teriimportantealefrecven[eiundelorperistaltice.Dincontr~,`n
cazulunuifluxurinarimportant,modificareafrecven[eicontrac[iilorperistalticenumaieste
directpropor[ional~cucre#tereafluxului.`nsitua[iaunuifluxurinarfoarteintenssepoate
producefuzionareabolusurilorurinare, `nfinalureteruldevenindocoloan~plin~delichid
(Constaninou,1974).

Efectulactivit~[iivezicaleasuprafunc[ieiureterale
Dilata[iaureteral~poaterezultadatorit~uneicauzecare`mpiedic~eliberareaurinii
`n vezica urinar~ sau prin cre#terea fluxului urinar. `n condi[iile unui ureter normal,
presiunea contractil~ ureteral~ dep~#e#te presiunea intravezical~, conduc]nd la pasajul
bolusuluiurinar`nvezic~.`ncazuldilata[ieiureterale,aundelorcontractileureteraleslabe
sau a unui flux ureteral extrem de crescut, pere[ii ureterali nu se pot alipi pentru a forma
bolusuldeurin~,iarpresiunealanivelulcoloaneiurinaretrebuies~dep~#easc~presiunea
vezical~pentruaasigurapasajulurinar(Weiss#icolab.,1998).
Presiuneaintravezical~`ntimpulfazeideumplereinfluen[eaz~eficacitateatranspor
tului urinii la nivelul jonc[iunii ureterovezicale. `n timpul umplerii normale impulsurile
simpatice#ipropriet~[ilev]scoelasticealedetrusoruluiseopuncre#teriipresiuniiintravezi
cale, facilit]nduse transportul urinii la nivelul jonc[iunii ureterovezicale cu prevenirea
dilata[ieiureterale.
`n cazurile cu vezic~ urinar~ necompliant~ #i `n unele forme de disfunc[ie vezical~
neurologic~, modific~ri relativ mici ale volumului vezical determin~ cre#teri mari ale
presiunii intravezicale, afect]nd evacuarea ureteral~. R~spunsul ureteral ini[ial const~ `n
cre#terea frecven[ei peristaltice. Tardiv, staza determin~ dilata[ia ureterului. Ureterul se
decompenseaz~c]ndpresiuneaintravezical~dep~#e#te40cmap~.

Fiziologiajonc[iuniiureterovezicale

Factorii implica[i `n transportul urinii la nivelul jonc[iunii ureterovezicale au fost


descri#ideGriffiths(1983).Astfel,`ncondi[iinormaleundadecontrac[ieureteral~capabil~
s~ alipeasc~ pere[ii ureterali `mpinge bolusul de urin~ p]n~ la nivelul jonc[iunii uretero
vezicale.Aparcontrac[iilanivelulfibrelormuscularelongitudinalealeureteruluiintramural
cu scurtarea traiectului acestuia prin culisarea sa `n teaca lui Waldeyer. Pe l]ng~ scurtarea
ureterului apare #i o cre#tere a diametrului la acest nivel, sc~z]nd mult rezisten[a la
propulsia bolusului de urin~. Pasajul vezical este posibil numai dac~ presiunea la nivelul
bolusuluiureteralodep~#e#tepeceaintravezical~.Dup~cebolusulesteejectat`nvezic~,
ureterul intramural revine la dimensiunea ini[ial~, presiunea intravezical~ comprim]nd
traiectulureteralsubmucos#istop]ndastfelrefluxulvezicoureteral.
Cre#terea excesiv~ a presiunii intravezicale sau obstruc[ia jonc[iunii ureterovezicale
perturb~ transportul bolusului ureteral, presiunea de la acest nivel dep~#ind presiunea
generat~ de unda contractil~. Poate rezulta astfel un reflux urinar retrograd. `n aceste
condi[ii pasajul bolusului urinar va fi incomplet, numai o parte a acestuia trec]nd `n vezica
urinar~.
92

Capitolul2.Fiziologiaaparatuluiurogenital

AcesteaspecteteoreticedescrisedeGriffithsprezint~aplicabilitateclinic~,obstruc
[iajonc[iuniiureterovezicaleput]ndficuantificat~cuajutorultestuluiWithacher.

Fiziologiaveziciiurinare#iauretrei
Prof.Dr.P.Geavlete

Func[iileveziciiurinare
Vezicaurinar~aredou~func[iiesen[iale:
rezervordestocareaurinii
evacuareperiodic~aurinii.
`ndeplinireaacestordou~func[iiesteposibil~datorit~propriet~[ilormusculare#ia
regl~riinervoaseextrinsecicomplexe.
Evacuarea vezicii urinare este dependent~ de mecanismele nervoase voluntare (de
Groat #i Steers, 1990) iar stocarea urinii se datoreaz~ propriet~[ilor viscoelastice #i
miogenice ale vezicii urinare #i uretrei, stimulii nervo#i juc]nd un rol important `n
men[inereacontinen[ei.Datorit~acestorfactoriinterdependen[i,complexulvezic~urinar~
col este sensibil la dezechilibre metabolice, afec[iuni neurologice, traumatisme #i
medicamente. `n[elegerea mecanismelor miogenice #i neuronale care regleaz~ activitatea
tractuluiurinarinferiorreprezint~cheiatratamentuluidisfunc[iilorvezicale.

Biomecanicaveziciiurinare
Ciclulmic[ionalestecompusdinalternan[aadou~procesedistincte:umplereavezicii
urinarecudepozitareaurinii#igolireaveziciiurinare.
Tractul urinar inferior func[ioneaz~ ca un complex a c~rui func[ie este s~ asigure
umplerea vezical~, stocarea urinii cu continen[~ perfect~ #i expulzie urinar~ periodic~
voluntar~,toatetreilapresiunejoas~.
Ciclulmic[ionalincludeurm~toareleetape:
fazadeumplere(diastola)presupuneacomodareadetrusoruluilaunvolumdeurin~
`ncre#tere,`ncondi[iilemen[ineriiuneipresiuniintravezicalejoase.`naceast~etap~
contrac[iilevezicaleinvoluntaresuntabsente
faza de golire (sistola) necesit~ o contrac[ie coordonat~ a musculaturii netede
vezicale,cuoamplitudinecorespunz~toare.Concomitentse`nregistreaz~osc~dere
arezisten[eilanivelulsfincteruluineted#istriat(bine`n[eles,`nabsen[aobstruc[iei
anatomicecares~seopun~mic[iunii).
Umplerea depinde de propriet~[i neuromusculare #i mecanice ale vezicii. Proprie
t~[ilemecanicesuntinfluen[atedegraduldistensiei#isuntextremdesensibilelastructura
#i compozi[ia tisular~. Complian[a vezical~ (C) este definit~ ca raportul dintre modificarea
relativ~avolumului(V)#ivaria[iapresiuniiintravezicale(P):

C=V/P
O serie de modific~ri patologice (afectarea structural~ a detrusorului, afectarea
inerva[ieieferenteetc.)potalteracomplian[avezical~.
Vezica urinar~ are `n compozi[ie circa 50% colagen #i 2% elastin~. `n obstruc[iile
cronice, afec[iunile detrusorului sau `n denerv~rile acestuia conduce la cre#terea cantit~[ii
decolagen,consecutiv`nregistr]ndusereducereacomplian[eiveziciiurinare.
Pierderea complian[ei modific~ tensiunea la nivelul peretelui vezical, aceasta
cresc]ndcum~rireavolumuluivezicalconformecua[ieiluiLaplace(Steers,1998):
93

TratatdeUrologie

T=PvesR/2d

`n timpul umplerii vezicii Pves este relativ constant~. C]nd vezica este complet
umplut~, parametrul d este neglijabil, cu excep[ia cazurilor `n care exist~ o hipertrofie a
detrusorului. Cu alte cuvinte, pentru vezica normal~ plin~, formula poate fi simplificat~
astfel:

T=PvesR/2

Datorit~ complian[ei crescute (dependent~ de propriet~[ile elastice ale peretelui),


umplerea vezicii urinare normale a adultului se realizeaz~ cu o modificarea minim~ a
presiunii intracavitare. La acest mecanism contribuie at]t un fenomen pasiv, elasticitatea
(carepermiteconstituen[ilorpereteluivezicals~se`ntind~lalungimidiferitef~r~acre#te
tensiunea),c]t#iunulactiv.Acestadinurm~serealizeaz~prinintermediulunuicomplexce
include fibrele musculare #i matricea extracelular~ #i care poate reac[iona prompt la
stimulareanervoas~.
Uzual, cistometria de umplere `nregistreaz~ o cre#tere u#oar~ a presiunii intra
vezicale. Totu#i, Klevmark (1974) a ar~tat c~ acest fenomen se datoreaz~ faptului c~ `n
aceste condi[ii umplerea se realizeaz~ cu o debit mai mare dec]t `n condi[ii fiziologice, cu
urin~.Laratelefiziologicedeumplerenuse`nregistreaz~ocre#tereapresiuniidec]tdup~
cecapacitateavezical~afostatins~.
Sintetiz]ndtoateacestemecanisme,complian[avezical~poatefialterat~prin:
procesecarealtereaz~viscoelasticitateasauelasticitateacomponentelorperetelui
umplereaveziciiurinarecuundebitmaimaredec]tceluzual,fiziologic
umplereaveziciicuocantitatepestelimit~adistensibilit~[ii
factorii neurologici care modific~ r~spunsul componentelor musculaturii netede `n
timpulumplerii.

Aparatulsfincteriansubvezical
Sfincterul neted, involuntar, este o structur~ func[ional~ #i nu una anatomic~,
constituit~ din musculatura neted~ a colului vezicii urinare #i uretrei proximale. La consti
tuireaacestuiaparticip~fibreletuturorstraturilordetrusorului:ansadetrusorului.
Sfincterul striat este constituit din fibre musculare striate dependente de peretele
exterior uretral, la b~rbat #i femeie (componenta intrinsec~), respectiv grupele de mu#chi
scheletici care `nconjoar~ uretra la nivelul por[iunii sale membranoase la b~rbat #i `n
segmentul mijlociu la femeie (componenta extrinsec~). Acesta din urm~, numit sfincter
uretralextern,seafl~subcontrolvoluntar.
Lab~rbatsistemulsfincterianestesuprapus(netedsuperior#istriatinferior),iarla
femeieesteconcentric(netedlainterior#istriatlaexterior).
Disfunc[iilevezicalepotfirezultatulalter~riiunuiasauamaimultordinstructurile#i
mecanismeledescrise.

Rolulcomplexuluisfincterian
`n timpul umplerii, la nivelul sfincterului neted se va `nregistra un tonus pasiv
permanent.Sfincterulstriatintervinedarpentruaseopuneuneimic[iuniimperioase,fiind
subcontrolvoluntar.Asociereadintreacestemodific~riactivedelanivelulsfincterelorneted
#i striat precum #i caracteristicile pasive ale [esuturilor uretrale are un rol esen[ial `n
asigurareacontinen[ei.
94

Capitolul2.Fiziologiaaparatuluiurogenital

`n timpul ini[ierii voluntare a mic[iunii, presiunea vezical~ devine mai mare dec]t
presiunea colului. O serie de mecanisme reflexe induc modific~ri conforma[ionale #i
tensionalealecoluluivezical#iuretreiproximale(Oerlich,1983),rezultatulfiindmodificarea
formeiacestuia#itrecereaurinii`nuretr~.
Atunci c]nd are loc numai cre#terea presiunii abdominale (dar `n afara ini[ierii
voluntareamic[iunii,cadeexemplu`ntimpulstr~nutuluisaualtusei)nuaparecontrac[ia
coordonat~ a vezicii. Simpla cre#tere a presiunii intravezicale nu este suficient~ pentru
evacuarea vezicii. Mai mult, presiunea abdominal~ are un efect de compresiune a uretrei
femininepeplan#eulpelvin,dependentdestabilitateastructurilorsuburetraledesus[inere.
Dac~planuldesus[inereesteferm,compresiauretreiesterapid~#ieficient~.Dac~aceste
structuri sunt laxe, compresia nu este eficient~ #i apare incontinen[a urinar~ de efort. `n
acest ultim caz, este necesar~, `n plus, asocierea incompeten[ei colului vezical #i a uretrei
proximale`nrepaus.
`ncondi[iifiziologice,cre#tereapresiuniide`nchidereauretreiestemaimaredec]t
presiunea intravezical~ asociat~ hiperpresiunii abdominale, ceea ce indic~ un mecanism
activ, probabil prin implicarea musculaturii perineale. Tanagho (1989) a fost primul care a
ar~tat c~ o presiune de `nchidere suplimentar~, care implic~ un reflex de cre#tere a
tonusuluisfincterelor,seexercit~asuprauretrei`ntimpulstr~nutului.

Mecanismedeevacuare
Presiuneaintravezical~reflect~combinareapresiuniiabdominale(Pabd)#iapresiunii
detrusorului(Pdet):

Pvez=Pdet+Pabd

`ntimpul mic[iunii,contrac[iiledetrusorienemediatenervosconduclaocre#tere a
Pdetf~r~ocre#teresemnificativ~aPabd.
Fibrelemuscularegenereaz~energiidiferite`nfunc[ie de lungime.Deoarecevezica
este un organ cavitar, for[a dezvoltat~ contribuie la Pdet `n timp ce viteza de scurtare a
fibrelorestelegat~defluxulurinar(Q).
Leg~tura`ntrePdet#idebitsereg~se#te`nrela[iacarecaracterizeaz~putereameca
nic~(W):

W=PdetQ

Evaluarea rela[iei dintre contractilitatea vezicii #i debit stau la baza investiga[iilor


urodinamice.Aceastapermite,lapacien[iicudebiturinarredus,diagnosticuldiferen[ial`ntre
obstruc[ie #i alterarea contractilit~[ii detrusoriene. Rezisten[a uretral~ este un parametru
util`napreciereaexisten[eiunuiobstacolsubvezical.Eavariaz~cuinversulp~tratuluifluxului
urinar. La pacien[ii cu obstruc[ii subvezicale rezisten[a uretral~ este mare iar Pdet poate
cre#telapeste6090cmap~.`naltecircumstan[e,dac~rezisten[auretral~estesc~zut~(a#a
cum se `nt]mpl~ la unele femei cu insuficien[~ sfincterian~) Pdet poate fi foarte mic~. `n
ambelesitua[iidescrise,`nciudavaria[iilorPdet,contractilitateadetrusoruluipoatefiidentic~.
`n timpul golirii vezicale, presiuneade `nchidere uretral~ trebuies~ fie dep~#it~ de
Pdet. La acest mecanism contribuie #i sistemul nervos, care coordoneaz~ contrac[ia detru
sorului#irelaxareauretral~(Geavlete,2003).

Neuroanatomiafunc[ional~(dev~zutcapitolulVezicaNeurologic~)

95

TratatdeUrologie

Fiziologiaglandeloranexealeaparatuluigenitalmasculin
Prof.Dr.P.Geavlete

Generalit~[i
Glandele sexuale accesorii sunt prostata, veziculele seminale #i glandele bulbo
uretrale.Laom,[esuturilesexualeaccesoriiproducsubstan[ebiologicactive`nconcentra[ii
mari care apar `n lichidul seminal fructoz~ (2 mg/ml), acid citric (4 mg/ml), spermin~
(3 mg/ml), prostaglandine (200 g/ml), zinc (150 g/ml), proteine (40 mg/ml) #i enzime
(imunoglobulinele,proteaze,esteraze#ifosfataze).

Secre[iileglandelorsexualeaccesorii

Lichidulspermaticesteformat,`nprincipal,dinsecre[iaglandeloraccesoriisexuale.
Ejaculatulnormallaomestede35ml#iesteformatdin2componente:spermatozoizii#i
lichidulspermatic.Spermatozoizii,carereprezint~maipu[inde1%dinejaculatultotal,sunt
`n num~r de aproximativ 100 mil/ml. Contribu[ia major~ la realizarea volumului lichidului
seminalesteceaaveziculelorseminale(3ml),aprostatei1,52ml,aglandelorCowper(0,5
ml)#iaglandelorLittre(0,10,2ml).

Acidulcitricesteformat`nprostat~#iareconcentra[iide100deorimaimaridec]t
alte[esuturimoi(30.000nmol/g`nprostat~,iar`nalte[esuturicon[inutuldeacidcitriceste
de150400nmol/g).Concentra[iacitratului`nejaculatestede5001.000orimaimaredec]t
`nplasm~.

Tabelul1.
Compoziiafluiduluispermatic
dupDanielsiGrayhack,1990.

pH6,67,2
Densitatea1027
Proteine25mg/ml
Lipide3mg/ml
Sodiu153mM
Potasiu48mM
Calciu30mM
Magneziu20mM
Cloruri38mM
Bicarbonat20mM
Citra[i98mM
Zinc488g/ml
Spermine24mg/ml
Colesterol0,9mg/ml

Unul dintre anionii importan[i ai fluidului seminal uman este citratul (`n medie 376
mg/100ml)`njurde20mMsau60mEg/l.Acestasecompar~cuconcentra[iaionuluideclor
(155 mg/100 ml) la 40 mM. Citratul leag~ activ ionii metalici, iar concentra[ia seminal~ a
citratului(20mM)estecomparabil~cuceaametalelorbivalente(Ca7mM,Mg4,5mM,Zn
2,1mM).Nivelulprostaticalcitratuluidinveziculeleseminaleestede100orimaimic,fiind
doar0,2mg/ml.

Fructoza. Veziculele seminale la om sunt sursa unic~ pentru fructoz~ din fluidul
seminal.Pacien[iicuabsen[~congenital~ aveziculelorseminalenuaufructoz~`nejaculat.
Secre[iaveziculelorseminalecon[inecantit~[imici,`njurula10mg/100ml,dealtezaharuri
96

Capitolul2.Fiziologiaaparatuluiurogenital

libere,precumglucoza,sorbitolul,riboza,fucoza.`ncompara[ie,concentra[iafructozeieste
de300mg/100ml`nsecre[iaseminal~#iarenivelde200mg/100ml`nfluidulspermatic.

Poliaminelesuntcelemaimicimoleculeorganicebazice(`nc~rcatepozitiv)`nnatur~.
Apar `n toate[esuturilela concentra[ii mari #i sunt implicate `n diferite procese fiziologice
care se coreleaz~ cu proliferarea celular~ #i cre#terea. Poliaminele pot servi ca factori de
cre#terepentruculturadeceluledemamifere#ibacterii, lafelca#iinhibitoriienzimatici,
careincludproteinkinazele.Rolullorexactlanivelmolecularnuestebinecunoscut,darele
reprezint~ocomponent~biologic~important~,cunivele`naltedeconcentra[ie`nejaculat.
Poliaminelepotafectadirec[ionarea#itransportulsubstan[elorprincanalelemembranare.
Dinperspectiveclinice,poliaminele(spermidine#ispermine)aufostinvestigatecamarkeri
aiterapieidedeprivareandrogenic~lapacien[iicucancerdeprostat~avansat.Love(1993)
investigheaz~ rolul poliaminelor `n fiziopatologia cancerului de prostat~. Primul pas `n
sintezapoliaminelordinprostat~estecontrolatdeenzimaornitindecarboxilaza(ODC).ODC
poatefiinhibat~deornitindifluorometil(ODFM)care,lar]ndulei,inhib~sintezapoliamine
lor. ODFM a fost propus ca agent pentru chemopreven[ia cancerului de prostat~. Nivelul
sperminelor `n lichidul seminal normal este de 50350 mg/100 ml #i sunt de origine
prostatic~ `n principal. Prostata este cea mai bogat~ surs~ de spermine `n corp. Spermina
[NH2(CH2)3H(CH2)4(CH2)4NH(CH2)3NH2] este o poliamin~ alifatic~ foarte bazic~, care se
leag~puterniclaacizisaulamoleculelecu`nc~rcarenegativ~,cumsuntioniidefosfat,acizii
nucleici #i fosfolipidele. C]nd sperma este depozitat~ la temperatura camerei, fosfataza
acid~ hidrolizeaz~ enzimatic fosforilcolina seminal~ #i formeaz~ ioni anorganici liberi de
fosfat, care apoi interac[ioneaz~ cu spermina, `nc~rcat~ pozitiv, #i precipit~ sub forma de
cristaletransparentedefosfatdespermin~.Poliaminelesuntoxidateenzimaticdediamino
oxidaza(prezent~`nfluidulseminal)#iformeaz~compu#ialdehidicifoarteactivi,carepotfi
toxici pentru spermatozoizi, dar #i pentru bacterii. Formarea acestor produ#i de aldehide
confer~caracteristicileodorizantealespermei.Este,deasemenea,posibilcaacestealdehide
s~ protejeze tractul genitourinar de agen[ii infec[io#i. Au fost sugerate rela[ii `ntre nivelul
sperminelor din fluidul seminal cu num~rul de spermatozoizi #i mobilitatea lor (van der
Graaf#icol,2000).

Fosforilcolina.Alteaminecu`nc~rcarepozitiv~suntprezente`nconcentra[iemare`n
ejaculat,colina#ifosforilcolina,caresuntcompu#iiobi#nui[iailipidelorsaufactorilorlipidici.
Spermamamiferelorestefoartebogat~`ncoline.Laompredomin~fosforilcolina.Seligman
(1975)ademonstratc~fosforilcolinaesteunsubstratcuspecificitate`nalt~pentrufosfataza
acid~ prostatic~ (FAP), care este #i ea foarte activ~ `n lichidul seminal. Rezultatul acestei
activit~[ienzimaticeesteformarearapid~acolineilibere`nprimapor[iuneaejaculatului.`n
schimb, alfaglicerilfosfocolina este secretat~ `n principal `n epididim #i nu este hidrolizat~
defosfatazaacid~.Pentruacestemotive,Mann(1981)asugeratc~nivelulalfaglicerilfosfo
rilcolineipoatefiunindicatoralconcentra[ieisecre[ieiepididimare`nejaculat.Secre[iiledin
epididimsuntsubcontrolandrogenic.Func[iaacestorcomponen[idecolin~nuestecomplet
cunoscut~,separec~einusuntmetaboliza[idespermatozoizi.

Prostaglandinele. Sursa cea mai bogat~ de prostaglandine la om sunt glandele


seminale. Prostaglandinele sunt prezente `n fluidul seminal `ntro concentra[ie total~ de
100300 g/ml. Injectarea fluidului seminal produce efecte farmacologice puternice de
stimulare sau inhibare a musculaturii netede (Van Waes #i col, 1995). Von Euler (1934) a

97

TratatdeUrologie

propusnumeledeprostaglandinepentrucomponenteleactivealefluiduluiseminalcrez]nd
c~acestea`#iauoriginea`nglandaprostatic~.Eliasson(1959)astabilitc~sursaprincipal~a
prostaglandinelor sunt glandele seminale, #i nu prostata. Prostaglandinele au o distribu[ie
larg~`n[esuturilemamiferelor,darlaconcentra[iimultmaimicidec]t`nglandeleseminale.
Suntaproximativ90deprostaglandinedescriselaom,dincare15suntprezente`nsperm~
#i toate sunt 20 acizi gra#i hidroxicarbon care sunt deriva[i de acid prostanoic. Cele 15
tipurideprostaglandineprezente`nprostat~ sunt`mp~r[ite `n4 marigrupuriA, B,E,F `n
conformitatecustructuraineluluideciclopentene#ifiecaredinacestegrupuriestesubdivi
zat`nconformitatecupozi[ia#inum~ruldublelorleg~turidinlan[(deaceeaPGE3indic~PG
detipEcu3dubleleg~turi`nlan[).GrupulEdeprostaglandineestecomponent~major~a
tractului reproductiv la b~rba[i, `n timp ce grupul F predomin~ `n sistemul feminin. Fuchs
(1976)araportatnivelulprostaglandinelorseminalelaom,astfel:PGE1=20g/ml,PGE2=
15g/ml,PGE1+E219OH=100g/ml;PGA1+A2=9g/ml,PGA1+A219 HO=31
g/ml, PGF 1alfa = 3 g/ml #i PGF 2alfa = 4 g/ml. Ace#ti componen[i sunt agen[i
farmacologici foarte activi, care au fost implica[i `ntrun num~r mare de evenimente
biologice `n corp, incluz]nd erec[ia, ejacularea, mobilitatea spermei #i transportul. `n plus,
prostaglandineledepozitateodat~cuejaculatul`nvaginmodific~mucusulcerviceal,secre[ia
vaginal~ #i transportul spermatozoizilor `n tractul genital feminin. Chandry (1994) a
investigat rela[ia dintre metabolismul prostaglandinelor #i HBP sau cancerul de prostat~.
PGE a fost asociat~ cu efectul imunosupresor al fluidului seminal mediat de organitele
extracelulare numite protozomi. Olin (1993) a investigat efectul facilizant al
prostaglandinelorasuprafertilit~[ii.

Colesterolul #i lipidele. Lipidele din sperm~ au fost descrise de Scott (1945), care a
ar~tatc~plasmaseminal~con[inelipidetotale,colesterol,fosfolipide.Vignon(1992)deter
min~ compozi[ia secre[iei prostatice astfel: lipide totale 186 mg/100 ml, colesterol 80
mg/100 ml, fosfolipide 180 mg/100 ml. Fosfolipidele din fluidul seminal sunt compuse din
44% sfingomielin~, 12,3% plasmalogen etanolamin~ #i 11,2% fosfatidilserin~. Nivelele
raportate ale colesterolului `n fluidul seminal au variat considerabil de la 11 mg/100 ml la
103mg/100ml.White(1975)a stabilitc~raportul`ntrecolesterol#ifosfolipide `nplasma
seminal~ stabilizeaz~ sperma `mpotriva temperaturii mediului `nconjur~tor. Rohan (1995)
analizeaz~roluldieteilipidice`npatogeniacanceruluideprostat~.

Zincul.Nivelul`naltalzincului`nfluidulseminalalomului(140g/ml)`#iareoriginea,
`nprincipal,dinsecre[iileglandelorprostatice(488g/ml18g/ml),undeexist~ceamai
mare concentra[ie de zinc (50 mg/ 100 g de [esut uscat) dintre toate organele. Mackenzie
(1962) arat~ c~ lichidul seminal uman con[ine 310 mg/Zn/100 g [esut uscat, iar spermato
zoizii con[in 200 mg/100 g [esut uscat. Secre[iile prostatice la subiec[ii normali au 720 g
Zn/100 g [esut uscat. Zinc65 `n prostata omului a fost localizat `n celulele epiteliale prin
metoderadioimune.Administrareaoral~azinculuipoatefiimportant~,darconcentra[ialui
`nprostat~estemultmaimaredec]tnecesarul.Nivelulzinculuiestecrescutsauconstant`n
HBP,`ntimpceosc~deremarcat~azinculuiseconstat~`ncanceruldeprostat~.Zinculleag~
multeproteine.
Heathcote #i Washington (1973) descriu o protein~ care leag~ zincul la pacien[ii cu
HBP care au nivele crescute de histidin~ #i alanin~. Fair #i Wehner (1976) sugereaz~ rolul
zincului ca factor antibacterian prostatic. `ntrun studiu pe 36 de b~rba[i, f~r~ infec[ii
prostatice,valoareamedieazinculuiafostdeaproximativ350g/ml,cuovaria[ie`ntre150
1.000 g/ml. `n compara[ie, fluidul recoltat `n 61 de specimene de la 15 pacien[i cu
98

Capitolul2.Fiziologiaaparatuluiurogenital

prostatit~ cronic~ bacterian~ documentat~, sa constatat o sc~dere cu 80% a zincului,


respectiv 50 g/ml cu o varia[ie de la 0 la 139 g/ml. Autorii propun o valoare inferioar~
limit~anormaluluide150g/ml.Studiileinvitrocuioniliberidezinclavaloarenormal~au
confirmat activitatea antibacterian~ a fluidului prostatic asupragermenilor grampozitivi #i
gramnegativi. O cantitate mare a zincului `n prostat~ este legat~ de o protein~ (metalo
tioneina), dar nu se cunoa#te dac~ acest factor poate altera propriet~[ile biologice ale
zincului.

Proteineleprostaticesecretate.Electroforezacurezolu[ie`nalt~`nplanbidimensio
nal a ejaculatului, fluidului seminal #i secre[iei prostatice a identificat profilul proteic al
acestorsecre[ii.Sunttreiproteinemajoresecretatedeprostat~:1)PSA(numit~#isemino
protein~),2)PAP#i3)proteinaspecific~prostatic~(PSP94)saumicroseminoproteinasau
inhibina.Acestetreiproteinepotfiidentificateimunohistochimic`nceluleleepitelialeale
prostatei(Yousef#icol.,1999;Nelson#icol.,1999).

Antigenulprostaticspecific(PSA)(asevedeacapitoluldepatologieprostatic~)

Fosfatazeleacideprostatice(FAP)
ActivitateaFAPestede200deorimaimare`n[esutulprostaticdec]t`nalte[esuturi.
Prostataesteresponsabil~pentrunivelulcrescutalFAP`nejaculat.Fosfatazelesuntenzime
carehidrolizeaz~multetipurideesteriorganicidemonofosfat`nionianorganicidefosfat#i
alcool. Multe fosfataze `#i exercit~ ac[iunea optim~ `n mediul acid (pH=46) sau alcalin
(pH=811)#ideaceeaseclasific~`nfosfatazeacide#ifosfatazealcaline.Celedou~fosfataze
suntubigvitare`n[esuturileanimale.Laom,FAPesteundimerdeglicoprotein~cugreutatea
de 102.000 MW, din care 7% este carbohidrat, care se compune din zaharuri neutre
(fructoz~,galatoz~#imonoz~),acidsialic,Nacetilglucozamin~.Proteinapoatefidisociat~`n
dou~ subunit~[i de 50.000 MW. Multe proteine secretorii #i enzime secretate `n prostat~
suntglicozilatedup~ceaufostsintetizate#ilafelse`nt]mpl~cuizoenzimeleFAP.Interesul
pentru dozarea FAP `n ser, ca m~sur~ a metastazelor produse de cancerul de prostat~, a
sc~zutodat~cuapari[iaPSA,careestemultmaisensibil#ispecificpentruaceast~afec[iune
(Romas#iKwan,1993).

Antigenulprostaticspecificmembranar(APSM)
APSM este o protein~ legat~ de membrana celulei epiteliale prostatice. Nu este o
protein~ secretorie. A fost preparat un anticorp monoclonal pentru identificarea acestei
proteine care reac[ioneaz~ slab `n prostata normal~ sau cu HBP #i puternic `n cancerul de
prostat~. Anticorpul nu reac[ioneaz~ cu alte tumori sau cu alte [esuturi normale. Expresia
APSM`ntumorileprostaticesecoreleaz~cugraduldediferen[iereatumorii,#inucustadiul
tumoral. Anticorpul monoclonal pentru APSM a fost legat de Indium111 #i se `ncearc~
detectareaimagistic~aluicaomodalitatedelocalizareametastazelorcanceruluiprostatic
#idediagnosticprecocearecuren[eiboliidup~prostatectomiaradical~.Importan[aclinic~a
APSM pentru diagnostic, monitorizarea #i imagistica cancerului de prostat~ este `nc~ `n
investiga[ie.Oalt~protein~specific~prostatic~,cu94aminoacizi(PSP94),afostdescris~`n
secre[iile prostatice #i se studiaz~ utilitatea ei pentru diagnosticul #i monitorizarea
canceruluideprostat~(Ulvsback#icol.,1989).
Leucinaminopeptidoza(LAP)
Prostataestebogat~`narilamidaz~,untipdeLAPcuoactivitate`nfluidulprostatic
de 30.000U/ml. LAP este un produs al celulelor epiteliale prostatice, care este secretat `n

99

TratatdeUrologie

lumenulacinilor.Afostdemonstratc~extracteledinariileprostaticeafectatedecancerde
prostat~con[inmaipu[inLAPdec]tariileafectatedeHBP.
Lacticodehidrogenaza(LDH)
Izoenzime LDH `n sperma uman~ pot fi alterate la pacien[ii cu cancer de prostat~.
SauobservatnivelecrescutealeLDHIV#iLDHVcareapar`n[esutulcancerosprostatic.

Imunoglobulinele,complementulC3#itransferina
Suntmulterapoartecarearat~prezen[aimunoglobulinelor`nlichidulseminallaom.
Poatefim~surat~IgG=712mg/100ml#iIgA=06mg/100ml,IgMestefoartesc~zut~#i
nupoatefidetectat~.Sursaacestoranticorpinuestecunoscut~,de#ieiseg~sesc`nfluidul
prostatic exprimat #i pot fi corela[i cu prezen[a infec[iei. Obi#nuit, ace#ti anticorpi sunt la
nivelefoartesc~zute`nplasmaseminal~fa[~des]nge#iexist~posibilitateadifuzieilorprin
barieras]ngeplasm~seminal~.Lichidulprostaticexprimatcon[inecantit~[iconsiderabilede
complementC3=1,82mg/100ml#iacestacre#tede10ori`nfluidulcolectatdelapacien[ii
cucancerdeprostat~(lanivelde16,9mg/100ml)(Blenk#iHofstetter,1991).Prostatitele#i
HBPaufostcorelatecunivelecrescutede2dou~orialeC3.Oprotein~transportatoarede
ioni,transferina,cre#te`naceea#imanier~merg]nddelanivelde5,3mg/dl`nfluidulpros
tatic normal la 42,4 mg/dl `n caz de cancer de prostat~. Func[ionalitatea acestor proteine
prezente`nsecre[iaprostatic~trebuies~fieaprofundat~.

Proteinelesecretatedeglandeleseminale
Glandeleseminalesecret~proteinemajore#ienzimeimplicate`ncoagularearapid~
a ejaculatului. Cea mai important~ protein~ care produce coagularea se nume#te
seminogelin, care este antigenul seminal specific. Aceste proteine din glandele seminale
servesc ca substrat pentru PSA din prostat~, care enzimatic lizeaz~ cheagul seminal prin
activitateaproteazic~(Harvey#icol.,1995).`nspatele acesteireac[iidecoagulare nueste
bine definit rolul acestor proteine din veziculele seminale, dar se cunoa#te efectul de
fertilizare #i cre#tere a mobilit~[ii spermatozoizilor. Multe din proteinele secretate de
glandeleseminalesuntsubcontrolandrogenic.

Coagularea#ilichefiereaspermei
`n5minutedup~ejaculare,spermauman~secoaguleaz~form]ndungelsemisolid#i
dup~ alte 520 minute cheagul se lichefiaz~ spontan, form]nd un lichid v]scos. Substan[ele
careleag~calciul,cumsuntcitratuldeNa#iheparina,nuinhib~acestprocesdecoagulare#i
nici protrombina, fibrinogenul sau factorul XII, deoarece ele nu sunt prezente `n plasma
seminal~(Zaneveld#iChatterton,1982).Cheagulseminalesteformatdinfibre0,1510nm
grosime #i morfologia lui difer~ de cea a cheagului de fibrin~. Factorii care influen[eaz~
coagularea s]ngelui nu regleaz~ v]scozitatea spermei. De aici rezult~ c~ la om coagularea
spermeidifer~decoagulareas]ngelui.
Examinarea ejaculatului pe etape indic~ faptul c~ prima frac[iune, originar~ din
glandeleCowper#iprostat~,con[inefactoridelichefiere,iarfrac[iuneafinal~aejaculatului,
bogat~`nsecre[iialeglandelorseminale,esteresponsabil~decoagulareaejaculatului.
Estedemultcunoscutfaptulc~fluidulprostaticareoactivitatefibrinolitic~#ic~2ml
din aceast~ secre[ie poate lichefia 100 ml de cheag de s]nge `n 18 ore la temperatura de
370C.Dou~tipurideenzimeproteolitice aufost identificate`nfluidulseminal,fiindfactori
majori ai procesului de lichefiere este vorba de activatorii de plasminogen #i PSA. Doi
activatori de plasminogen au fost izola[i `n fluidul spermatic; ei au greut~[i moleculare de
100

Capitolul2.Fiziologiaaparatuluiurogenital

70.000#i74.000#i parafi`nrudi[icuurokinazele.Ace#tiactivatorideplasminogen `#iau


originea`nsecre[iileprostatice.
Fluidulseminalcon[ineovarietatedealteenzimeproteoliticeincluz]ndpepsinogen,
lizozim, alfaamilaze, hialuronidaze. Sperma uman~ inhib~ activitatea enzimei proteolitice
tripsina#iaceastasefaceat]ttimpc]t`nplasmaseminal~suntprezen[iinhibitoricaalfa1
antitripsina #i alfa1antichimotripsina. Coagularea #i lichefierea variaz~ la diferitele specii
animale.
`nconcluzie, plasmaseminal~coaguleaz~#i selichefiaz~subcontrolenzimatic,dar
scopul biologic al acestui proces nu a fost determinat. Enzime #i proteine din glandele
seminale#iprostat~suntimplicate`nmecanismuldecoagulareaspermei.Saobservatc~
unii b~rba[i cu infertilitate au un deficit de lichefiere a spermei (Hagstrom #i col., 1992;
Aumuller#icol.,1990).

Fiziologiareproduceriimasculine(deconsultatcapitoluldeInfertilitate)

Fiziologiapenisului(deconsultatcapitoluldeDisfunc[ieerectil~)

Fiziologiaglandelorsuprarenale
Prof.Dr.P.Geavlete,Conf.Dr.V.Jinga

Suprarenalelepotfi`mp~r[itefunc[ional`ndou~organedistincte:cortextul#imedu
lara.Fiecareareofiziologieunic~#isecre[iiactivedeprodu#ihormonali.

Corticosuprarenala
Dintrunprecursorcomun,cortexulsuprarenaleiproduceoseriedehormonisteroizi
care au diferite ac[iuni, incluz]nd homeostazie metabolic~, echilibrul ionic #i dezvoltarea
caracterelor sexuale. Pregnenolonul, structura steroid~ bazal~, este derivat din colesterol.
Zona glomerular~ este singura surs~ de hormon mineralocorticoid (aldosteronul) care
regleaz~reabsorb[iaNa+lanivelulrinichilor,glandelorsalivare#isudoripare(Moore,1989).
Celelalte zone produc #i secret~ cortizolul, principalul glucocorticoid la om, #i androgenii
principali: dehidroepiondrasteronul (DHEA), dihidroepiondrosteronul sulfatat (DHEAS) #i
androstenediolul.Ratadelimitareaform~riiacestorhormoniesteproduc[iadepregnenolon
(Madrazo,1987).Deficien[auneiadincelecincienzime,necesarepentruconversiacoleste
rolului `n cortizol, produce o boal~ familial~ numit~ hiperplazia adrenalian~ congenital~
(Bornstein, 1991). Lipsa acestei enzime blocheaz~ feedbackul hipofizar cu hiperplazia
suprarenalian~ #i precursori proximali `n exces. Excesul unuia dintre produ#ii steroizi d~
semnele #i simptomele caracteristice sindromului Cushing, hiperaldosteronismul primar
(sindromulConn)saucarcinomulsuprarenal.
Acesteentit~[ipatologicepotfirecunoscutepebazasimptomatologieiclinice#ibio
umoralfolosindtestediagnostice.Astfel,stimulareacuACTH(corticotropin~)esteutilizat~
pentru diagnosticul insuficien[ei suprarenaliene; suprimarea cu dexametazon~, un gluco
corticoidsintetic,esteutil~pentruaidentificatipuriledesindromCushing.

Reglareasecre[ieihormonale
Reglarea secre[iei de corticosteroizi implic~ o interac[iune complex~ `ntre hipotala
mus, hipofiz~ #i glandele suprarenale. ACTH este un polipeptid cu 39 aminoacizi, care
exercit~ o ac[iune major~ asupra cortexului suprarenalian. ACTH este produs dintro
101

TratatdeUrologie

protein~ mai mare (290 de aminoacizi) numit~ propiomelanocortin (PMC). Al[i deriva[i de
PMCsunt: lipoproteina,hormonul alfastimulator almelanocitelor (alfaMSH),MSH,
endorfina#iencefalinelemetionine(Carey,1986).Secre[iadeACTHestecaracterizat~deun
ritm diurn inerent, care conduce la modific~ri paralele `ntre secre[ia de cortizol #i ACTH
(Lindzey#iKorach,1997).
Absen[a varia[iilor normale ale cortizolului plasmatic se `nt]lne#te la pacien[ii cu
sindrom Cushing. Hormonul eliberator al ACTH este corticotropin releasinghormonul (CT
RH) sintetizat `n hipotalamus #i transportat `n hipofiza anterioar~ printrun sistem port
sangvin.CTRHesteunpolipeptidformatdin41deaminoacizicarestimuleaz~eliberareade
ACTH,ca#iacelorlal[iprodu#idePMC,printrunmecanismcAMPdependent,carenecesit~
calciu(Tepperman,1987).
Al[i stimulatori ai ACTH sunt vasopresina, oxitocina, adrenalina, angiotensina II,
peptidulvasoactivintestinal(VIP),serotonina, peptidul eliberatordegastrin~,factorulacid
natriuretic#iacidulgamaaminobutiric(GABA)(Antoni,1986).`nfinal,secre[iadeACTHeste
`nleg~tur~reciproc~cunivelulcortizoluluicirculant.

Fig.1. Ritmul circadian al


secre[iei de cortizol `n plasm~ la
subiectulnormal`ncompara[iecu
absen[a acestui ritm la pacien[ii
cu sindrom Cushing (modificat
dup~ Bergland RM, Harrison TS:
Pituitaryandadrenal.InSchwartz
SI [ed]: Principles of Surgery, 3rd
ed.NewYork,McGrawHill,1979,
p1493.)

Produc[ia de androgeni suprarenalieni `n zona reticulat~ #i fasciculat~ este, de


asemenea,subinfluen[aACTH,dar#ialtemecanismesuntimplicate.NiveluldeDHEAcre#te
dup~ administrarea de ACTH, o cre#tere tardiv~ se produce asupra DHEAS datorit~ unei
conversiispecifice`ncetinite(Laragh#iSealey,1992).
Suntsitua[iic]ndstimulareaandrogenilorsuprarenaliestedisociat~deACTH.Aceste
situa[iiincludpubertatea,`mb~tr]nirea,stresul(Laragh#iSealey,1992).Spredeosebirede
glucocorticoizi#iandrogeniisuprarenali,controlulfiziologicprincipalalsecre[ieidealdoste
ronesteexercitatdeangiotensinaII(Hubbard#icol,1990).
Controlul ACTH este secundar. Cunoa#terea fiziologiei sistemului renin~
angiotensin~aldosteron (SRAA) este necesar~ pentru `n[elegerea fiziopatologiei hiperaldo
steronismuluiprimar#ievaluareaacestorpacien[i.
SenzorulprincipalalSRAAsesitueaz~lanivelulaparatuluijuxtaglomerulardinrinichi.
Ca r~spuns la diferi[i stimuli, dar `n special la reducerea perfuziei renale (Fig.42), aceast~
eliberare de renin~ conduce la formarea deangiotensinaII #i asecre[iei implicit~ de aldo
steron,cuefectdere[inereasodiului#iderestabilireaperfuzieirenale(Fig.43).Invers,dac~
exist~ o reten[ie de Na+, secre[ia de renin~ este inhibat~, scade secre[ia de aldosteron #i
cre#teexcre[iarenal~deNa+.Aceast~rela[ie`ntrenivelulrenineiplasmatice,nivelulaldoste
ronului#iexcre[iaurinar~deNa+afoststudiat~pecazurivoluntare.
102

Capitolul2.Fiziologiaaparatuluiurogenital

ANGIOTENSINOGEN ( alfa 2 - GLOBULIN)


ACTIVAT DE :

RENINA

PRESIUNEA DE PERFUZIE SCZUT

APORTUL SCZUT DE SODIU


beta - AGONITI
PROSTAGLANDINE
c AMP CELULAR CRESCUT

INHIBAT DE :
PRESIUNEA DE PERFUZIE CRESCUT
APORTUL CRESCUT DE SODIU
beta - BLOCANI
ANGIOTENSINA II
Ca 2+ CELULAR CRESCUT
VASOPRESINA
PEPTIDUL NATRIURETIC ATRIAL

H2N- Asp1 - Arg2 - Val3 - Tir4 - Ile5 - His6 - Pro7 - Phe8 - His9 - Leu10 - OH
ANGIOTENSINA I
ENZIMA DE CONVERSIE
LISINOPRIL, ENALAPRIL,
INHIBAT DE :
CAPTOPRIL
H2N- Asp1 - Arg2 - Val3 - Tir4 - Ile5 - His6 - Pro7 - Phe8 - OH
ANGIOTENSINA II ( AII)
RECEPTOR ( AII)
ACTIVAREA RECEPTORILOR ARE CA REZULTAT

VASOCONSTRICIA
RETENIA DE SODIU
ELIBERAREA ALDOSTERONULUI
ELIBERAREA CATECOLAMINELOR

AII ANALOGII BLOCHEAZ AII RECEPTORII


SARCOSINE
VALINE
ALANINE

Fig.2.
Figur
2. Factorii care activeaz i inhib sistemul renin-angiotensin-aldosteron.

Aldoileastimulator,maipu[ineficient,pentrueliberareaaldosteronuluiestepotasiul
(K+). Exist~ un sistem cibernetic secundar pentru controlul K+ seric care implic~ SRAA
(Chrousos, 1995). La pacien[ii cu hipokaliemie #i hiperaldosteronism, hipokaliemia scade
secre[iadealdosteroncurevenirealanormalaniveluluiplasmaticalK+(Biglieri#icol,1990).

Fig.3.Controlulsecre[ieide
aldosteron#irela[iadefeedback
cucircuitulrenin~angiotensin~
#ipotasiu.

Ac[iuneahormonilor
To[i hormonii steroizi difuzeaz~ pasiv `n celul~ #i apoi se leag~ de cap~tul terminal
amino al unui receptor, protein~ cu `nalt~ afinitate din citosol, pentru a forma complexul
steroidreceptor. Complexul se transform~ `ntro form~ activ~ #i apoi migreaz~ `n nucleu
(Nelson,1980).`nnucleurezult~adouaactivare,careconst~`nstimulareatranscrip[ieiprin
interac[iuneacuungrupspecificdegenesteroidreglatoare,rezult]ndunnouARN#isinteza
specific~ proteic~ (Derksensi #i col, 1994). `n plus, glucocorticoizii au o cale nonnuclear~
103

TratatdeUrologie

careesteimportant~`ncontrolulACTH.Numeroaseleactivit~[ialeacesteic~iincludinhibi[ia
sintezeiprostaglandinelor,inhibi[iafluxuluidecalciu,inhibi[iacAMPproteinkinazei#ialtele
(Laragh#iSealey,1992).
Glucocorticoiziisuntesen[ialipentruvia[~prinefectulexercitatasupraunuispectru
largdereac[iidinmetabolismulcelular,incluz]ndacumulareaglicogenului`nficat#imu#chi,
stimulareagluconeogenezei,utilizareaperiferic~redus~aglucozei.Suntimplica[i`ntroserie
de procese patologice: miopatie, osteopatie, inflama[ie mediat~ imun #i numeroase inter
ac[iunicual[ihormoni(tabelul5)(Manger#iGifford,1990).
Aldosteronul asigur~ 95% din activitatea mineralocorticoizilor #i serve#te pentru
men[inereabalan[eiNa+#iK+.Locuriledeactivitateincludrinichiul#iglandelesalivare.

Tabelul2.Efectele#iimplica[iileglucocorticoizilor

Efecte
Cre#tecontrac[iamuschiuluischeletic#i
cardiac
Stimuleaz~catabolismulproteic
Inhib~metabolismulosos
Inhib~sintezacolagenului
Cre#tecontractilitateavascular~#iscade
permeabilitatea
Activitateaantiinflamatorie
Activitatedeinhibareasistemuluiimun
Men[infiltrareaglomerular~normal~

Implica[iiclinice
Absen[ascadefor[adecontrac[iecuastenie
Excesulproduceslabire`ngreutate#iastenie
Excesulscademasaosoas~
Excesulproduceopielesub[irecucapilarefragile
Absen[afacedificil~men[inereapresiunii
sangvine
Administrareasteroizilorpentrutratamentul
afec[iunilorinflamatorii
Administrareasteroiziloresteutil~`ntratamentul
bolilorimune#itransplant
Absen[areducefiltrareaglomerular~

Laacestnivel,efectullorestedereabsorb[ieaNa+#icre#tereasecre[ieideK+#iH+
pecaleaactiv~riiNaKATPazeisauactivareapermeazei`nmembranaluminal~(Winkler#i
Smith,1975).
Androgenii suprarenali sunt slab activi `n compara[ie cu testosteronul testicular #i
apar relevan[i doar`nst~ripatologice,cumestehiperplaziacongenital~suprarenalian~,`n
careexist~unexcesdeproduc[ieandrogenic~.

Metabolismul
Eliberarea acestor steroizi, metabolismul lor #i calea de excre[ie joac~ un rol
important`n`n[elegereatestelorfolositepentrudiagnosticuldisfunc[iilorsuprarenaliene.`n
circula[ie, 80% din cortizol este legat de o globulin~ care leag~ corticosterona (CBG,
transcortin); 1015% este legat de albumine #i 710% este liber. Legarea variabil~ de
proteineinfluen[eaz~cortizolulplasmatictotal,darnucortizolulliber,careesteactivmeta
bolic (Iverson, 1975). Dozarea cortizolului plasmatic este posibil~ folosind tehnici fluoro
metricesau radioimune. Varia[ia diurn~ a cortizolului plasmatic #ir~spunsul lasupresiacu
dexametazon~audevenittesteesen[ialepentrudiagnosticulsindromuluiCushing.Cortizolul
urinar liber este, de asemenea, folosit ca test screening, de#i 3,3% din pacien[ii obezi sau
bolnavii cronici au valori ridicate, iar valorile nu sunt bine stabilite la copii (Reckler #i col,
1989). Dificult~[i au fost `nt]lnite `n stabilirea limitelor superioare ale secre[iei 17hidroxi
steroizilor.Eiauovaloaremaimare`nevaluareafunc[ieinormaleasuprarenalei#ipentru
diagnosticulinsuficien[eisuprarenalesauhiperplazieisuprarenalienecongenitale`ncare17
HS au valori sc~zute #i nivelul 11hidroxilazei este crescut. Nu este `n[eles `n totalitate
controlul androgenilor suprarenali, de#i sa pus `n eviden[~ un mecanism de reglare a
104

Capitolul2.Fiziologiaaparatuluiurogenital

secre[iei lor prin intermediul ACTH. Conversia periferic~ a DHEA #i DHEAS contribuie la
stabilirea nivelului DHEAS (Orth, 1995). DHEA nu prezint~ varia[ii diurne. DHEA nu este
produs `n cantit~[i semnificative de alte organe, cu excep[ia bolii chistice ovariene #i
tumorilegonadiceproduc~toaredeandrogeni(Nelson,1980).Pacien[iicunivelecrescutede
DHEA au #i nivel crescut de 17cetosteroizi (17CS) care, de altfel, nu produc virilizare.
NivelelecrescutedeDHEA,aldostenedion~sau17CS`nafarapropor[ieideglucocorticoizise
`nt]lnesc `n carcinomul suprarenal (Cohn #i col, 1986). Dintre aceste teste de func[ie
androgenic~suprarenal~,valoareaplasmatic~aDHEASesteceamaifolosit~ast~zi#ieste
maifidel~dec]tceaaandrostenedionei.Valorilecrescutealeconcentra[ieitestosteronului#i
DHEAsuntunmarkeralprezen[eitumorilorsuprarenalelafemeilecareprezint~hirsutism#i
sunt folosite ca teste screening pentru 5% din femeile cu hirsutism care au o patologie
suprarenal~ semnificativ~ (Derksen #i col, 1994). Aldosteronul, cel mai important hormon
care re[ine sodiul, este secretat de zona glomerular~, este slab legat de albumin~ #i
proteinele plasmatice (Laragh #i Sealey, 1992) #i are o via[~ scurt~ de 2030 de minute.
Aldosteronul plasmatic poate fi m~surat prin tehnici radioimune, iar valorile plasmatice
trebuie corelate cu Na+ plasmatic. La fel de fidele sunt doz~rile urinare ale aldosteronului
excretat`naceea#imanier~.

Medulosuprarenala

Este format~ din numeroase celule cromafine care `n principal secret~ adrenalina,
noradrenalina#idopamina.Faptulc~acestecelulesecoloreaz~`nchisc]ndsuntexpusela
s~rurile de crom este rezultatul oxid~rii adrenalinei #i noradrenalinei, de unde deriv~ #i
denumirea de celule cromafine. Enzima etanolaminaNmetiltransferaza (EAMT), care
catalizeaz~metilareanoradrenalineipentruaformaadrenalina,estelocalizat~`nmedulara
suprarenalei (Mueller, 1970). De aceea, dac~ exist~ produc[ie excesiv~ de adrenalin~ #i
noradrenalin~,cauzaeste`ntotdeaunaoleziuneamedulosuprarenalei,#inu`nalte[esuturi
cucelulecromafine.Datelesugereaz~c~nivelelecrescutedeglucocorticoizisuntnecesare
pentru men[inerea nivelului crescut al EAMT #i, prin aceasta, a secre[iei de adrenalin~
(Manger#iGifford,1990).Acesteobserva[iiexplic~unicalocalizareamedulosuprarenalei#i
sistemulcentraldedrenajvenosdinsuprarenalecarescald~celulelemedularecucantit~[i
crescutedeglucocorticoizi.Sintezacatecolaminelor`ncepecutirozina#ifenilaminadindiet~
care sunt substratul. Sinteza catecolaminelor se desf~#oar~ `n suprarenale, `n sistemul
nervos central #i `n termina[iile nervilor adrenergici. Activarea #i suprimarea activit~[ii
tirozinhidroxilazei sunt reglatorii majori ai biosintezei catecolaminelor (Winkler #i Smith,
1975) care pot fi influen[a[i de corticosuprarenal~. Noradrenalina este principala
catecolamin~secretat~denerviisimpatici.Studiilepeoamenis~n~to#iauindicatfaptulc~
dopamina plasmatic~ reprezint~ 13% din catecolaminele libere, adrenalina 14% #i
noradrenalina 73%. Catecolaminele sunt depozitate `n vezicule separate al~turi de ATP #i
enzima dopaminhidroxilaz~. Stimularea nervilor preganglionari simpatici `n timpul
stresului, durerii, expunerii la `nghe[ sau c~ldur~, asfixia, hipotensiunea, hipoglicemia,
deple[ia de Na+, toate cresc eliberarea de catecolamine. Dup~ stimulare, con[inutul
veziculeloresteeliberatprinexocitoz~.`nplus,catecolaminelepotfieliberatef~r~stimulare
simpatic~#iposibilf~r~exocitoz~unfenomencareaparelapacien[iicufeocromocitom.
Metabolismulcatecolaminelor.Catecolaminele(CA)suntrapideliberatedincircula
[ie, cu un timp de `njum~t~[ire mai mic de 20 de secunde (Ferrerira #i Vane, 1967).
Recaptareaneural~estedemareimportan[~`neliberareanoradrenalineidinsinapsepentru

105

TratatdeUrologie

afireeliberat~(Iverson,1975).CAsuntdegradateprinac[iuneacatecolaminometilentrans
ferazei (COMT) #i monoaminooxidazei (MAO). Procesul de degradare `ncepe cu ambele
enzime simultan. Metabolitul principal `n urin~ este acidul vanilmandelic (VMA), care este
determinatlapacien[iicufeocromocitomal~turicealteprodusemetabolicedetipulmeta
nefrinei#inormetanefrinei(Reckler,1989).

Ac[iunea catecolaminelor. Catecolaminele exercit~ un efect variat prin stimularea


receptorilorspecifici(adrenoreceptorii)caresuntlocusurideproteinedelegare(tabelul3).
Diversitateaefectelorcatecolaminelorcirculanteasupraorganelorcontribuielaconturarea
simptomelor pe care le prezint~ pacien[ii cu feocromocitom. Mai mult de at]t, diferite
tumori pot produce adrenalina, noradrenalina sau dopamin~ `n concentra[ii variabile.
Ac[iuneaadrenalinei#inoradrenalineiestedependent~dedoz~.`nfelulacesta,clasificarea
hormoniloradrenergicinaturalicaalfasaubeta#iainhibitorilorcaalfa#ibetaantagoni#ti,
esteutil~,darnucaracterizeaz~pedeplinactivitateahormonilorsauantagoni#tilor`ndife
ritelesitua[iiclinice.

Tabelul3.Receptoriicatecolaminelor(adrenoreceptorii).

Alfaadrenergici
Alfa1

Betaadrenergici
Beta1

Agoni#tiipostsinaptici
Musculaturaneted~vascular~vasoconstric[ie
Prostatacontrac[ie
Ficatglicogenez~

Inimaefectinotropic#icromotropic
Adipocitelipoliz~
Rinichistimuleaz~eliberareareninei

Beta2
Pl~m]nibronhodilata[ie
Musculaturaneted~vascular~vasodilata[ie
Uterrelaxare
Tubdigestivrelaxare

Dopaminergici
DA1:Vascularvasodilata[ie
DA2:Presinapticinhib~eliberareanoradrenalinei

Afla2
Presinapticinhib~eliberareanoradrenalinei
Postsinapticagonist
Venelemarivasoconstric[ie
Creierscadeinfluxulsinaptic
Pancreasinhib~secre[iadeinsulin~
Tubuldigrestivrelaxare
Adipociteinhib~lipoliza

Bibliografie

1.
2.
3.
4.
5.
6.
7.

AlpernRJ,CoganMG,RectorFCJrEffectsofluminalbicarbonateconcentrationonproximalacidifica
tionintherat.AmJPhysiol1982;243:F53.
AmannRPAcriticalreviewofmethodsforevaluationofspermatogenesisfromseminalcharacteristics.
JAndrol1981;2:37.
AnderssonKEPharmacologyoflowerurinarytractsmoothmuscleaipenileerectiletissues.Pharmacol
Rev1993;45:253307.
AntoniFHypothalamic controlofadrenocorticotropinsecretion:Advancessincethediscoveryof 41
residuecorticotropinreleasingfactor.EndocrRev1986;7:351.
Aoki H, Matsuzaka J, Yeh KH, et al. Involvement of vasoactive intestinal peptide (VIP) as a humoral
mediatorofpenileerectilefunctioninthedog.JAndrol1994;15:174182.
AumullerG,SeitzJ,LiljaH,etal.Speciesspecificityandorganspecificityofsecretoryproteinsderived
fromhumanprostateandseminalvesicle.Prostate1990;17:3140.
Aumuller G, Seitz J Protein secretion and secretory processes in male sex accessory glands. Int Rev
Cytol1990;121:127231.

106

Capitolul2.Fiziologiaaparatuluiurogenital

8.
9.
10.
11.
12.
13.
14.
15.
16.
17.
18.
19.
20.
21.
22.
23.
24.
25.
26.
27.

28.
29.
30.
31.
32.
33.
34.
35.

BarajasLAnatomyoftheJuxtaglomerularApparatus.Am.J.Physiol.237:F333F343,1979.
BentleyH,HamdyFC,HartKA,etal.Progressionofbonemorphogeneticproteinsinhumanprostate
adenocarcinomaandbenignprostatichyperplasia.BrJCancer1992;66:11591163.
Berggren A, Rubenson A, Sillen U Involvement of opioid mechanisms `n peripheral motor control of
detrusormuscle.PharmacolToxicol1992;71:179184.
BerlinerRWHarveyLect.,1961,55,141.
Biglieri EG, Irony I, Kater CE Adrenocortical formsof human hypertension.In LaraghJH,Brenner BM
(eds):Hypertension:Pathophysiology,Diagnosis,andManagement.NewYork,RavenPress,1990.
BlantzRC,PelayoJCDisordersofGlomerularFiltration.NewYork:PlenumMedical,p.919938,1986.
Blenk H, Hofstetter A Complement C3, coeruloplasmin and PMNelastase in the ejaculate in chronic
prostatoadnexitisandtheirdiagnosticvalue.Infection1991;19(Suppl3):S138S140.
BlobelCP,MylesDG,PrimakoffP,WhiteJMProteolyticprocessingofaproteininvolvedinspermegg
fusioncorrelateswithacquisitionoffertilizationcompetence.JCellBiol1990;111:6978.
Blumfeld DJ, Vaughan ED Renal Phzsiology and Pathophysiology in Campbells Urology, Patrick C.
Walsh,EightEdition2003.
BomsztzkK,WrightFSDependenceofionfluxesonfluidtransportbyratproximaltubule.AmJPhysiol
1986.
BornsteinSR,EhrhartBornsteinM,UsadelH,etal.Morphologicalevidenceforacloseinteractionof
chromaffincellswithcorticalcellswithintheadrenalgland.CellTissueRes1991;265:19.
Bosch RJ, Benard F, Aboseif SR, et al. Penile detumescence: Characterization of three phases. J Urol
1991;146:867871.
Brenner BM, Hostetter TH, Humes HD Glomerular Permselectivity: Barrier Function Based on
DiscriminationofMolecularSizeandCharge.Am.J.Physiol.234:F455F460,1978.
BruschiniH,SchmidtRA,TanaghoEAStudiesontheneurophysiologyofthevasdeferens.InvestUrol
1977;15:112.
Burnstock G: Structure of smooth muscle and its innervation. In Blbring E, Brading AF, Jones AW,
TomitaT(eds):SmoothMuscle.Baltimore,Williams&Wilkins,1970,pp169.
Bushinsky DA, Coe FL, Katzenberg C, et al. Arterial PCO2 in chronic metabolic acidosis. Kidney Int
1982;22:311314.
Bushinsky DA, Lechleider RJ Mechanism of protoninduced bone calcium release: Calcium carbonate
release.AmJPhysiol1987.
Carey RM, Sen S Recent progress in the control of aldosterone secretion. Rec Prog Hormone Res
1986;42:251.
Carter JN, Tyson JE, Tolis G et al. Prolactinsecretingtumors and hypogonadism in 22 men. N Engl J
Med1978;299(l6):847852.
ChristGJ,MorenoAP,ParkerME,etal.Intercellularcommunicationthroughgapjunctions:Apotential
roleinpharmacomechanicalcouplingandsyncytialtissuecontractioninvascularsmoothmuscleisolated
fromthehumancorpuscavernosum.LifeSci1991;49:PL195PL200.
Chrousos GP The hypothalamicpituitaryadrenal axis and immunemediated inflammation. N Engl J
Med1995;332:13511362.
ClarkJT,SmithER,DavidsonJMEvidenceformodulationofsexualbehaviorbyalphaadrenoceptorsin
malerats.Neuroendocrinology1985;41:3643.
CoganMG,MaddoxDA,WarnockDG,etal.Effectofacetazolamideonbicarbonatereabsorptioninthe
proximaltubuleoftherat.AmJPhysiol1979;237:F447F454.
Cogan MG, Rector FC Jr Acidbase disorders. In Brenner BM, Rector FC (eds): The Kidney, 4th ed.
Philadelphia,WBSaunders,1991,pp737804.
CohnK,GottesmanL,BrennanMAdrenocorticalcarcinoma.Surgery1986;100:1170.
ConnJWPrimaryhyperaldosteronism:Anewclinicalsyndrome.JLabClinMed1955a;45:3.
Constantinou CE Renal pelvic pacemaker control of ureteral peristaltic rate. Am J Physiol 1974;226:
1413.
CoplenDE,MacarakEJ,LevinRMDevelopmentalchangesinnormalfetalwholebladderphysiology.J
Urol1994;151:13911395.

107

TratatdeUrologie

36.
37.

38.

39.
40.
41.
42.
43.
44.
45.
46.

47.
48.
49.
50.
51.
52.
53.
54.
55.
56.
57.

58.
59.
60.

Corsi M, Pietra C, Toson G, et al. Pharmacological analysis of 5hydroxytryptamine (5HT) on


electricallyinducedcontractionsinthemouseurinarybladder.BrJPharmacol1991;104:719725.
Crowe R, Light K, Chilton CP, Burnstock G Vasoactive intestinal polypeptidesomaloslalinand
substancePimmunoreactivenervesinthesmoothandstrialemuscleoftheintrinsicexternalurethral
sphincterofpatienlswithspinalcordinjury.JUrol1986;136:487.
deGroatWC,SteersWDAutonomieregulationoftheurinarybladderandsexualorgans.InLoewyAD,
SpyerKM,eds:CentralRegulationoftheAutonomieFunctions,Isted.Oxford,OxfordUniversityPress,
1990,p313.
de Groat WC Regulation of urinary bladder capacity by endogenous opioid peptides. J Urol 1985;
133:339.
DelTacca M Acetylcholine content of and release from isolated pelviureteral tract. Naunyn
SchmiedebergsArchPharmacol1978;302:293.
DerksenJ,NagesserSK,MeindersAE,etal.Identificationofvirilizingadrenaltumorsinhirsutewomen.
NEnglJMed1994;331:1018973.
DerksenJ,NagesserSK,MeindersAE,etal.Identificationofvirilizingadrenaltumorsinhirsutewomen.
NEnglJMed1994;331:1018973.
DiZerga GS, Sherins RJ Endocrine control of adult testicular function. In Burger H, DeKretser D(eds):
TheTestis.NewYork,Raven,1981,p.127.
DorofteiuMMecanismelehomeostazieisangvine,Ed.Dacia,ClujNapoca,1989.
DuBose TD Jr Acidbase disorders. In Brenner BM (ed): Brenner and Rectors The Kidney, 6th ed.
Philadelphia,WBSaunders,2000,pp925997.
Edyvane KA, Smet PJ, Trussell DC, et al. Patterns of neuronal colocalisation of tyrosine hydroxylase,
neuropeptide Y, vasoactive intestinal polypeptide, calcitonin generelated peptide and substance P in
humanureter.JAutonNervSyst1994;48:241.
Edyvane KA, Trussell DC, Jonavicius J, et al. Presence and regional variation in peptidecontaining
nervesinthehumanureter.JAutonNervSyst1992;39:127.
Elbadawi A, Blaivas JG, eds Neurourology and Urodynamics: Principles and Practice. New York,
Macrnillan,1988,pp96105.
Emmett M, Alpern RJ, Seldin DW Metabolic acidosis. In Seldin DW, Giebisch G (eds): The Kidney:
PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,2752836.
FairWR,WehnerNTheprostaticantibacterialfactor:Identityandsignificance.InMarbergerH,etal
(eds):ProstaticDisease,vol6.NewYork,AlanRLiss,1976,pp383340.
FawcettDW,HofferAPFailureofexogenousandrogentopreventregressionoftheinitialsegmentsof
theratepididymisafterefferentductligationororchiectomy.BiolReprod1979;20:162.
Ferguson DR, Marchant JS Inhihitory actions of GABA on rabbit urinary bladder muscle strips:
Mediationbypotassiumchannels.BrJPharmacol1995;115:8183.
FerreriraSH,VaneJRHalflivesofpeptidesandaminesinthecirculation.Nature1967;215:1237.
Foote JW, Blennerhassett JB, Wigglesworth FW, MacKinnon KJ Observations on the ureteropelvic
junction.JUrol1970;104252.
GanongWFReviewofMedicalPhysiology,ed.aYHIa,LangemedicalPubl.,LosAltos,1977,552
566.
Geavlete P Anatomia #i fiziologia aparatului urinar. Tratat de patologie chirurgical~ sub redac[ia N.
Angelescu.Ed.Medical~,2003,pag.27672780.
GennariFJ,MaddoxDARenalregulationofacidbasehomeostasisIntegratedresponse.InSeldinDW,
GiebischG(eds):TheKidney:PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,pp2759
2836.
George NJR, O'Reilly PH Jr, Barnard RJ, Blacklock NJ Practical management of patients with dilated
uppertractsandchronicretentionofurine.BrJUrol1984;56:9.
Giovannucci E, Rimm EB, Wolk A, et al Calcium and fructose intake in relation to risk of prostate
cancer.CancerRes1998;58:442447.
GoldbergM,AgusSZ,GoldFachSRenalHandlungofPhosphate,CalciumandMagnezium.In:The
Kidney(subred.BrennerBM,RectorFC),W.B.Saunders&Comp.,PhiladelphiaLondraToronto,1976,
344390.

108

Capitolul2.Fiziologiaaparatuluiurogenital

61.
62.
63.
64.
65.
66.
67.
68.
69.
70.

71.
72.
73.
74.
75.
76.
77.
78.
79.
80.
81.
82.

83.
84.
85.
86.
87.

GoslingJA,DixonJS,LendonRGTheautonomieinnervationofthehumanmaleandfemalebladder
neckandproximalurethra.JUrol1977;118:302.
Gosling JA, Dixon JS, Humpherson JR Func[ional Anatomy of the Urinary Tract. Edinburgh, Churchill
Livingstone,1983,p1.
GoslingJA,DixonJSFunctionalobstructionoftheureterandrenalpelvis.Ahistologicalandelectron
microscopicstudy.BrJUrol1978;50:145.
GottschalckCW,LassiterWEMechanismsofUrineFormation.In:MedicalPhysiology(subred.Mount
CastleVB),vol.II,C.V.Mosby&Comp.,SaintLouis,1974,1065.
GramaMFiziologieCurs,AlmaMaterSibiu,2004,211225.
GriffithsDJThemechanicsofurinetransportintheupperurinarytract1983;2:155and2.Thedischarge
ofthebolusintothebladderanddynamicsathighratesofflow.NeurourolUrodyn1983;2:167.
GuptaG,RajalakshmiN,PrasadMRN,MoudgalNRAlterationofepididymalfunctionanditsrelationto
maturationofspermatozoa.Andrologia1974;6:35.
GuytonACTextbookofmedicalPhysiologyEd.VaW.B.,SaundersComp.PhiladelphiaLondonToronto
1976,386.
Hagstrom J, Harvey S, Wieben E Androgensare necessaryforthe establishment ofsecretoryprotein
expressionintheguineapigseminalvesicleepithelium.BiolReprod1992;47:768775.
HalperinML,KamelKS,EthierJH,etal.Biochemistryandphysiologyofammoniumexcretion.InSeldin
DW,GiebischG(eds):TheKidney:PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,pp
26452679.
HammLL,AlpernRJCellularmechanismsofrenaltubularacidification.InSeldinDW,GiebischG(eds)
TheKidney:PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,pp25812626
HannaMKSomeobservationsoncongenitalureteropelvicjunctionobstruction.Urology1978;12:151.
HarringtonJT,LemannJThemetabolicproductionanddisposalofacidandalkali.MedClinNorthAm
1970;54:15431554.
HarveyS,VrabelA,SmithS,WiebenEAndrogenregulationofanelastaselikeproteaseactivityinthe
seminalvesicle.BiolReprod1995;52:10591065.
Heathcote JG, Washington RJ Analysis of the zincbinding protein derived from the human benign
hypertrophicprostate.JEndocrinol1973;58:421423.
HebertSCMolecularmechanisms.SeminNephrol1999,504523..
HernndezM,SimonsenU,PrietoD,etal.Differentmuscarinicreceptorsubtypesmediatingthephasic
activityandbasaltoneofpigisolatedintravesicalureter.BrJPharmacol1993;110:1413.
Hernandez RE, Schambelan M, Cogan MG, et al. Dietary NaCl determines severity of potassium
depletioninducedmetabolicalkalosis.KidneyInt1987;31:13561367.
HolmesEW,KelleyWNTheRenalPathophysiologyoftheGout.In:PathophysiologyoftheKidney(sub
red.KurtzmanD.A.,MartinezMaldonadoM.)CharlesC.ThomasPubl.,Springfield,1976,696735.
HsuGL,BrockG,MartinezPineiroL,etalAnatomyandstrengthofthetunicaalbuginea:itsrelevance
topenileprosthesisextrusion.JUrol1994;151:12051208.
Hubbard MM, Kulaylat MM, Amabumrad NN Adrenocorticoidsphysiology regulation function and
metabolism.InScottHWJr(ed):SurgeryoftheAdrenalGlands.Philadelphia,JBLippincott,1990.
Ignarro LJ, Bush PA, Buga GM, et al Nitric oxide and cyclic GMP formation upon electrical field
stimulation cause relaxation of corpus cavernosum smooth muscle. Biochem Biophys Res Comm
1990;170:843850.
IversonLLUptakeofcirculatingcatecholamines.InBlaschkoH,SayersG,SmithAD(eds):Handbookof
Physiology.Washington,DC,AmericanPhysiologicalSociety,1975,p713.
IversonLLUptakeofcirculatingcatecholamines.InBlaschkoH,SayersG,SmithAD(eds):Handbookof
Physiology.Washington,DC,AmericanPhysiologicalSociety,1975,p713.
JacobsSC,LawsonRKMitogenicfactorsinhumanprostateextracts.Urology1980;16:488491.
Johannes CB, Araujo AB, Feldman HA, et al Incidence of erectile dysfunction in men ages 4069:
LongitudinalresultsfromtheMassachusettsmaleagingstudy.JUrol2000;163:460.
Jones JW, Sebastian A, Hulter AN, et al. Systemic and renal acidbase effects of chronic dietary
potassiumdepletioninhumans.KidneyInt1982;21:402410.

109

TratatdeUrologie

88.
89.
90.
91.
92.
93.
94.
95.
96.
97.

98.
99.
100.
101.
102.
103.
104.
105.
106.

107.
108.

109.
110.
111.
112.
113.

JonesRMembraneremodellingduringspermmaturationintheepididymis.240.OxfRevReprodBiol
1989;11:285337.
KanwarYSBiophysiologyofGlomerularFiltrationandProteinuria.LabInvest.51:721,198.4
KazemiH,HitzigBCentralchemicalcontrolofventilationandacidbasebalance.InSeldinDW,Giebisch
G(eds):TheKidney:PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,pp26272644.
KlevmarkBMotilityoftheurinarybladderincatsduringfillingatphysiologicrates:I.Intravesical
pressurepattcrnsstudiedbyanewmethodofcystometry.ActaPhysiolScand1974;90:565.
KobayashiS,TangR,WangB,etalLocalizationofendothelinreceptorsinthehumanprostate.JUrol
1994a;151:763766.
Kokko J Proximal Tubular Reabsorption. In: Pathophysiology of the Kidney (sub red. Kurtzman N.A.,
MartinezMaldonadoM.)CharlesThomasPubl.,Springfield,1977,p.125156.
KuhnA,KurnotRA,SesterhennIA,etalExpressionofthecerbB2(HER2/neu)oncoproteininhuman
carcinoma.JUrol1993;150:14271443.
KuriyamaH,OsaT,ToidaNMembranepropertiesofthesmoothmuscleofguineapigureter.JPhysiol
(Lond)1967;191:225
LammersWJEP,AhmadHR,ArafatKSpatialandtemporalvariationsinpacemakingandconductionin
theisolatedrenalpelvis.AmJPhysiol1996;270:F567.
Laragh JH, Sealey JE Reninangiotensinaldosterone system and the renal regulation of sodium,
potassium,andbloodpressurehomeostasis.InWindhagerEE(ed):HandbookofPhysiology.Section8:
RenalPhysiology,vol2.NewYork,OxfordUniversityPress,1992,pp14091541.
LeafA,CotranRSRenalPathophysiology.OxfordUniversityPress,1976.
Levin RM, Hypolite J, Broderick GA Comparative studies on intracellular calcium and NADH
fluorescenceoftherabbitcorpuscavernosum.NeurourolUrodyn1994;13:609618.
Lilja H: A kallikreinlike serum protease in prostatic fluid cleaves the predominant seminal vesicle
protein.JClinInvest1985;76:18991903.
Lindzey J, Korach KS Steroid hormones in endocrinology: Basic and clinical principles. In Conn PM,
MelmedS(eds):Endocrinology:BasicandClinicalPrinciples.Totowa,NJ,Humana,1997,4762.
LipshultzLI,McConnellJ,BensonGSCurrentconceptsofthemechanismofejaculation.JReprodMed
1981;26:499.
LiuFY,CoganMSAngiotensinII:APotentRegulatorofAcidificationinRatEarlyProximalConvoluted
Tubule.J.Clin.Invest.80:272275,1987.
LongriggNMinorcalycesasprimarypacemakersitesforureteralactivityinman.Lancet1975;1:253.
Love RR, Carbone PP, Verma K, et al Randomized phase I chemoprevention doseseeking study of
alphadifluoromethylornithine.JNatlCancerInst1993;85:732737.
Lubahn DB, Moyer JS, Golding TS, et al Alteration of reproductive function but not prenatal sexual
developmentafterinsertionaldisruptionofthemouseestrogenreceptorgene.ProcNatlAcadSciUSA
1993;90:1116211166.
LueTFPhysiologyofpenileerectionandpathophysiologyoferectiledisfunctionandpriapism.Walsh
PC,RetikAB,VaughanED,WeinAJCampbellsUrology,SeventhEdition,vol.2,199811571179.
MacDonald PC Origin of estrogen in men. In Grayhack JT, Wilson JD, Scherbenske MJ (eds): Benign
ProstaticHyperplasia.ProceedingsofaworkshopsponsoredbytheKidneyDiseaseandUrologyProgram
oftheNIAMDD,February2021,1975.Washington,DC,U.S.GovernmentPrintingOffice,1976,pp191
192
Mackenzie AR, Hall T, Whitmore WF Jr. Zinc content of expressed human prostatic fluid. Nature
1962;193:72.
Madrazo I,DruckerColin RH, Diaz V,et al. Open microsurgical autograph ofadrenal medulla to the
rightcaudatenucleusintopatientswithintractableParkinson'sdisease.NEnglJMed1987;316:3831.
Maggi CA Tachykinins and calcitonin generelated peptide (CGRP) as cotransmitters released from
peripheralendingsofsensorynerves.ProgNeurobiol1995;45:1.
MaizelsM,StephensFDValvesoftheureterasacauseofprimaryobstructionoftheureter:Anatomic,
embryologic,andclinicalaspects.JUrol1980;123:742.
Manger WM, Gifford RW Jr Pheochromocytoma. In Laragh JH, Brenner BM (eds): Hypertension:
Pathophysiology,Diagnosis,andManagement.NewYork,RavenPress,1990.

110

Capitolul2.Fiziologiaaparatuluiurogenital

114. MannT,MannCLMaleReproductiveFunctionandSemen.NewYork,SpringerVerlag,1981.
115. MarchantDJEffectsofpregnancyandprogestationalagentsontheurinarytract.AmJObstetGynecol
1972;112:487.
116. MartanJEpididymalhistochemistryandphysiology.BiolReprod1963;1:134
117. McConnellJDProstaticgrowth:Newinsightsintohormonalregulation.BrJUrol1995;76(Suppl1):510.
118. McGuire E, Elbadawi A, Blaivas J, eds Neurourology and Urodynamics: Principles and Practice. New
York,Macmillan,1988,pp343357.
119. McGuireEJPhysiologyofthelowerurinarytract.AmJKidneyDis1983;2:402.
120. Mevorach RA, Bogaert GA, Kogan BA Role of nitric oxide in fetal lower urinary tract function. J Urol
1994;152:510514.
121. MieussetR, BujanL, MondinatC,etal.Associationofscrotalhyperthermiawithimpairedspermato
genesisininfertilemen.FertilSteril1987;48:10061011.
122. MooreM,AmbersonJB,KazamE,VaughanEDJrAnatomy,histology,embryology.InVaughanEDJr,
CareyRM(eds):AdrenalDisorders.NewYork,ThiemeMedical,1989.
123. MoritaT,WadaI,SaekiH,etal.Ureteralurinetransport:Changesinbolusvolume,peristalticfrequen
cy,intraluminalpressureandvolumeofflowresultingfromautonomicdrugs.JUrol1987;137:132.
124. MuellerRA,ThoenenH,AxelrodJEffectofthepituitaryandACTHonthemaintenanceofbasaltyrosine
hydroxylaseactivityintheratadrenalgland.Endocrinology1970;86:751.
125. MurnaghanGFThedynamicsoftherenalpelvisandureterwithreferencetocongenitalhydronephro
sis.BrJUrol1958;30:321.
126. NelsonDH,MeakinJW,DealyJBJr,etal.ACTHproducingtumorofthepituitarygland.NEnglJMed
1958;259:161.
127. NelsonDHTheadrenalcortex:Physiologicalfunctionanddisease.MajorProblInternMed1980;18:15.
128. OerlichTMThestriatedurogenitalsphinctermuscleinthefemale.AnatRec1983;205:223.
129. Oken DE Proteinuria and Aminoaciduria. In: Pathophysiology of the Kidney (sub red. Kurtzman N.A.
MartinezMaldonadoM.)CharlesC,ThomasPubl.,Springfield,1977.
130. OlinEH,FabianaR,JohanssonL,RonquistGArachidonicacid15lipoxygenaseandtracesofEprotaglan
dinsinpurifiedhumanprostasomes.JReprodFertil1993;99:195199.
131. OrthDNCushing'ssyndrome.NEnglJMed1995;332:791.
132. PalmerLG,AntonianL,FrindtGRegulationofapicalK+andsodiumchannelsandNa+/K+pumpsinrat
corticalcollectingtubulebydietaryK+.JGenPhysiol1994;104:69710.
133. Peehl DM, Cohen D, Rosenfeld RG Insulingrowth factor system in the prostate. World J Urol 1995;
13:306311.
134. Pettersson S, Soderholm B, Persson JE, et al. Testicular blood flow in man measured with venous
occlusionplethysmographyandxenon133.ScandJUrolNephrol1973;7:115119.
135. PittsRFPhysiologyoftheKidneyandBodyFluidsed.aIlla,YearBookMedicalPubl.Chicago,1974,12
98.
136. Polascik TT, Oesterling JE, Partin AW Prostatespecific antigen: A decade of discoverywhat we have
learnedandwherewearegoing.JUrol1999;161:294306.
137. Prieto D, Simonsen U, Martn J, et al. Histochemical and functional evidence for a cholinergic
innervationoftheequineureter.JAutonNervSys1994;47:159.
138. RecklerJM,VaughanEDJr,TjeuwM,CareyRMPheochromocytoma.InVaughanEDJr,CareyRM(eds):
AdrenalDisorders.NewYork,ThiemeMedical,1989.
139. ReidRE,HermanR,TengCAttemptsatalteringureteralactivityintheunanesthetized,conditioneddog
withcommonlyemployeddrugs.InvestUrol1976;12:74.
140. ReiterRJThepinealand itshormonesin thecontrolof reproduction`nmammals.EndocrRev1980;
1(2):109131.ReppertSM,KleinDC:Mammalianpinealgland:Basicandclinicalaspects.InMottaM,ed:
TheEndocrineFunctionsoftheBrain.NewYork,RavenPress,1980,pp327371.
141. ReubiFGGlucoseTitrationinRenalGlycosuria.In:TheKidney,1954,96106.
142. RiveraL,HernndezM,BeneditoS,etal.Mediationofcontractionandrelaxationbyalphaandbeta
adrenoceptorsintheureterovesicaljunctionofthesheep.ResVetSci1992;52:57.
143. RobertsJAHydronephrosisofpregnancy.Urology1976;8:1.

111

TratatdeUrologie

144. RobertsonGL,SheltonRL,AtharSTheOsmoregulationofVasopressin.KidneyInt.10:p.2537,1976.
145. RohanTE,HoweGR,BurchJE,JainMDietaryfactorsandriskofprostatecancer:Acasecontrolstudyin
Ontario,Canada.CancerCausesControl1995;6:145154.
146. RomasNA,KwanDJProstaticacidphosphatase.UrolClinNorthAm1993;20:581588.
147. Rose BD Clinical Physiology of AcidBase and Electrolyte Disorders, 3rd ed. New York, McGrawHill,
1989.
148. RoseJG,GillenwaterJYTheeffectofadrenergicandcholinergicagentsandtheirblockersuponureteral
activity.InvestUrol1974;11:439.
149. Ross JA, Edmond P, Kirkland IS Behavior of the Human Ureter in Health and Disease. Edinburgh,
ChurchillLivingstone,1972.
150. RozD,LaztonHE,JamisonRLCountercurrentmechanismanditsregulation.InSeldinDW,GiebischG
(eds):TheKidney:PhysiologyandPathophysiology,2nded.NewYork,Raven,1992,16491692.
151. RussellDW,WilsonJDSteroid5reductase:Twogenes/twoenzymes.AnnRevBioch1994;63:2561.
152. Sann H Chemosensitivity of nociceptive, mechanosensitive afferent nerve fibres in the guineapig
ureter.EurJNeurosci1998;10:1300.
153. SanticioliP,MorbidelliL,ParentiA,etal.CalcitoningenerelatedpeptideselectivelyincreasescAMP
levelsintheguineapigureter.EurJPharmacol1995;289:17.
154. Sawyer CH Functions of the amygdala related Io feedback actions of gonadal steroid hormones. In
EleftheriouBE,ed:NeurobiologyoftheAmygdala.NewYork,PlenumPress,1972,pp745752.
155. SchelegelPN,ChangTSKPhysiologyofmalereproduction:thetestis,epididymisandductusdeferens.
WalshPC,RetikAB,VaughanED,WeinAJCampbells Urology,SeventhEdition,vol.2,1998,1254
1286.
156. SchulzeW:Structuralprinciplesunderlyingthespermatogenicprocessinmanandanonhumanprimate
(Macacacynomolgus).InReproductiveBiologyandMedicine.DiesbachVerlag,1989,pp5865.
157. SchwartzWB,OrningKJ,PorterRTheinternaldistributionofhydrogenionswithvaryingdegreesof
metabolicacidosis.JClinInvest1957;36:373382.
158. Seligman AM, Sternberger NJ, Paul BD, et al. Design of spindle poisons activated specifically by
prostatic acid phosphatase (PAP) and new methods for PAP cytochemistry. Cancer Chemother Rep
1975;59:233242.
159. ShiratoriT,KinoshitaHElectromyographicstudiesonurinarytract.III.Influenceofpinchingandcutting
theuretersofdogsontheirEMGs.TohokuJExpMed1961;73:159
160. Sikes RA, Kao C, Chung LWK Autocrine and paracrine mediators for prostate growth in cancer
progression. In McGuire EJ, Bloom D, Catalona WJ, Lipshultz LI (eds): Advances in Urology, vol 8. St.
Louis,MosbyYearBook,1995,pp2160.
161. Smith RC, RinkerSchaeffer CW Understanding molecularbiology and carcinogenesis of genitourinary
cancers. In Vogelzang NJ, Scardino PT, Shipley WU, Coffey DS (eds): Comprehensive Textbook of
GenitourinaryOncology.Baltimore,Williams&Wilkins,1995,pp6880.
162. StarlingEHTheLinacreLectureontheLawoftheHeart(GivenatCambridge,1915).London:Longmans,
Green,1918.
163. SteeleTH,RieselbachRERenalHandlungofUrateandOtherOrganicAnions.In:TheKidney(sub
red.BrennerBM,RectarFG),W.B.Saunders&Comp.,PhiladelphiaLondraToronto,1975,446476.
164. SteersWDPhysiologyandformacologyofthebladderandurethra.WalshPC,RetikAB,VaughanED,
WeinAJCampbellsUrology,SeventhEdition,vol.1,1998,870915.
165. SteinM,DiscippioW,DavidM,TaubHBiofeedbackforthetreatmentofstressandurgeincontinence.J
Urol1995;153:641643.
166. SternsRH,CoxM,FeigPU,SingerIInternalpotassiumbalanceandthecontroloftheplasmapotassium
concentration.Medicine1981,60,339.
167. SwerdloffRS,WangCPhysiologyofhipothalamicpituitaryfunction.WalshPC,RetikAB,VaughanED,
WeinAJCampbellsUrology,SeventhEdition,vol.2,1998,12391253.
168. Tamaki M, Iwanaga T, Sato S, Fujita T Calcitonin generelated peptide (CGRP)immunoreactive nerve
plexusesintherenalpelvisandureterofrats.CellTissueRes1992;267:29.
169. Tanagho EA, Schmidt RA, Orvis BR Neural stimulation for control of voiding dysfunction: Prelirninary
reportin22patientswithseriousneuropathicvoidingdisorders.JUrol1989;142:340.

112

Capitolul2.Fiziologiaaparatuluiurogenital

170. TeppermanJ,TeppermanHMetabolicandEndocrinePhysiology,5thed.Chicago,YearBookMedical,
1987.
171. Thulesius O, AngeloKhattar M, Sabha M The effect of ureteral distension on peristalsis: Studies on
humanandsheepureters.UrolRes1989;17:385.
172. Tomiyama Y, Hayakawa K, Shinagawa K, et al. Betaadrenoceptor subtypes in the ureteral smooth
muscleofrats,rabbitsanddogs.EurJPharmacol1998;352:269.
173. TungPS,SkinnerMK,FritzIBFibronectinsynthesisisamarkerforperitubularcontaminantsinSertoli
cellenrichedcultures.BiolReprod1984;30:199211.
174. UlvsbackM,LindstromC,WeiberH,etal.Molecularcloningofasmallprostateprotein,knownas
microsemenoprotein, PSP 90 or inhibin, and demonstration of transcripts in nongenital tissues.
BiochemBiophysResCommun1989;164:13101315.
175. vanderGraafM,SchipperRG,OosterhofGO,etal.ProtonMRspectroscopyofprostatictissuefocused
onthedetectionofspermine,apossiblebiomarkerofmalignantbehaviorinprostatecancer.MAGMA
2000;10:153159.
176. VanWaesC,SurhDM,ChenZ,etal.Increaseinsuprabasilarintegrinadhesionmoleculeexpressionin
human epidermal neoplasms accompanies increased proliferation occurring with immortalization and
tumorprogression.CancerRes1995;55:5434.
177. Vaughan ED, Blumenfeld JD The adrenals. Walsh PC, Retik AB, Vaughan ED, Wein AJ Campbells
Urology,SeventhEdition,vol.3,1998,29152924.
178. VereeckenRLDynamicalAspectsofUrineTransportintheUreter.Acco,Louvain,1973.
179. Vignon F, ClavertA, KollBack MH, Reville P Onthe glandular origin ofseminal plasma lipids in man.
Andrologia1992;24:341343.
180. Waikar MV, Ford APDW, Clarke DE Evidence for an inhibitory 5HT4 receptor in urinary bladder of
RhesusandCynomolgusmonkeys.BrJPharmacol1994;111:2132128.
181. Walsh PC, Brendler CB, Chang T, et al. Preservation of sexual function in men during radical pelvic
surgery.MdMedJ1990;39:389393.
182. WalshPC,SwerdloffRS,OdellWDFeedbackcontrolofFSHinthcm]lc:Roleofestrogen.ActaEndocrinol
1973;74:449.WangC:Bioassaysoftblliclestimulatinghormone.EndocrRev1988;9:374.
183. WangMC,ValenzuelaLA,MurphyGP,ChuTMPurificationofahumanprostatespecificantigen.Invest
Urol1979;17:159163.
184. Watt KWK, Lee PJ, Tinkulu TM, et al. Human prostatic specific antigen: Structural and functional
similaritieswithserumproteases.ProcNatlAcadSciUSA1986;83:31663170.
185. WattsSW,CohenMLEffectofboinbesin,bradykinin,substancePandCGRPinprostate,bladderbody
andneck.Peptides1991;12:10571062.
186. WeinbauerGF,SchlattS,WalterV,NieschlagETestosteroneinducedinhibitionofspermatogenesisis
more closely related to suppression of FSH than to testicular androgen levels in the cynomologous
monkeymodel(Macacafascicularis).JEndrocrinol2001;168:2538.
187. WeissRM,BassettAL,HoffmanBFAdrenergicinnervationoftheureter.InvestUrol1978;16:123.
188. Weiss RM, Vulliemoz Y, Verosky M, et al. Adenylate cyclase and phosphodiesterase activity in rabbit
ureter.InvestUrol1977;15:15.
189. WhangR,FlinkEB,DycnerR,etal.Magnesiumdepletionasacauseofrefractorypotassiumrepletion.
ArchInternMed1985,16861689.
190. WhitakerRHClinicalassessmentofpelvicandureteralfunction.Urology1978;12:146.
191. WhitakerRHMethodsofassessingobstructionindilatedureters.BrJUrol1973;45:15.
192. WhiteMAChangesinpHofexpressedprostaticsecretionduringthecourseofprostatitis.ProcRSoc
Med1975;68:511513.
193. WilkesBM,SusinM,MentoPF,MacicaCMLocalizationofETlikeImmunoreactivityinRatKidneys,Am.
J.Physiol.260:F913,1991.
194. WinklerH,SmithADThechromaffingranuleandthestorageofcatecholamines.InBlaschkoH,Sayers
G, Smith AD (eds): Handbook of Physiology. Washington, DC, American Physiological Society, 1975, p
321.
195. WoodburneRT,LapidesJTheureterallumenduringperistalsis.AmJAnat1972;133:255..

113

TratatdeUrologie

196. YacoeME,SommerG,PeehlDInvitroprotonspectroscopyofnormalandabnormalprostate.Magn
ResonMed1991;19:429438.
197. YousefGM,ObiezuCV,LuoLY,etal.Prostase/KLKL1isanewmemberofthehumankallikreingene
family,isexpressedinprostateandbreasttissue,andishormonallyregulated.CanRes1999;59:4252
4256
198. ZaneveldLJD,ChattertonRBiochemistryofMammalianReproduction.NewYork,JohnWiley&Sons,
1982.
199. ZerbeRL,RobertsonGLOsmoticandNonosmoticRegulationofThirstandVasopressinSecretion.New
YorkMcGrawHill,p.6178,1987.

114

Capitolul3.Examenulclinicalaparatuluiurogenital

Capitolul

EXAMENULCLINIC
ALAPARATULUIUROGENITAL

Conf.Dr.GLCKGABRIEL

Dr.CRISTIANI.SURCEL

115

TratatdeUrologie

Cuprins:

Examenulclinicalaparatuluiurogenital117
Explorareaclinic~arinichilor#iaspa[iuluiretroperitonealadiacent119,
Metodedepalparerenal~120
A.MetodaGuyon120
B.MetodaGlenard120
C.MetodaIsrael121
D.MetodaPetit121
Puncterenaledureroase121
Examenulveziciiurinare125
Examenulorganelorgenitalelab~rbat126
A.Examenulpenisului126
B.Examenulmeatuluiuretralextern127
C.Examenulscrotului#ialcon[inutuluiscrotal127
D.Examenultesticulului127
E.Examinareavaginaleitesticulare129
F.Examenulcordonuluispermatic#ialcanaluluideferent129
Tu#eulrectal131
Examenulmacroscopicalurinei135

Bibliografie137

116

Capitolul3.Examenulclinicalaparatuluiurogenital

Examenulclinicalaparatuluiurogenital

`n cadrul protocolului de evaluare al pacientului urologic, anamneza #i examenul


clinic r~m]n, `n ciuda progresului pe care la realizat imagistica, baza indispensabil~ de la
caresepleac~pentruformulareadiagnosticului#ipentruorientareaterapeutic~.
Practic,prindefini[ie,urologiaesteospecialitatemedicochirurgical~deordinulI`n
carediagnosticulclinicareocomponent~fundamental~`nstrategiaterapeutic~ulterioar~#i
`ndirec[ionareapacien[ilorspreaceast~specialitate.
Examenul fizic trebuie s~ respecte anumite principii: s~ fie complet, indiferent de
amploareasimptomatologiei,s~fiesistematic(parcurgelogicetapeleexamenuluigeneralpe
aparate #i sisteme), s~ fie cursiv, f~r~ pauze nejustificate, confortul psihic #i cel fizic al
pacientuluitrebuie,deasemenea,luate`nconsidera[ie(BrucknerI,2002).
Examenulobiectivurologicefectuatatent,cubl]nde[e,f~r~manevrebru#tecomple
teaz~anamneza#ipoateaduceinforma[iiimportante.Vafiexaminat`ntregulaparaturinar,
chiar dac~ diagnosticul pare evident din datele culese prin anamnez~, continu]nd cu
examinarea clinic~ complet~ pe aparate #i sisteme, pentru a nu omite prezen[a anumitor
leziuni concomitente. Examenul fizic al aparatului urogenital `ncepe la nivelul lombelor, `n
sensul de curgere a urinei, p]n~ la nivelul meatului uretral extern, incluz]nd examenul
scrotului#icon[inutulacestuia,tu#eulrectal#irespectivvaginallafemeie.
`n continuarea examenului obiectiv, pacientul va fi invitat s~ urineze de fa[~ cu
examinatorulpentruaapreciaactulmic[ional(cumseelimin~urina,c]tseelimin~,plusalte
atribute ale mic[iunii) #i, de asemenea, se va face analiza urinei dup~ emisie, ce va fi
recoltat~ `ntrun recipient curat, de sticl~ transparent~. Nu se va aprecia urina adus~ de
pacient, deoarece aceasta `#i schimb~ caracterele `n timp, `n func[ie de temperatur~, de
calitateavasuluietc.
Examenulfizicgeneralofer~dateimportantepentruurolog:
1. Aspectul pacientului poate fi evocator. Astfel, cu excep[ia colicii renale `n care
pacientul este agitat #i a manifest~rilor convulsive din cadrul encefalopatiei hiper
tensivesauaceleiuremice,bolnavulurologicestelini#tit.
2. Tegumentele pot furniza informa[ii importante despre patologia renal~, cum ar fi
exantemul morbiliform sau scarlatiniform, `nt]lnit `n sindromul uremic, al~turi de
uremide formate prin eliminarea cutanat~ a ureei, a chiciurei uremice la nivelul
pleoapelor, g]tului #i nu `n ultimul r]nd prezen[a pruritului determin~ escoria[ii
cutanate tipice insuficien[ei renale cronice. Culoarea cenu#iup~m]ntie a fe[ei #i
mucoaselorse`nt]lne#te,deasemenea,`nsindromuluremic.Paloareategumentar~
esteunsemnimportantce`nso[e#teaproapetoatebolileconsumptive.
3. Fanerele pot #i ele suferi modific~ri, `n special p~rul ce devine aspru, friabil `n sin
dromul nefrotic. `n perioadele de acutizare el se decoloreaz~, urm]nd s~ se
recoloreze`nperioadelederemisiune(semnulfirului de p~r).`ninsuficien[arenal~
unghiileprezint~modific~riimportante(stria[iilongitudinaleproeminente,cre#terea
propor[ieilunuleloretc.).
4. [esutul subcutanat, de asemenea, poate furniza date clinice, `n special prezen[a
edemului,care,princaractere#ilocalizare,poateorientadiagnosticul(edemulrenal
este pufos, alb, moale, nedureros, bilateral #i simetric, apare `n general peste
noapte,las~semnulgodeului).Estelocalizatini[ialpalpebral,periorbital,facial,retro

117

TratatdeUrologie

maleolar,poateinteresacoapsele,organelegenitaleexterneetc.).Prezen[aedemului
limfatic la nivelul unui membru pelvin poate reprezenta un semn important `n
patologia retroperitoneului, fiind sugestiv pentru compresia extrinsec~, cel mai
frecventtumoral~lanivelulaxuluivasculariliac.
5. Starea de nutri[ie reprezint~ #i ea o afectare `n cadrul bolilor renale: ca#exia se
`nt]lne#te `n neoplazii, iar obezitatea poate reprezenta un semn de dereglare
hormonal~(hipercorticism,diabetzaharatetc.).Sistemulmuscularrecunoa#teosc~
dere a troficit~[ii #i a for[ei contractile cu atrofii mari ce determin~ astenie, curba
tur~,semneimportante`nsindromuluremic.
6. Manifest~rileosoasesuntdes`nt]lnitelapacien[iicuinsuficien[~renal~cronic~,sub
tabloul osteodistrofiei uremice caracterizat~ prin osteit~ fibroas~, osteomalacie #i
osteoscleroz~ ce stau la baza nanismului renal (dac~ survin la copii) sau a durerilor
osoase, fragilitate, fracturi spontane, calcific~ri aberante (corneene, periarticulare,
arterialeetc.).
7. Aparatul respirator este afectat precoce prin apari[ia halenei amoniacale, ce poate
impresiona medicul de la primul contact, dispneea tip Kussmaul (acidozele meta
bolicedininsuficien[arenal~cronic~stadiuluremic),iardispneeaCheyneStokesface
parte din tabloul clinic al encefalopatiei hipertensive cu edem cerebral. Pl~m]nul
uremic caracterizat prin dispnee, tuse, expectora[ie seromucoas~ la care se adaug~
pleurezia uremic~ sunt consecin[a edemului intersti[ial, infiltratelor celulare #i
alveolitei edematoase, toate `nt]lnite `n insuficien[a renal~ cronic~ uremic~. `n sin
dromul nefrotic apar transudate pleurale importante. Hemoptiziile pot fi date de
prezen[aeventualelormetastazeprovenitedelauncancercupunctdeplecareapa
ratulurogenitalsaudatorit~sindromuluiGoodpasture,edemuluipulmonaracutetc.
8. Aparatulcardiovascular,deasemenea,esteo[int~predilect~abolilorrenale,cumar
fi sindromul hipertensiv din cadrul insuficien[ei renale cronice ce este `nso[it de
ateroscleroz~ precoce ce evolueaz~ spre sindroame ischemice fatale (hipertrofie
ventricular~ cu apari[ia de sufluri sistolice mitrale #i accentuarea zgomotului II,
modific~ri la nivelul fundului de ochi, tulbur~ri de excitabilitate #i conducere,
prezen[a suflurilor arteriale pe arterele afectate de ateroscleroz~ etc.). Pericardita
uremic~ determin~ dureri precordiale sau retrosternale `nso[ite de dispnee #i
anxietatecudetectareafrec~turiipericardice#im~rireamatit~[iicardiace.
9. Aparatul digestiv este afectat pe toat~ lungimea lui de la nivelul cavit~[ii bucale
(stomatita#iglositauremic~usc~ciuneamucoaselor#ilimbapr~jit~cutulbur~ride
mastica[ie#idegluti[ie),gastritauremic~(anorexie,v~rs~turicusucgastriccumiros
caracteristic, hematemez~, melen~), enterocolita uremic~ (dureri abdominale,
meteorism,flatulen[~,scaunediareicecremoasecustriurisanghinolente)lacarese
adaug~ hepatoza #i pancreatita cronic~. Ficatul mic, cu subicter, deshidratarea #i
oligoanuria sugereaz~ tabloul clinic al unui sindrom particular: sindromul hepato
renal.
10. Tulbur~ri neurologice de tipul: contracturi musculare, fascicula[ii, convulsii, sughi[ul
uremicului indus de excitarea nervilor fernici, cefalee, insomnia, tulbur~ri psihice,
parestezii,toatefacpartedintabloulclinccomplexalencefalopatieiuremice.
11. Ginecomastiaal~turidealtesemneendocrine(hirsutism,virilism)poateaveacauze
urologice cum ar fi: anomalii testiculare, tumori de suprarenal~ sau `n urma trata
118

Capitolul3.Examenulclinicalaparatuluiurogenital

mentuluihormonaladministrat`ncanceruldeprostat~oripoateap~rea`nbolinon
urolgicecumarfi:diabetulzaharat,alcoolismul,cirozaetc.
12. Herniileabdominalesepotasociapatologieiurologice,`nspecialafec[iunilortractului
urinarinferior,careprinobstruc[iefacposibil~dezvoltareaacestora.
13. Forma[iuni tumorale inghinale pot fi reprezentate de hernii inghinale, testicul
anormal migrat sau adenopatii inghinale (inflamatorii, tumorale, infec[ioase), diag
nosticuldiferen[ialestefundamental(SinescuI,2006).

Explorareaclinic~arinichilor#iaspa[iuluiretroperitonealadiacent

`ngeneral,rinichiicorespundtopograficvertebrelorT12,L1,L2.Apofizatransvers~a
L3corespundepoluluiinferiorrenal,maialespentrurinichiuldrept,careestesituatmaijos
dec]tcelst]ngcu23cm.CoasteleaXIa#iaXIIa,`mpreun~cumusculaturasacrolombar~,
reprezint~dou~rapoarteimportantealerinichilor.
1. Inspec[ia regiunii lombare, `n absen[a patologiei renale #i perirenale, nu aduce
nicioinforma[ie.`nfunc[iedepatologie,sepoteviden[ialainspec[ieurm~toarele:
a) edem lombosacrat ce poate avea diferite cauze: manifestare a edemului
gravita[ional,c]ndestebilateral#iaparelapacien[icestaumult`nclinostatism
cuinsuficien[~renal~cronic~sau`nafec[iuninefrologice,saupoatefi`nso[itde
hiperemie`nabceseleperinefreticecaredeobiceisuntunilaterale.`nacestultim
caz, zona lombosacrat~ apare infiltrat~, las~ godeu la digitopresiune sau chiar
lenjeria poate amprenta aceast~ regiune l~s]nd impresiuni cutanate. Sa descris
astfel testul prosopului prin care pacien[ii la care se suspicioneaz~ prezen[a
abcesului perinefrectic erau a#eza[i pe un prosop rugos #i apoi se observau
indenta[iile;
b) pozi[iaantalgic~,prezent~`nsupura[iileperirenale,sedatoreaz~mioziteisatelite
cecontract~musculaturalombar~.`ncolicarenal~nuexist~pozi[ieantalgic~;
c)circula[ia colateral~ abdominal~ se `nt]lne#te `n tumorile maligne renale,supra
renaliene,cuextensielanivelulveneicaveinferioaresau/#i`noriceafec[iunece
determin~progresivtromboz~deven~cav~inferioar~;
d) deformarea regiunii lombare este `n general unilateral~, mai rar bilateral~, iar
lombaaparebombat~,grilajulcostalridicat,unghiulcostovertebralplin.Apare`n
afec[iuni ce stau la baza conceptului de rinichi mare: tumori renale, supra
renaliene,hidronefroze,pionefroze,hematoamelombare,chistrenal,hipertrofie
compensatorie (unilateral) sau `n boala polichistic~ hepatorenal~ sau tumori
bilaterale. `n aceast~ situa[ie se eviden[iaz~ deformarea bilateral~ a regiunii.
Uneori se poate produce fenomenul de abdominalizare a rinichiului, cu defor
marea abdomenului, `n special `n flancuri sau chiar `n fosele iliace, `n tumori
renalevoluminoase,gigantice#i`nBPHR;
e) solu[ii de continuitate, pl~gi, echimoze, hematoame, cicatrici, de obicei se
deceleaz~dup~traumatisme,`nfunc[iedeintensitatealor;
f) vergeturilapacien[iicuafec[iuniendocrinesaulaceicucre#teresomatic~rapid~;
g) tuburidedren,nefrostomiesaualteformedederiva[ieurinar~lapacien[iceau
suferitinterven[iichirurgicalepentrudiferiteafec[iuniretroperitoneale.

119

TratatdeUrologie

2. Palparea regiunii lombare se face cu dificultate, deoarece rinichii sunt situa[i


profund, retroperitoneal sub diafragm #i la nivelul ultimelor coaste. La b~rba[i se adaug~
faptulc~suntmaipu[inmobili,iartonusulmusculaturiiabdominaleestemaicrescutdec]tla
femei.Oricumreprezint~timpulesen[ialalexamenuluifizic(BatesB,1991).

Datorit~ prezen[ei ficatului pe partea dreapt~, la pacien[ii slabi, copii #i la femei se


poate palpa polul inferior al rinichiului `n inspir profund. Palparea rinichiului se poate
executa #i de pe partea st]ng~ a bolnavului (la fel casplina). La obezi palpareaeste impo
sibil~ `n condi[ii normale. Prin palpare putem aprecia: volumul rinichilor, consisten[a,
mobilitatea,sensibilitatea,suprafa[a#ichiarforma.`nmodnormal,rinichiulesteunorgan
plin, neted, regulat, nedureros, imobil. Prin palpare se pot decela: rinichiul mare, lomba
plin~ (hematom, supura[ie, tumori retroperitoneale), mobilit~[i anormale, eventuale
crepita[iilocale(TanaghoE,2002).
Deasemenea,trebuieefectuatdiagnosticuldiferen[ialcutumorileretroperitoneale,
patologiasplenic~,patologiadeunghicolonic,veziculabiliar~,chistulpancreaticetc.

Metodedepalparerenal~

A. Metoda Guyon. Pacientul este `n decubit dorsal, a#ezat pe o suprafa[~ tare #i


plan~,cugenunchiiflexa[i,cuexaminatorulaflatpeparteaexaminat~,av]ndm]naopus~`n
unghiul costomuscular (indexul paralel cu ultima coast~, iar mediusul ajunge `n unghiul
costomuscular),iarm]nacealalt~subrebordulcostal(Fig.1).
Se pune bolnavul s~ respire
profundrinichiulfiindmobilcumi#c~
rile respiratorii. Ridic]nd peretele lom
bar, rinichiul va fi proiectat anterior #i
poate fi astfel palpat prin apropierea
celor dou~ m]ini sau prin balotare. Este
metoda de preferat, chiar #i la obezi
(Bates B, 1991; Proca E, 1984). Palparea
rinichiuluicontralateralseexecut~lafel,
invers]ndpozi[iam]inilor.

Fig.1.MetodaGuyon.

B. Metoda Glenard. Pacientul `n


decubit dorsal, cu genunchii flexa[i, cu
examinatorul aflat pe partea examinat~,
av]ndm]naopus~plasat~cupolicelesub
rebord, iar celelalte degete `n regiunea
lateroposterolombar~ (Fig.2). Se pune
bolnavul s~ respire profund, rinichiul
fiindpalpat`ntrepolice#iultimelepatru
degete, deci este o metod~ unimanual~
(Bates B, 1991; Proca E, 1984). Aceast~
metod~ se recomand~ `n general la
noun~scu[iav]ndastfelorat~desucces
de95%.

Fig.2.MetodaGlenard.

120

Capitolul3.Examenulclinicalaparatuluiurogenital

C.MetodaIsrael.Pacientulestea#ezat`ndecubitlateralopusrinichiuluiafectat,cu
membrulinferiordeparteabolnav~`nflexie#icuexaminatorulplasatdeparteaexaminat~
av]ndm]nadreapt~(deexemplupentrurinichiuldrept)cupoliceleaflat`nregiunealatero
posterolombar~,iarcelelaltedegetesubrebord(Fig.3).
Se `ndrum~ bolnavul s~ respire
profund, dar fiind o metod~ unimanual~
estepreferabilaseefectuadoarlabolnavii
slabi. Unii realizeaz~ aceast~ metod~ #i
bimanual, asem~n~tor metodei Guyon,
pozi[ia bolnavului fiind diferit~ (Bates B,
1991;ProcaE,1984).

Fig.3.MetodaIsrael.

D. Metoda Petit. Metoda reprezint~ o modificare a procedeului Guyon #i este


aplicabil~ pentru rinichiul st]ng, ce este mai diferit de explorat. Examinatorul se a#eaz~ la
dreaptapacientului#iplaseaz~m]nast]ng~subbolnavp]n~launghiulcostovertebral#ipe
ceadreapt~anteriorprofund(BatesB,1991;ProcaE,1984).

Puncterenaledureroase

1) Puncte lombosacrate (Fig.4): relev~ afec[iuni ale rinichiului sau ale atmosferei
perirenale(PNA,colicanefretic~,perinefrite):
a) Punctul costovertebral Guyon aflat `n unghiul
dintrecoastaaXIIa#icoloanavertebral~
b) Punctul costomuscular aflat `n unghiul dintre
coastaaXIIa#imusculaturasacrolombar~
c) Punctul subcostal BazyAlbarran aflat `n v]rful
coasteiaXIa.

Fig.4.Punctelombosacrate.
1)punctcostovertebral;
2)punctsubcostal;
3)punctcostomuscular.

2) Puncte dureroase aflate la distan[~ (pe traiectul nervilor plexului lombar) care
relev~, de asemenea, afec[iuni renale sau perirenale (litiaze, abcese perirenale, infec[ii
renale):
a) Punctulsuprailiaclateralsituatdeasupramedianeicresteiiliace(nerviisubcostali)
b) Punctul supraintraspinos Pasteau deasupra #i medial de spina iliac~ antero
superioar~(nervulfemurocutanat)
c) Punctul inghinal situat la nivelul orificiului inghinal extern (ramura genital~ a
nervuluigenitofemural).
121

TratatdeUrologie

De asemenea, palparea punctelor de irita[ie nervoas~ (efectuat~ prin ap~sarea cu


policele la nivelul articula[iei costovertebrale toracale sau la nivelul apofizelor transverse
lombare)poatedeclan#adureredeobiceicuorigineradicular~.
Hiperestezia cutanat~, la nivelul abdomenului anterior, flancului sau `n regiunea
lombar~,poatefiunsemnimportant`ndiagnosticulradiculitei.
De asemenea, prin palpare se pot decela diferite entit~[i patologice reunite sub
numelederinichimareunilateral(nefromegalieunilateral~)saubilateral,c]t#iptozarenal~.
Rinichiulmarepoateavealabaz~:
1. un substrat tumoral: rinichiul apare dur, cu margini neregulate #i suprafa[~
polinodular~
2. chisturirenale:deobiceisolitare,localizatelanivelulunuipol
3. hipertrofia compensatorie ce apare `n cadrul rinichiului unic func[ional, chirur
gicalsaucongenital
4. hidronefroza (mai ales cea de grade mari): de obicei rinichiul este dureros, `n
tensiune,relativomogen
5. `n cazul pionefrozei, rinichiul apare mare, neregulat, ferm, boselat, diagnosticul
diferen[ial cu cancerul renal fiind dificil #i adesea se asociaz~ perinefrit~ (Tanagho, 2002;
WalshCP,2001).

La palpare se pot sim[i balotarea renal~ #i contactul lombar (de la ball = minge),
no[iuni ce descriu mobilitatea rinichiului #i apartenen[a tumorii la spa[iul intra sau
retroperitoneal. Astfel rinichiul poate fi palpat `ntre cele dou~ m]ini (una anterior, alta
posteriorlafelcalametodaGuyon),prin`mpingereapereteluianterior(contactlombar)sau
posterior (balotare) spre m]na contralateral~ ca pe o minge. Contactul lombar traduce de
obicei prezen[a unei tumori retroperitoneale, pe c]nd balotarea semnific~ prezen[a unei
tumoriintraperitoneale(BrucknerI,2001).
Rinichiul mare bilateral se `nt]lne#te `n boala polichistic~ hepatorenal~, tumori
renalebilaterale,hidronefrozebilateraleprinobstacolsubvezicaletc.(SinescuI,1998).
Aten[ie!Nudepu[ineoripalpareauneimasetumorale`nregiunealombar~sepoate
asociacuprezen[auneisplenomegaliisauhepatomegalii,tumoriretroperitoneale,neoplazii
colonice,leziunilanivelulveziculeibiliaresaupancreasului.
Oalt~problem~estes~elucid~mapartenen[atumoriipalpatelaperetelelombarsau
la cavitatea peritoneal~. Manevra de diferen[iere const~ `n a invita bolnavul s~ contracte
musculaturaabdominal~ridic]ndcapul#iumeriidepepern~.Oforma[iuneparietal~r~m]ne
saudevinemaipalpabil~,`ntimpceunaintraabdominal~numaipoatefipalpat~(Bruckner
I,2002).
Ptozarenal~prezint~treigrade:
1. gradul I c]nd se palpeaz~ polul inferior renal deasupra liniei bispinoase, ce
une#teceledou~spineiliaceanterosuperioare
2. gradulIIc]ndpolulinferioratingeliniabispinoas~
3. gradul III c]nd polul inferior atinge fosa iliac~, ce practic ocup~ tot hemi
abdomenulrespectiv(SinescuI,1998).
Din punct de vedere clinic, rinichiul ptozat se caracterizeaz~ prin: sonoritate la
percu[ie (colonul se interpune), coboar~ `n inspir profund #i determin~ contact lombar (o
presiunebrusc~lanivelulpereteluilombar`mpinge`naintemasarenal~).Ptozarenal~este
maievident~lapalparea`nortostatismsaudup~tuse(SinescuI,1998).
122

Capitolul3.Examenulclinicalaparatuluiurogenital

Percu[ia rinichilor aduce elemente de orientare `n delimitarea rinichiului mare cu


consisten[~ sc~zut~ (chist, hidronefroz~), care nu se simte la palpare #i are valoare `n
traumatismele renale pentru urm~rirea evolu[iei hematomului renal, c]nd palparea nu se
poateefectuadincauzadurerii#icontracturiimusculare.
O manevr~ specific~ examenului clinic al aparatului urinar este reprezentat~ de
manevraGiordano(Fig.5).Acestsemnseculegeprinlovireacumargineacubital~am]iniila
nivelulmaseimuscularesacrolombare`nzonaunghiuluicostovertebral`nsenscraniocaudal.
Dac~ rinichiul este normal, unda de hiperpresiune creat~ r~m]ne f~r~ r~spuns:
Giordanoabsent.
Dac~rinichiulestedestins,undadehiperpresiunead~ugat~presiuniicrescuteintra
renale,dejaexistent~,provoac~odureredeintensitatevariabil~:Giordanoprezent(Sinescu
I,1998).
Prezen[a durerii dup~ manevra Giordano are
aceea#i semnifica[ie ca `n cazul punctelor renale
posterioare. Manevra Giordano este contraindicat~
`ncolicarenal~.
Orice pacient cu durere lombar~ #i/sau la
nivelulflanculuitrebuieexaminatcuaten[iepentrua
nu trece peste o patologie reumatic~ sau neuro
logic~. Astfel semnele de irita[ie nervoas~ trebuie
foartebinecunoscutedeurolog.

Fig.5.ManevraGiordano.

Sonoritateacolic~prerenal~prezent~`ncazulleziunilor`nlocuitoaredespa[iurenal
sauretroperitonealcertific~aceast~patologie,pec]ndprezen[amatit~[iiprerenaleascunde
deobiceiotumor~decolon,splenomegaliesauhepatomegalie(SinescuI,2006).
Transiluminareaabdominal~esteindi
cat~ la copiii sub 1 an, cu mas~ tumoral~
suprapubian~ sau `n flanc. Rinichiul hidro
nefrotic sau vezica urinar~ destins~ las~
lumina s~ treac~, `n timp ce o tumor~ solid~
(Wilms) r~m]ne opac~ (Sinescu I, 1998;
SinescuI,2006).
Ausculta[ia regiunii lombare vizeaz~
arterelerenale#iaortaabdominal~(Fig.6).

Fig.6.Punctedeausculta[iearteriale
1)aorta;2)arterelerenale;
3)artereleiliace;4)arterelefemurale.

123

TratatdeUrologie

Aortaabdominal~seauscult~supraombilicalpec]ndarterelerenaleparaombilical,la
intersec[iacumarginilelateralealemu#chilordrep[iabdominalisaulanivellombar,lateral
decorpulvertebreiL2.Sepotdecelasufluricucaracterediferite`nfunc[iedepatologiace
st~labazalor:`ngeneralstenozesauanevrismealeartereirenalesaualeaortei#ideobicei
cucaracterdetril,sincroncupulsul(sistolic)(SinescuI,2006).
Exist~treitipuridesufluriceaparlaaproximativ40%dintrebolnaviicuhipertensiune
arterial~ renovascular~. Astfel se poate decela: 1) suflu continuu sistolodiastolic pe aorta
abdominal~cuiradiere`n flancuridealungularterelorrenalecaracteristicdisplazieifibro
musculare; 2) un suflu aspru, `n general supraombilical, iradiat pe aort~ #i pe arterele
femurale asociat #i cu alte semne de stenoz~ ale axului aortoiliac (puls diminuat, paloare,
tulbur~ri trofice, `n ateroscleroza aortei) #i 3) suflu continuu cu caracter de dutevino la
nivelul flancurilor `n fistulele arteriovenoase (Bates B, 1991). Artera renal~ se auscult~
anterior cum am amintit, dar se pot decela sufluri de stenoz~ arterial~ la bolnavii
hipertensivi#iprinausculta[iaposterioar~lanivelulcoasteia12paramedian(BatesB,1991).
Explorarea c~ilor renale superioare (bazinet,
ureter) se poate efectua indirect. Informa[ii valoroase
ne furnizeaz~ punctele ureterale localizate la nivelul
abdomenuluicesepalpeaz~cuindexul(Fig.7):

Fig.7.Punctedureroaseureteraleabdominale.
1)punctulureteralsuperiorBazy;
2)punctulureteralmijlociuHalle.

1)punctulureteralsuperior(Bazy)(Fig.8)seafl~laintersec[ialinieiorizontaletrans
ombilicalecumarginilelateralealedreptuluiabdominal.Al[iautori`lplaseaz~laintersec[ia
orizontalei ce trece prin marginea inferioar~ a rebordului costal cu marginea lateral~ a
mu#chiuluidreptabdominal.
Acestpunctcorespundeposterior
punctuluisubcostalAlbarranBazyce,de
fapt,corespundebazinetului#ijonc[iunii
pieloureterale#idevinedureros`npato
logia c~ilor renale superioare (tumori,
litiaze,tuberculoz~).

Fig.8.Punctulureteralsuperior.

2) punctul ureteral mijlociu (Halle) (Fig.9) este situat la intersec[ia orizontalei ce


une#teceledou~spineiliaceanterosuperioarecumarginealateral~aaceluia#imu#chi#ise
mai nume#te punctul supraspinosTurneaux. Acest punct este dureros `n afec[iuni ale
ureteruluilombar#iiliac.
124

Capitolul3.Examenulclinicalaparatuluiurogenital

Fig.9.Punctulureteralmijlociu.

3) punctul ureteral inferior (Pasteau)


corespunde zonei ureterovezicale #i se
palpeaz~ direct prin tu#eu rectal sau vaginal.
Punctulureteralinferiorpalpatbimanualpoate
eviden[ia calculul ureteral juxtavezical sau
intramural ori tumora infiltrativ~ ureteral~
(patologia ureterului terminal) (Bates B, 1991;
SinescuI,2006).

Examenulveziciiurinare

Vezicaurinar~goal~nuestevizibil~lainspec[ie,nusepercut~#inusepalpeaz~,fiind
situat~ retrosimfizar. Atunci c]nd se poate percuta la adult, `nseamn~ c~ vezica urinar~
con[inecelpu[in150ml,iarlapeste300mlsepoatepalpa.Laocantitatemaimarede500
mldeurin~vezicadevinevizibil~lainspec[ie,lapacien[iislabi,caomas~tumoral~situat~
deasuprasimfizeipubiene,`nspe[~globulvezical.
Percu[iaarevaloaremaimarecapalparea`nevaluareauneiveziciurinaredestinse`n
special`ndou~situa[ii:1)c]ndpacientulesteobez#ipalpareasefacecudificultate#i2)`n
reten[ia cronic~ de urin~ c]nd peretele vezical este sub[ire, hipoton #i se palpeaz~ greu
(SinescuI,1998;SinescuI,2006).
Percu[iasedemareaz~imediatdeasuprasimfizei#isecontinu~`nsenscranialp]n~
exist~omodificarearezonan[eidelamatlasonor.
Palpareaseefectueaz~`ndecubitdorsal cucoapselemoderatflectatepe bazin,iar
m]na examinatorului percepe cu marginea cubital~ limita superioar~ a globului vezical, ce
ajungeuneorilanivelulombiliculuisauchiar`ldep~#e#teat]t`nreten[iaacut~,c]t#i`ncea
cronic~(Fig.10).
La bolnavii obezi distensia vezical~
poatetreceneobservat~.
Globul vezical nu este `ntotdeauna
strict median #i se poate lateraliza pierz]nd
aparentraporturileculojavezical~,situa[iece
se poate preta la confuzii cu chisturile
ovarienesaualtetumoriabdominale.
Exist~ situa[ii extreme c]nd vezica
urinar~ supradestins~ a provocat edemul
membrelorinferioareprincompresiepevase
le iliace (mecanism controversat) (Sinescu I,
2006).

Fig.10.Palpareaglobuluivezical.

125

TratatdeUrologie

Lanoun~scutsaulacopiiimicipalpareauneimasepelvinedeconsisten[~crescut~
poatefiovezic~urinar~cuperete`ngro#at#ihipertrofiatsecundarobstruc[ieicauzatede
valveuretraleposterioare.
Rarsaudescrisherniiinghinalecucon[inutperetevezicalcaresepotpalpa`ncazuri
extremelanivelscrotal.
Pentru vezica urinar~ nedestins~, cea mai bun~ metod~ de palpare este cea bima
nual~, de preferat sub rahianestezie, cu indexul m]inii drepte intrarectal sau intravaginal,
m]nast]ng~deprim]ndpereteleabdominalhipogastric`mpingevezicaspredegetulpalpator
(SinescuI,1998).`nacestfelsepoateapreciasuple[eapereteluivezical,mobilitateavezicii,
decelarea unui eventual reziduu vezical, prezen[a unor eventuale forma[iuni intravezicale,
fiind foarte valoroas~, de asemenea, `n cuantificarea gradului de infiltra[ie parietal~ `n
tumorilevezicaleinfiltrative.

Examenulorganelorgenitalelab~rbat

A.Examenulpenisului

Se va aprecia aspectul #i integritatea tegumentului. Dac~ pacientul nu a fost


circumcis, se decaloteaz~ glandul. Astfel, se pot eviden[ia tumori ale glandului sau ale
prepu[ului,ulcera[iilaacestnivel,balanite,foseteleglandelorTysonsituatedeoparte#ide
altalanivelulfrenului.
Celemaimultecancerepenieneaparlapersoanelenecircumcise#i`#iauorigineala
nivelulglanduluisauprepu[ului.Deaceeapacien[ilorcusecre[ieuretral~sanghinolent~,la
carenuesteposibil~decalotarea,trebuies~liseefectuezeoinciziedorsal~saucircumcizie
pentruaevaluauretra#iglandulcorespunz~tor.
Dificultatea sau imposibilitatea decalot~rii glandului (fimoz~), ca #i blocarea prepu
[ului`npozi[ieretrobalanic~(parafimoz~)impuninterven[iachirurgical~decorec[ie.
Inspec[ia pielii penisului poate decela cicatrici post#ancru sifilitic, ulcera[ii ale
glanduluicepotascundecancerepenienesauleziuniactivesifilitice(ulcera[ienedureroas~,
ro#ie,indurat~,cumarginiabrupte),verucivenerienecondylomaacuminatum(excrescen[e
cu cre#tere rapid~, suprafa[a neregulat~, papilomatoas~, umed~), vezicule superficiale
herpetice (buchet de vezicule, dureroase, neindurate pe fond eritematos) etc. O aten[ie
deosebit~trebuieacordat~uretreipetoat~lungimeasa,inclusivperineal~(fistule,cicatrici,
stricturi,periuretrite)(SinescuI,2006;WalshCP,2001).
`ncurbareapenisuluipoatefieviden[iat~cuu#urin[~,labazaeiexist]nddou~tipuri
maridecauze:congenital~(cordeecoard~)saudob]ndit~(boalaPeyronie).
Palparea penisului presupune obligatoriu palparea corpilor caverno#i ce poate
eviden[ia pl~ci sau noduli fibro#i situa[i `n grosimea fasciei Buck (cavernita fibroas~ sau
maladia Peyronie: bolnavul se pl]nge de durere #i de deformarea penisului `n timpul
erec[iei).Acestepl~cifibroaseapar`nspecialpeparteadorsal~apenisului.
Palparea uretrei se face pe partea ventral~ a penisului, unde se poate eviden[ia o
sensibilitatecrescut~,celmaifrecventsecundar~stricturiloruretrale.Uretra,deasemenea,
trebuieevaluat~#ilanivelulscrotului,c]t#iperineal.
Aprecierea m~rimii penisului este de asemenea important~ (macropenie sau
micropenie).

126

Capitolul3.Examenulclinicalaparatuluiurogenital

B.Examenulmeatuluiuretralextern

Trebuies~urm~reasc~4elementeclinice:1)formameatului,2)m~rimeameatului,
3)sediulfa[~dev]rfulpenisului(epispadiaspefa[adorsal~#ihipospadiaspefa[aventral~),
c]t#i4)prezen[aeventual~aanumitorscurgeripatologicecetrebuie`ntotdeaunac~utate
`naintedeapunepacientuls~urineze.
Secre[iileuretralepotfi:
1. nesanghinolente #i trebuie
considerate p]n~ la proba contrarie
veneriene (gonoree: cantitate crescut~,
consisten[~ crescut~, culoare g~lbuie, pe
c]nd `n uretritele nespecifice cantitatea
este redus~, consisten[~ sc~zut~ #i cu
aspectmucoid,grunjos);
2. sanghinolente ce pot ascunde
un cancer uretral #i mai rar la copii corpi
str~ini intrauretrali. `ntotdeauna meatul
uretral extern trebuie deschis `ntre dou~
degete pentru a examina fosa navicular~
(inflama[ie, tumor~) (Fig.11) (Sinescu I,
2006).

Fig.11.Examenulmeatuluiuretralextern.

C.Examenulscrotului#ialcon[inutuluiscrotal

Estefoarteimportant#itrebuierealizatcurigurozitate.Lainspec[iesepotobserva
infec[iialefiruluidep~rsaualeglandelorsebaceeabundentelaacestnivel.Folicululpilosse
poate infecta determin]nd mici pustule pe suprafa[a scrotului ce adesea se pot remite
spontan, dar pot da na#tere la infec[ii semnificative `n special la diabetici sau la imuno
supresa[i. Trebuie evaluat at]t volumul burselor scrotale, c]t #i aspectul tegumentului
scrotal. Se pot decela modific~ri ale culorii tegumentelor, cum ar fi eritem inflamator sau
orificii fistuloase, dar #i alte leziuni ce pot ascunde afec[iuni grave. De exemplu, absen[a
pliurilorsepoateconstata`ncazdeedeminflamatorsautumoriscrotale,iarelefantiazisul
scrotalapare`ncazdefilarioz~(frecvent`nzoneletropicale)saudeobstruc[ielimfatic~cu
blocajulganglioniloringhinali#ifemuralidup~rezec[iiradicalelaacestnivelsauneoplasme
ceinvadeaz~bilateralace#tiganglioni.Sepoatedecela#iunscrotbifid`ncazdehipospadias
scrotal sau perineal. Mici hemangioame scrotale pot fi descrise #i pot s]ngera spontan
(SinescuI,2006).
Prin palparea scrotului se pot eviden[ia suple[ea tegumentului, mobilitatea pe
planurileprofunde,greutateaburselor(cre#te`nhematom,hidrocel,tumori,pahivaginalit~).
Existen[aunuihemiscrotmicsugereaz~absen[atesticulului,careseconfirm~prinpalpare.

Aten[ie!Diagnosticulleziunilornecroticedetipgangren~Fournieresteeminamente
clinic!

D.Examenultesticulului

Sevaefectuaat]t`npicioarepentruaeliminaeventualeleafec[iuniextrascrotalecu
r~sunet scrotal (hernie, varicocel), c]t #i pentru a aprecia greutatea testiculului, dar #i `n
decubitdorsalcucoapseleflectate#i`nabduc[ieu#oar~.
127

TratatdeUrologie

Examenul trebuie efectuat `ntro


camer~ cu temperatur~ convenabil~ #i
cu m]inilecalde, altfel, mai aleslacopii,
risc~mcatesticululs~seretracteze#is~
dispar~dinburs~.Testicululsepalpeaz~
cu v]rful degetelor ambelor m]ini: cu o
m]n~ se imobilizeaz~ testiculul, iar cu
cealalt~sepalpeaz~(Fig.12).Sevaapre
cia forma testiculului, volumul, suprafa
[a, consisten[a #i sensibilitatea. `n mod
normal testiculul are o form~ ovoidal~,
are dimensiuni medii de 6/4 cm, are
suprafa[~ neted~, consisten[~ ferm~ #i
estenedureroslapalpare.

Fig.12.Palpareatesticulului.

Orice suprafa[~ dur~ sau de consisten[~ mai crescut~, decelabil~ la examenul fizic,
trebuie socotit~ tumor~ malign~ p]n~ la proba contrarie. Testiculul tumoral are anumite
caracteristici,cumarfi:prezint~oarieindurat~`ntroanumit~regiune,estemaigreucacel
opus, este nedureros la palpare, la transiluminare apare opac, iar suprafa[a acestuia este
adeseanet~,darpoatefi#ineregulat~.Aproape10%dintretumoriletesticulareseasociaz~
cuhidrocelreactiv.Dup~evacuareahidroceluluiesteimportants~fimsiguridelipsaacestei
asocieriprinecografiescrotal~ulterioar~(SinescuI,2006).
Testicululatroficaretreicauzeprincipale:1)torsiuneadetesticul,2)orhitaurlian~#i
3)orhitasecundar~orhidopexieisaudup~curaoperatorieaherniei.
Din punct de vedere clinic, testiculul atrofic apare de obicei ferm, hiposenzitiv
(sindrom Klinefelter), dar poate fi #i moale #i hipersenzitiv (ciroza hepatic~ sau dup~
administrareadeestrogeni).De#ispermatogenezaestealterat~,deobiceifunc[iaendocrin~
r~m]neprezervat~.
Absen[a testiculului din bursa scrotal~ se poate `nt]lni `n dou~ situa[ii: 1) una
tranzitorie`ncazdetesticulretractilfiziologicsau2)`ncazuriledecobor]reanormal~testi
cular~.
Palparea epididimului reprezint~ un pas important `n evaluarea afec[iunilor de la
acestnivel,deoarecepozi[iaacestuiapermiteunexamendirectpentruexaminator.Astfelse
pot eviden[ia coada, capul epididimului, #an[ul epididimotesticular dup~ cum epididimul
estelibersauata#atdetesticul.Prinpalpareputemdecela`nprincipalm~rireadevolum#i
indura[ia acestuia ce apar frecvent `n inflama[iile acute sau cronice #i rar `n tumorile
epididimare.
Dinpunctdevedereclinic,epididimitaacut~areurm~toarelecaracteristici:testiculul
#iepididimulfaccorpcomun#inupotfisepara[iprinpalpare,ader~eventuallascrot,iar
bursaestecongestiv~,cald~,deplisat~#icusensibilitatecrescut~.
`n epididimita cronic~, epididimul este indurat, nedureros #i are de obicei dou~
cauze:1)tuberculoza#i2)schistostomiaza.Pentruetiologiatuberculoas~pledeaz~indura[ia
cronic~epididimal~,nedureroas~,veziculeleseminaledilatate,prostat~nodular~,aderen[~
cutanat~scrotal~posterioar~,deferentelecaun#iragdem~rgele,piuriasteril~#iprezen[a
fistuleicronicescrotale.
Palparea capului epididimului este esen[ial~ pentru diagnosticul tumorilor testi
culare.Astfel,oricetumor~scrotal~,lacaresepoateeviden[iapesuprafa[aeicapulepididi
128

Capitolul3.Examenulclinicalaparatuluiurogenital

mului, este cu mare probabilitate un testicul mare, iar dispari[ia acestuia sau `ncastrarea
epididimului`ntumor~pledeaz~pentrucancertesticular.

E.Examinareavaginaleitesticulare

Sepoateefectuaprintransiluminare#ipalpare.Hidrocelulprintransiluminareapare
transparent, pe c]nd `n tumorile solide (hematocel #i pahivaginalit~) vaginala testicular~
apare opac~. Palparea poate pune `n eviden[~ prezen[a unor forma[iuni chistice fie
hidrocelul,cedeobicei`nconjoar~complettesticulul,fiespermatocelulcaredeobiceieste
situatlapolulsuperioraltesticululuisauseparatdeacesta.

F.Examenulcordonuluispermatic#ialcanaluluideferent

Cordonul spermatic se poate palpa `n regiunea scrotal~ rul]nd elementele ce `l


compun `ntre police, plasat ventral, #i celelalte degete situate dorsal, dar #i la nivelul
canalului inghinal prin rularea lui pe peretele posterior al acestuia din urm~ (Fig.13).
Cordonulspermaticsepoatemodificapatologic`nsensul`ngro#~rii#iindur~riidifuzepetot
traiectul acestuia `n special `n filarioze sau m~rirea acestuia, parcelar~ `n caz de tumor~
dezvoltat~ din una dintre structurile componente. M~rirea chistic~ de volum a cordonului
spermaticpoateap~rea `n hidrocelul comunicant asociat cu hernie congenital~ sau `n hernia
inghinal~dob]ndit~.
Un lipom dezvoltat printre elementele cordonului spermatic poate mima prezen[a
unei hernii inghinale. Canalul deferent se recunoa#te cu u#urin[~ prin consisten[a lui
caracteristic~#iseeviden[iaz~`nzonaposterioar~acordonului.
Lapalpare,canaluldeferenttrebuies~
aib~uncalibruuniform,osuprafa[~neted~#i
s~fiesuplu.
`ncazulinflama[iilor,canaluldeferent
apare`ngro#at,indurat,moniliform(#iragde
m~rgele/m~t~nii, tuberculoz~), cel mai frec
ventsecundarinfec[iilorepididimotesticulare.
Alteoripoatefiabsent,elementimportantde
descoperitlapacien[iiinfertili.

Fig.13.Palpareafunicululuispermatic.

Palparea venelor cordonului se


efectueaz~ `n orto #i clinostatism, `n timpul
respira[ieinormale#imanevreiValsalva.
Astfel putem face diagnosticul dife
ren[ial`ntrevaricocelulprimar#icelsecundar
(simptomatic). Percepera pulsa[iilor arterei
testiculareestesemndehipervasculariza[ie#i
poateap~rea`ntumoriletesticulare(Fig.14).

Fig.14.Examenulcanaluluiinghinal.

129

TratatdeUrologie

Tu#eulrectal#icelvaginalvorfidiscutateseparat.
Datorit~ faptului c~ `ntre aparatul genital feminin #i aparatul urinar exist~ asocieri
patologice este util s~ prezent~m c]teva elemente orientative la examenul fizic. Acesta se
efectueaz~ `n pozi[ie ginecologic~. Inspec[ia organelor genitale externe poate eviden[ia
modific~riatroficelanivelulmucoaselor,eroziuni,ulcera[ii,secre[ii,condiloamecepotcauza
mic[iuni dureroase #i disconfort pelvin. La noun~scu[i sau la copii trebuie inspectat vesti
bululvaginalpentruaneasiguradeabsen[aepispadiasului,labiilorfuzionate,dedeschidere
unic~aaparatuluiurinar#icelgenital(sinusurogenitalcomun).Dac~exist~secre[iivaginale,
sevaprelevapentrucolorare,`ns~m]n[arelafelcapentrusecre[iileuretrale.
Examenulmeatuluiuretralpoate decelacarunculiuretrali(leziunifriabile,sensibile,
ro#ii), ectropionul mucoasei uretrale ce impune diagnosticul diferen[ial de cancer uretral,
uneori fiind indicat~ biopsia #i chiar cancerul uretral distal. De asemenea, este important
examenul glandelor Skene #i Bartholin, inflama[ia c~rora poate fi sursa multor uretrite #i
cistiterebele.
La pacientele cu incontinen[~ urinar~ de efort, examenul genital poate eviden[ia
afec[iuni ce pot sta la baza acestei afec[iuni, cum ar fi cistocelul, rectocelul etc., pun]nd
pacientas~efectuezemanevraValsalvasaus~tu#easc~.Cistocelulpoatefi`nso[itdecistite
rebele prin rezidiul vezical secundar. Tot la inspec[ie se pot eviden[ia diverticulul uretral ,
fistuleuretro#ivezicovaginalesauleziuniherpetice(SinescuI,2006;TanaghoE,2002;Walsh
CP,2001).
Examenul cu valve poate decela eroziuni la nivelul peretelui vaginal anterior
(diverticuluretral)saulanivelulcoluluiuterin(cervicite,cancerdecoluterinetc.).
Palparea uretrei poate releva indura[ii (semn de malignitate #i/sau de inflama[ie
cronic~) sau prezen[a diverticulelor uretrale ce au de obicei o consisten[~ sc~zut~, iar prin
palparesepoteliminasecre[iipurulente.
Prin tu#eu vaginal se pot eviden[ia leziuni la nivelul uretrei, bazei vezicii urinare #i
ureteruluiinferior(cancer,litiaz~etc.).
Examenul bimanual se efectueaz~ cu dou~ degete introduse `n vagin #i cu cealalt~
m]n~plasat~peabdomenulinferior.Unuterm~ritdevolumsaubolilecolonicepotficauza
simptomelor urinare, iar cancerul de col uterin poate invada vezica urinar~ #i ureterul
terminaldetermin]ndosimptomatologiepleomorf~#iuneorifoartezgomotoas~.
Tot`nexamenulclinicalpacientuluiurologicintr~at]tevaluareaadenopatiilor,c]t#i
examenulneurologic.
Ganglionii inghinali pot fi afecta[i `n dou~ situa[ii: adenopatii inflamatorii ce pot
ap~rea `n sifilis, limfogranulomatoza venerian~, uretrite gonococice, afec[iuni ce implic~
pielea penisului, scrotului sau vulvei, adenopatii maligne cu punct de plecare cancere la
nivelulpenisului,scrotului#iuretreidistale.
Tumorile testiculare nu disemineaz~ `n ganglionii inghinali dec]t dac~ au invadat
pieleascrotuluisaupacientuluiisaf~cutanteriororhidopexie.
Tumorile testiculare disemineaz~ limfatic la distan[~, cu prima sta[ie limfatic~ la
nivelul retroperitoneului. Tumora de origine poate fi minuscul~ #i ascuns~ `ntrun testicul
aparentnormallaexamenulfizic.
Tumorile prostatice #i testiculare pot implica #i ganglionii supraclaviculari st]ngi. `n
plus,cancerelevezicale#iprostaticedisemineaz~lanivelulganglionilorpelvini(iliaciinterni
#iexternietc.)situa[iprofund,cenusuntaccesibiliexamenuluifizic.
Examenulneurologicpoateeviden[iacauzaunuireziduuvezical(vezicaneurologic~)
sauauneiincontinen[e urinareprindescoperireaunor deficiteneurologice.Deasemenea,
130

Capitolul3.Examenulclinicalaparatuluiurogenital

au un rol important #i `n evaluarea pacien[ilor cu disfunc[ie erectil~. Se apreciaz~ reflexul


bulbocavernos,achilean,tonusulsfincteruluianal,#tiindc~exist~oinerva[ieparasimpatic~
comun~cuacestestructuri(segmentulS2S4)(SinescuI,2006;WalshCP,2001).
Examenul,cuaten[iealregiuniilombosacrate,estefundamental,maialeslacopiiicu
deficien[eurologice.
Examenul ombilicului este important; la nivelul acestuia ajunge o ven~ ombilical~,
dou~ artere ombilicale #i uraca. Dac~ uraca r~m]ne neobliterat~, urina poate curge prin
ombilic.Dac~esteobliterat~distalapareundiverticulvezicouretral,iardac~esteobliterat~
par[ial#iintermediarexist~ozon~neobliterat~cedetermin~apari[iaunuichistombilical.

G.Tu#eulrectal

Tu#eul rectal este o manevr~ obligatorie `n cadrul examenului fizic general. Din
p~cate, acestanuseefectueaz~derutin~nicim~cardec~tre mediciichirurgi, fie eigene
rali#ti,ginecologi,toracicietc.Omitereatu#euluirectaldec~treurologiesteimpardonabil~.
Esteomanevr~simpl~,cetrebuieefectuat~cubl]nde[e,lasf]r#itulexamenuluiclinic
aviz]nd `nainte pacientul. Pentru a c]#tiga complian[a pacientului, este de preferat a se
efectuanumaidec~tremediculcareaexaminatbolnavul.
Experien[ajoac~unrolfoarteimportant,acestexamenput]ndfurnizaomultitudine
de informa[ii despre regiunea perianal~, anus, rectul inferior #i mediu, prostat~, vezica
urinar~,glandebulbouretrale,veziculeseminale,funduldesacperitonealrectovezical.
Pacientulesterugat`naintedeaceast~manevr~s~urinezepentruarecoltaprob~de
urin~ #i pentru a cre#te acurate[ea evalu~rii prostatei, ca m~rime #i consisten[~. De
asemenea,dac~ suspicion~m o prostatit~ cronic~, la care testul Stamey este fundamental,
estebinecapacientuls~aib~vezicaplin~pentruaputearecoltaurin~`naintedeefectuarea
masajuluiprostatic.
Tu#eulrectalseefectueaz~cuindexulm]iniidrepte,binelubrifiat,introdusprogre
siv, cu bl]nde[e, rug]nd pacientul s~ relaxeze sfincterul anal. Examinarea rectului #i
sfincterului anal se realizeaz~ `n timpul introducerii degetului examinator, iar evaluarea
urologic~ `n timpul retragerii acestuia av]nd reperul cranial v]rful coccisului, iar cel caudal
anusul.Pentruacre#teacurate[eaevalu~riiserecomand~palpareabimanual~lacarem]na
opus~ apas~ hipogastrul, `mping]nd vezica #i prostata spre degetul examinator. Aceast~
manevr~trebuies~fieeficient~,cursiv~#irealizat~`ntruntimprezonabil.
Eficien[a maxim~ a acestei evalu~ri se ob[ine la pacien[ii afla[i sub rahianestezie la
carerelaxareaesteoptim~#idisconfortulpacientuluiminim.
Tu#eul rectal se realizeaz~ `ntro
succesiunedeetape:
1. Pozi[ionareapacientului
Exist~ 4 modalit~[i de pozi[ionare a
bolnavului `n vederea efectu~rii tu#eului
rectal (Fig.15). Pentru evaluarea urologic~,
careinclude#iexaminareaorganelorgenitale
externe #i a regiunii inghinale, recomand~m
pozi[ia de litotomie (dreaptajos) (Sinescu I,
2006).

Fig.15.Modalit~[idepozi[ionare`ntu#eulrectal.

131

TratatdeUrologie

2. Inspec[ia regiunii anale, perianale #i perineale reprezint~ un timp preliminar


obligatoriu`nainteaefectu~riitactuluirectal.Astfelputemdetectaoeventual~patologiela
nivelul acestor regiuni anatomice: hemoroizi externi, carcinom anal, fisuri anale, fistule
perianale,abceseperianale,perineale,cicatricietc.Deasemenea,sepoteviden[iaexcoria[ii,
ulcera[ii(inclusiv#ancrulluetic),chistpilonidaletc.

3. Introducerea degetului examinator indexul, protejat de m~nu#a chirurgical~,


lubrifiat cu vaselin~. Se aplic~ v]rful degetului pe orificiul anal #i se invit~ pacientul s~ se
scream~(manevraValsalva).`nmomentulc]ndsesimterelaxareasfincteruluiseavanseaz~
degetul`ncanalulanal,respect]nddirec[iaacestuia(spreombilic).Manevranutrebuies~fie
dureroas~, chiar dac~ este nepl~cut~ pentru bolnav. Prezen[a durerii indic~ fie o manevr~
incorect~ (brutal~, cu degetul insuficient lubrifiat), fie prezen[a unei leziuni ce nu a fost
observat~(fisur~anal~)#iimpuneoprireamanevrei.
Odat~ degetul introdus `n rect, se palpeaz~ sistematic to[i pere[ii p]n~ la limita
accesibil~,identific]ndrepereleanatomice#ieviden[iindanomaliiledelanivelulacestora.

4.Estimareatonusuluisfincteruluianalestefoarteimportant~.Untonussc~zutsau
crescutsugereaz~modific~riidenticelaniveluldetrusoruluisausfincteruluiurinar:
un tonus sc~zut poate fi sugestiv pentru boli neurologice ce afecteaz~ conco
mitent#isfincterulurinar#idetrusorul;
untonuscrescutspastic,deasemenea,sepoateasociacubolineurologice,dar#i
cuafec[iunilocoregionaleinflamatorii(fisurianale,fistuleanorectale,hemoroizi
externi,rectite).

5.Palpareacanaluluianalpetoat~circumferin[apentruaexclude:
stenoza
hemoroiziinterni
criptita
fistulelerectale
polipiimuco#i
neoplasmanorectal.

6.PalpareaglandelorCowpercudegetulintrodus`nrectp]n~laarticula[iainter
falangian~ (pria falang~) #i orientat cranial #i lateral, `n timp ce policele palpeaz~ zona
perineal~ corespunz~toare indexului. Se vor sim[i glandele rul]nd `ntre cele dou~ degete
atunci c]nd sunt inflamate. Normal, nu se palpeaz~ sau se examineaz~ cu dificultate.
Inflama[iaglandelorCowper#ia[esuturilorvecinelefaces~proemine`nregiuneaperineal~
anterolateraldeorificiulanal.Inflama[iasedeceleaz~at]tprininspec[ie,c]t#iprinpalpare
(SinescuI,2006).

7.Palpareauretreiperineale(uretrite,indura[ii,calculi,abceseperiuretrale,tumori
etc.).

8. Examenul ampulei rectale, dup~ dep~#irea canalului anal degetul examinator


p~trunde `n ampula rectal~ care trebuie examinat~ `n `ntregime prin rotirea degetului cu
3600.Ampularectal~poatefigoal~sauocupat~de:

132

Capitolul3.Examenulclinicalaparatuluiurogenital

fecaloame(diagnosticdiferen[ialcliniccutumoriledeampul~rectal~fecalomul
arelimit~dedemarca[iepetoat~circumferin[acuperetelerectal);
tumorirectale.

9. Palparea fundului de sac peritoneal rectovaginal poate fi dureroas~ (`n caz de


peritonit~)saupoatedecelaonodozitatedur~`nmetastazeleperitoneale.

10.Examenulprostateitrebuieefectuatsistematic,petoat~suprafa[aei.
Seevalueaz~:m~rimea,consisten[a,suprafa[a,mobilitatea#isensibilitatea.
M~rimeaauneicastane,de3/3cm,cecorespundeunuivolumde15g,cuform~
detrunchideconcubazamare`nsus,av]ndunapexorientatcaudal#i2unghiurilaterale
(coarne prostatice). De regul~, se descriu la palpare doi lobi laterali demarca[i de un #an[
median, cu limite laterale precis delimitate. `n cazul cre#terii dimensiunilor prostatei,
#an[urile laterale devin proeminente, cel median se #terge, iar diametrele prostatei se
alungesc. Cre#terea dimensiunii prostatei reprezint~ un indiciu important `n diagnosticul
hiperplaziei benigne de prostat~, dar aceasta nu se coreleaz~ cu simptomatologia sau cu
severitateaobstruc[iei.
Suprafa[aneted~,uniform~,`ncondi[iile`ncaremucoasarectal~esteindemn~.
Consisten[a normal este similar~ cu a eminen[ei tenare contractate (cu degetul
mare `n opozi[ie complet~ peste cel mic). Consisten[a este fermelastic~, omogen~ ca de
cauciuc.
Modific~rialeconsisten[ei:

`ncongestiaprovocat~de:
Consisten[~moale
lipsacontactelorsexuale
infec[iecronic~cudrenajafectat
Consisten[acrescut~
`nhiperplaziaadenomatoas~
Consisten[aindurat~
`nprostatitacronic~cusauf~r~calculi
Consisten[apietroas~
`ncancerulavansat

Schimbarea consisten[ei prostatei `ntro zon~ limitat~ reprezint~ singura metod~


clinic~eficient~`nridicareasuspiciuniidecancerdeprostat~(SinescuI,2006).
Exist~odificultate`ndiferen[iereaariilorfermedinprostat~:
fibrozadininfec[ianespecific~
prostatitagranulomatoas~
nodulituberculo#i
calculiprostatici
cancerprostaticprecoce.

Noduliicauza[ideinfec[ie(prostatit~cronic~#ituberculoz~):
proemin~lasuprafa[aglandei
marginilelorse#tergtreptat.

Noduliidetermina[idecancer:
nuproemin~/`ncastra[i
margininete
duri
tinds~apar~`n#an[ullateral.
133

TratatdeUrologie

Dac~ exist~ un nodul prostatic, dar nu exist~


semne de tuberculoz~ #i nu exist~ puroi `n secre[ia
prostatic~ atunci probabilitatea de cancer prostatic
este mare, mai ales dac~ RRVS nu arat~ calculi
prostatici(proiecta[ichiarpesimfiz~).
PSApoatefideajutordac~estecrescut(exist~
cancer prostatic cu PSA sc~zut). Urm~torul pas este
biopsiaprostatic~.

`n litiaza prostatic~ multipl~ se pot produce


crepita[ii la palparea glandei prin frecarea calculilor
(semnulsaculuicunuci)(SinescuI,2006).

`ncanceruldeprostat~,dateleculeseprintu#eulrectalvariaz~`nfunc[iedestadiul
dedezvoltarealtumorii,dup~cumurmeaz~:

Cancerulinsitunuproducemodific~rilatu#eulrectal,diagnosticulfiindhistologic
(corespundeT1).

Nodululcanceros:`ntroprostat~normal~sauhipertrofiat~adenomatos,degetul
exploratordeceleaz~unnoduldur,dem~rimevariabil~,`ncastrat`nparenchimul
glandular. Nodulul poate fi unic sau multiplu, `n acela#i lob sau `n ambii lobi
prostaticioripoateocupaintegrallobulrespectiv(corespundeT2).

Prostata mare, dur~: `ntreaga gland~ prostatic~ este mare, cu o duritate


lemnoas~,cureparti[ieuniform~sauneregulat~.

`ntrunstadiumaiavansat,glanda`#ipierdeconfigura[ia#iseprezint~caomas~
tumoral~bomb]nd`nampularectal~,cumarginicesepierdlateral,cuprelungiri
laterocraniene `n direc[ia veziculelor seminale care sunt `nglobate `n procesul
neoplazic. Blocul tumoral este fix, clasicii descriind leziunea `n "cap de taur", `n
care glanda prostatic~ reprezint~ capul propriuzis, iar coarnele erau date de
veziculele seminale destinse de con[inutul ce nu se putea elimina prin canalele
ejaculatoaresufocatedeprocesulneoplazic.Cercet~rilenecropticeaustabilitc~
cesesimtem~ritestetumora#inuveziculeleseminaledestinse(corespundeT3).

Carcinomatozaprostaticopelvin~reprezint~stadiullocaldedezvoltaremaxim~a
tumorii.`naceast~etap~,tu#eulrectaldescoper~omas~tumoral~dens~,care
cuprindetotpelvisul,aderent~lapere[iioso#i,imobil~,neregulat~,dureroas~la
atingeresautotalindolor~.Rectulpoateficomprimat,`ngustatsauchiarefectiv
invadatdemasatumoral~(corespundeT4)(SinescuI,2006).

Mobilitatea`nafec[iunilebenigneprostata`#imen[inemobilitatea.`ncancerulde
prostat~localavansat,aceastapoatedisp~rea.
Sensibilitatea glandei este crescut~ `n afec[iunile inflamatorii acute (prostatita
acut~).Simptomatologie:
febr~,indispozi[ie
disconfortperineal#irectal
polachiurie
disurie.
134

Capitolul3.Examenulclinicalaparatuluiurogenital

Tu#eul rectal deceleaz~: prostat~ sensibil~, fierbinte, cu consisten[~ crescut~,


fluctuent~ (`n abces prostatic) / `mp~stat~. `n timpul examin~rii prostatei se va examina
meatuluretraldac~exist~scurgeri.

Examenulmacroscopicalurinei

Examenul de urin~ ocup~ un loc important `n semiologia nefrologic~ #i poate fi


consideratcaobiopsierenal~intravitam. Pentruurologulaflatlacameradegard~sau `n
cabinetul de consulta[ie este esen[ial, `n cadrul examenului clinic, s~ cunoasc~ atributele
normale #i patologice pe care le are urina la emisie evaluat~ din punct de vedere macro
scopic.Astfelsepotapreciaevident,cuooarecarerelativitate,aspectulurinei(turbiditatea),
culoarea#imirosulurinei.
Aspectulurineinormalevariaz~`nfunc[iedeconcentra[ie,detemperaturamediului
ambiant #i de timpul trecut de la emisie. La emisie, urina normal~ este limpede #i
transparent~.
Ea poate deveni tulbure la temperaturi sc~zute atunci c]nd pHul este alcalin #i
con[inefosfa[i`ncantitatecrescut~careprecipit~.
Deasemenea,urinapoateaveaacestaspect#i`ncazulunuipHacid#icon[ineura[i
`ncantitatemare.
Cea mai frecvent~ cauz~ de urin~ tulbure este fosfaturia, ce apare de obicei dup~
mesesaudup~ingestia`ncantitatemaredelapte.Diagnosticulfosfaturieisefacerapidprin
acidifiereaurineicuacidaceticcedetermin~clarificareaurineisauprinexamenmicroscopic
cearat~cantit~[imaridecristaledefosfatamorf.
Ourin~tulburepoateascunde:
1. s~ruri(ura[ihiperuricozurie,oxala[ihiperoxalurie,fosfa[isaucarbona[i)
2. num~rcrescutdehematii,leucocitesauceluleepiteliale
3. flor~microbian~abundent~
4. gr~simicedauaspectl~ptos(chilurie)lipidurie
5. sulfamidepu[insolubile.
Piuria este a doua cauz~ de urin~ tulbure dup~ fosfaturie, aspectul fiind datorat
num~rului crescut de leucocite #i de obicei se asociaz~ cu infec[ie urinar~. Diagnosticul
diferen[ial se face pe baza mirosului ce `n caz de infec[ie urinar~ este specific (nu exist~
miros`ncazdefosfaturie)#iprinexamenmicroscopic(leucociteversuscristaledefosfa[i).O
urin~tulburechiarlaemisiepoatecon[inepuroi,care`ntimpformeaz~undepozitgalben
verzui.
Urina normal~ formeaz~ la agitare o cantitate redus~ de spum~ alb~. `n condi[ii
patologice atunci c`nd urina con[ine proteine `n cantit~[i crescute la agitare formeaz~ o
cantitate crescut~ de spum~. Dac~ urina con[ine pigmen[i biliari sau fenozopiridin~ spuma
estegalben~.
Mirosul urinei poate constitui un element de diagnostic important `n cazul exa
menuluifizic.Pentruaevaluamirosulurinei,aceastatrebuierecoltat~respect]ndprincipiile
dezb~tute la recoltarea urinei pentru urocultur~. Cu alte cuvinte se dezinfecteaz~ glandul
saulabiilemaricusolu[ieantiseptic~#iapoisecolecteaz~unspecimendinjetulmijlociude
urin~ proasp~t~ `ntrun recipient steril (Medline plus Medical encyclopedia NIH). Urina
proasp~t~ are un miros caracteristic, u#or fad sau aromatic datorat acizilor volatili sau a
substan[elorurinoidepecarelecon[ine.Urinanormal~poateaveaunmirosmodificatcenu
ascundeobligatoriuoleziunepatologic~,iar`ncazulurinelorconcentrate,c]ndestemirosul
135

TratatdeUrologie

accentuatsaudezagreabil,sedatoreaz~unuiaportcrescutdehrean,usturoisausparanghel.
De asemenea, p~strat~ la temperatura camerei, urina poate dob]ndi un miros amoniacal
datorit~descompuneriisubstan[elorchimice.
Modific~rilepatologicealemirosuluiurineipotfideterminatede:
1. mirosamoniacal`ninfec[iiurinaresautumorirenale
2. mirosputrid`ninfec[iicuflor~anaerob~
3. mirosdemereacre`ncetonurie
4. mirosdeuntr]nced`nhipermetioninemie
5. insuficien[ahepatic~
6. fistul~rectal~,mirosspecificdefecale
7. maplesugarurinedisease
8. fenilcetonurie.
Culoareaurineinormaleestedat~deurocromi#ivariaz~delagalbenpailagalben
auriu.
`ncondi[iifiziologice, culoarea urinei depindededensitate,pH,diet~#ioraemisiei.
De exemplu, `n regimul carnat urina are o culoare mai `nchis~, iar `n cel vegetarian mai
deschis~.
Exist~omultitudinedealimente,medicamente,produ#imetabolici#iinfec[iicepot
modificaculoareaurinei.
Mul[ipacien[imerglaconsulta[iepentruacestmotiv#iastfelesteimportantpentru
urologs~#tiecauzelecelemaifrecventealemodific~riiculoriiurinei.
Trebuiespusc~sauidentificataproximativ72decauzecestaulabazamodific~rilor
deculoarealeurinei,dintrecare7cauzesuntfrecvente,16suntrare#ifoarterare,iar55
dintreelenuauoevaluareepidemiologic~clar~.Celmaifrecvent,culoareaurineivariaz~`n
func[iedecantitateadeap~pecareocon[ine.
Astfel, `n caz de deshidratare, aport sc~zut de ap~, urina este `nchis~ la culoare,
portocaliebrun~, asociat~ cu un miros puternic, pe c]nd urina apoas~ este albg~lbuie,
diluat~.
Ocazional, o culoare anormal~ a urinei poate constitui un semn particular al unui
proces patologic. `n sclerozele renale `nso[ite de oligurie urina este hipocrom~ datorit~
incapacit~[ii[esutuluirenaldeaoxidacromogeniiurinari.
Culoareaurineipoatefifoartevariat~:
ro#ie
portocalie
brun~
verde
albastr~
l~ptoas~(tulbure)
galbenpaispreapoas~.
Culoarearo#iesaubrun~aurineiapare`ncelemaimultecazuri`nhematurie,darse
poate`nt]lni#i`nhemoglobinurie,mioglobinurie,porfirinurie,alcaptonurie,melanurie.
Diferen[ierea hematuriei, hemoglobinuriei sau mioglobinuriei se poate face prin
metode chimice, examen microscopic al sedimentului urinar #i compararea culorii super
natantuluiurineicentrifugatecuaceeaaseruluisanguin.

136

Capitolul3.Examenulclinicalaparatuluiurogenital

Microhematurie
Macrohematurie
Hemoglobinurie
Mioglobinurie

Test
benzidin~
pozitiv
pozitiv
pozitiv
pozitiv

Culoaresupernatant
Hematiiurin~ Culoareser
urin~
clar
pozitiv
clar
ro#u
pozitiv
clar
ro#u
negativ
ro#u
ro#ubrun
negativ
clar

Culoarearo#ieaurineimaipoatefiindus~#i`nst~ridetoxicitatemedicamentoas~:
1. medicamenteceinducporfiriaacut~:barbiturice
2. medicamenteceinducrabdomiolize:clofibrat,heroin~
3. medicamenteceinduchematurie: warfarin~,urokinaz~.
Altesubstan[eceinducculoarearo#ieaurineisunt:metronidazolul,nitrofurantoin,
levodopa,metildopa,laxative,fenolftalein~,fenitoina,fenotiazide,toxicecapirogalol,crezol,
nitrobenzen, bacterii ca Serratia marcescens etc. De asemenea: rifampicina, sfecla ro#ie #i
fenazopiridinapotstalabazaacesteimodific~ri.
Culoarea portocalie apare dup~ administrarea redus~ de lichide, febr~, #i `n toate
st~rile de deshidratare, ca #i `n administrarea de sulfamide (sulfasalazina), suplimente de
betacarotensaudec~treurobilinogen(icter).Rubarbapoatestalabazacolora[ieiportocalii
aurinei.
Culoareagalbenincolorapare`ncazdediurez~apoas~,hiperhidrat~ri,diabetinsipid,
tratamentdiuretic,fazapoliuric~ainsuficien[eirenalecronice,aportcrescutdealcool.
Culoarea galben #ofran spre brun se `nt]lne#te `n cazul hemoglobinuriei, Mburiei,
hematuriei, porfirinuriei, dar #i datorit~ prezen[ei bilirubinei #i deriva[ilor ei (icter), fena
cetin~, caroteni, flavone, rubarba, chinin~, colchicin~, deriva[i antronici (aloe, sena), metil
dopa,nitrofurantoin,ro#udeCongo,crezol,nitrobenzenetc.
Culoareaalbl~ptos:chilurie,fosfaturie,piurie.
Culoarea maro (brun): urobilinogen, porfirie, furazolidon, metronidazol, nitro
furantoinetc.
Culoarea verdealbastru: albastru de metilen, albastru Evans, amitriptilin~, bili
verdin~,cimetidin~,cupru,sparanghel.
Culoarea verde murdar: cei de mai sus la care se adaug~ biliverdin~, bil~, bacterii
cromogene(piocianic,triamteren,crezoli).
Culoareamaronegricios:alcaptonurie,melanurie,Metildopa,hematurievecheetc.

Bibliografie

1.
2.
3.
4.
5.
6.
7.
8.

BatesBAGuidetoPhysicalExaminationandHistoryTaking.FifthEdition.J.B.LippincottCompany,
Philadelphia,1991.
BrucknerISemiologiemedical~,EdituraMedical~,2002.
ProcaETratatdepatologiechirurgical~.VolVIII,Ed.Med.,Bucure#ti,1984;partea1:24.
SinescuIUrologieCurspentrustuden[i,EdituraUniversitar~CarolDavila,Bucure#ti,2006.
SinescuILucr~ripractice,EdituraUniversitar~CarolDavila,Bucure#ti,2006.
SinescuIUrologieclinic~.EdituraMedical~Amaltea,Bucure#ti,1998.
TanaghoE,McAnnichJSmith'sGeneralUrology.XVthEd.Appleton&Lange,EastNorwalk,2002.
Walsh CP, Retik BA, Stamey AT Vaughn ED Cambell's Urology. XVIIIth Ed. WB Saunders Company,
Philadelphia,2001.

137

Capitolul4.Investiga[iidelaborator`nurologie

Capitolul

INVESTIGA IIDELABORATOR
`NUROLOGIE

Conf.Dr.DANMISCHIANU

DR.CORINATAUBNER

139

TratatdeUrologie

Cuprins:

I.Hemoleucogramacomplet~#ivitezadesedimentareahematiilor141
II.Determinareagrupelorsangvuine
150
III.Explorareahemostazei#iafibrinolizei150
IV.Doz~ribiochimiceserice/plasmatice158
V.Testeimunologiceserice(markeritumorali,hormoni)167
VI.Analizaurinei170

Bibliografie183

140

Capitolul4.Investiga[iidelaborator`nurologie

Expunerea capitolului de Investiga[ii de laborator `n urologie va urma o topic~


dictat~demodulexecu[ieieizilnice.

I.Hemoleucogramacomplet~#ivitezadesedimentareahematiilor

Hemoleucograma (HL) este unul dintre cele mai valoroase examene de laborator
folosite`ninvestigareaini[ial~#i`nurm~rireaoric~ruipacient,inclusivapacientuluiurologic.
Parametriihemoleucogrameicomplete,`nvariantaautomat~#i/sauclasic~,sunt(cu
specifica[ia c~ actualele buletine de analiz~ con[in aceste prescurt~ri, necesar a fi
cunoscute):
- hemoglobina(HbsauHGB)
- hematocritul(HtsauHCT)
- num~ruleritrocitelor(nr.Er)
- volumuleritrocitarmediu(VEMsauMCV)
- con[inutulmediudehemoglobin~`neritrocite(HEMsauMCH)
- concentra[iamedieahemoglobinei`neritrocite(CHEMsauMCHC)
- histogramaeritrocitelor(RDW)
- reticulocitele,exprimateprocentual#i`nvaloriabsolute(retic)
- num~rultrombocitelor(nr.TrsauPLT)
- volumulmediualtrombocitelor(VTMsauMPV)
- volumultrombocitarprocentual(PCT=pachetocrit)
- histogramatrombocitelor(PDW)
- num~rulleucocitelor(nr.LsauWBC)
- neutrofilele,monocitele,limfocitele,limfociteleatipice,celulelemariimature(expri
mateprocentual#i`nvaloriabsolute).

Analizoarele hematologice automate, din laboratoarele de hematologie, variante


constructive apar[in]nd diferitelor firme produc~toare, folosesc, `n general, tehnologii
bazatepeprincipiidem~surareasem~n~toare:
- citometria`nflux
- varia[ia impedan[ei sau a conductibilit~[ii la trecerea celulelor printro apertur~
calibrat~
- spectrofotometria
- analizacon[inutuluienzimatic
- dispersiadec~trecelulealuminiiemis~deunfascicullasermonocromatic,detec[ia
cuajutorulfotodetectorului#iconversia`nimpulselectric.

Num~ruldeimpulsuridetermin~num~rulcelulelor,iaramplitudineaimpulsuluieste
propor[ional~cuvolumulcelulei.
Informa[iilecolectate pentru10.000celuleindividualedintroprob~suntprocesate
decomputer,rezultatelereg~sindusepebuletinuldeanaliz~subformavalorilorabsolute,
procentelor,rapoartelor#iahistogramelor.
Rezultatele ob[inute sunt exacte, precise #i sigure (P~un R, 1999) dac~ se respect~
regulilerecolt~rii#ipreg~tiriianalizorului(`ntre[inere,calibrare,controldecalitate).
Diferen[iereaautomat~acelulelorareoseriedelimite`nsitua[iipatologicelegatede
prezen[aeritrobla#tilor,alimfobla#tilor,alimfociteloratipice,agranulocitelorimatureetc.

141

TratatdeUrologie

Analiza automat~ nu poate depista anomalii morfologice ale eritrocitelor sau


prezen[amicroorganismelorintracelularesauextracelulare(bacterii,fungi,parazi[i).
`nacestesitua[iiseimpuneexaminareamicroscopic~clasic~afrotiuluides]ngecare
permite analiza morfologic~ de fine[e a unui num~r de c]teva sute de celule, dar permite
decelareaanomaliilormorfologicecarescap~analizeiautomate.
Coroborarea datelor hemoleucogramei automate #i ale celor furnizate de micro
scopia optic~ clasic~ morfologului hematolog permite minimizarea dezavantajelor fiec~rei
metode #i folosirea avantajelor pe care le au analiza hematologic~ automat~ #i metoda
clasic~.

Recoltareas]ngeluipentruhemoleucogram~

Probele adecvate pot proveni din s]ngele venos, s]ngele capilar (deget, c~lc]i, lobul
urechii)sauarterial(P~unR,1999).
Recoltarea se face `n tuburi vidate care con[in anticoagulant K2EDTA (acid etilen
diaminotetraaceticsaredepotasiu)1,52,2mg/ml(IacobsDS,2004)acoperitecudopmov
sau`nmicroteinerepentruprobedins]ngecapilar.
Respectarea cantit~[ii de s]nge indicat~ pe eticheta tubului vidat #i omogenizarea
prinmi#c~rigentileimediatdup~recoltaresuntaspectefoarteimportante.
Probatrebuieanalizat~dup~maxim6oredelarecoltaredac~sap~stratlatempe
raturacamerei,saudup~maxim24ore,dac~afostrefrigerat~la40C.
Nupoatefianalizat~oprob~coagulat~sauhemolizat~.

Hemoglobina

Generalit~[i:
Hemoglobina este elementul esen[ial din structura eritrocitului #i are func[ia de
transportaloxigenului.
Valoareahemoglobineiintr~`ncalcululindiciloreritrocitari(HEM#iCHEM).

Valorinormale:
- b~rba[i: 1317g/dl
- femei: 1216g/dl.

Importan[aclinic~:
- scade`n:anemie,hemoragie,hemoliz~
- cre#te`npolicitemie.

Rezultatefalse:
- crioglobulinemie
- carboxihemoglobina(>10%)
- hemoglobinaSsauC
- hemolizainvivo
- tratamentcuheparin~
- hiperbilirubinemia
- lipemia
- prezen[aproteinelormonoclonale
142

Capitolul4.Investiga[iidelaborator`nurologie

falssc~zute:probecumicrocoaguli.
Metodededeterminare:
Hb ob[inut~ dup~ hemoliz~se transform~ prin reac[ie chimic~ `ncianHb m~surat~
spectrofotometricla540mm
Spectroscopia`ninfraro#upentruuneleanalizoareautomate.

Hematocritul

Generalit~[i
- Hematocritulreprezint~procentuldeeritrocitedins]ngeletotal.ValoareaHTintr~`n
calcululunorindicieritrocitari(VEM#iCHEM).

Valorinormale:
- b~rba[i:3951%
- femei:3647%.

Rezultatelefalsepotfidatorateanomaliiloreritrocitare(microcite,macrocite,sfero
cite)`ncare,pentrumetodamanual~,valorilesuntmaimaricucirca2%.
Pentrumetodaautomat~,prezen[acrioglobulinelor,leucocitozelemari,trombocitele
gigantepotdarezultatefalsmaimari;microcitoza,hemoliza,autoaglutinareapotdarezul
tatefalsmaimici.

Metodededeterminare:
- manual~:centrifugareamicrotuburilorde75mm/1mmcapilarecon[in]nds]ngetotal
cu anticoagulant EDTA potasic la 1012.000 g/5 minute #i citirea procentului de
hematii
- automat~:parametrulestecalculatdeanalizorHT=RBCxMCV/10.

Num~ruleritrocitelor

Generalit~[i:
- Num~ruleritrocitelorseexprim~`nunitatedevolums]ngetotal#iestefolositpentru
calcululindiciloreritrocitari(VEM#iHEM).

Valorinormale:
- b~rba[i:4,66x106/mm3
- femei:3,95,5x106/mm3.

Rezultatefalsmaimicipotfidatorateprezen[eiaglutininelorlarece.

Importan[aclinic~:
- scade`nanemii,hemoragii,hemolizeintrasauextravasculare,dilu[ieintravenoas~
- cre#te `n policitemia vera sau policitemii secundare (hipoxemie sau produc[ie
crescut~deeritropoietin~asociat~unorchisterenalesaucarcinoamerenale)
- cre#te`nhemoconcentra[ie.

Metodededeterminare:
clasic~:prinnum~rare`nhemocitometru
143

TratatdeUrologie

automat~:num~r~toareelectronic~.

Indiciieritrocitari

Generalit~[i:
- indiciieritrocitarisecalculeaz~folosindvalorileHb,HT#iNr.Er.#ipermitclasificarea
anemiilor
- au aplica[ii `n asigurarea controlului intern de calitate din laboratorul de hema
tologie.

VEMesteraportuldintreHT#inr.Er:

HT%
VEM=
x10
E(X106/l)

Sem~soar~`n3(micronicubi)saufl(femtolitri)/eritrocit.

HEMesteraportuldintreHb#inr.Er:

Hb(g/dl)
HEM=
x10
E(x106/l)

Sem~soar~`npg/eritrocit.

CHEM reprezint~ concentra[ia medie de Hb a eritrocitelor exprimat~ `n procente,


respectivc]tegramedeHbsuntcon[inute`ntrundecilitrudemas~eritrocitar~.

Hb(g/dl)
CHEM=
x100
HT%

Sem~soar~`ng/dl.

Indicelededistribu[ieadimensiuniieritrocitelor,histogramaeritrocitelor(RDW)este
unparametrum~suratelectronic,sugestivpentruanizocitoz~.Seexprim~`nprocente.

Valorinormale:
- VEM: 80943
- HEM: 2534pg/eritrocit
- CHEM:3236g/dl
- RDW: 11,714,2%.

Importan[aclinic~:
Sintezainforma[iilorfurnizatedeindiciieritrocitaripermiteconturareaunorentit~[i
patologice.
`n anemia feripriv~ VEM scade `naintea CHEM invers dec]t `n anemia din bolile
cronice.

144

Capitolul4.Investiga[iidelaborator`nurologie

`nanemiahemolitic~,`nhemoragiesaupolicitemie,modific~rileindiciloreritrocitari
suntdiscrete.
AnemiilemegaloblasticesuntcaracterizatedeVEMcrescut.
`nhemocromatoz~VEM,CHEM#iHEMauvaloricrescute.
VEMpoateficrescut`ncetoacidozadiabetic~datorit~hiperosmolarit~[iiplasmatice,
`ngeneralVEMcrescutpoatefiunindiciudestatushiperosmolar.
La unii pacien[i cu uremie hemodializa[i cronic se pot asocia anemii microcitare cu
VEMsc~zut.
RDWcre#te`nanemiaferipriv~#i`nbetatalasemiamajor~.
Datele furnizate de valoarea indicilor eritrocitari trebuie corelate cu examenul
microscopicalfrotiuluides]ngeperiferic.

Pentru stabilirea etiologic~ a sindroamelor anemice diagnosticate se apeleaz~ la o


seriedetestedelaborator,dintrecareamintim:
- Sideremia:valorinormale:
b~rba[i:60160g/dl
femei:50150g/dl.
- Capacitateatotal~delegareafierului:TIBC
Valorinormale:250350g/dl
- Saturareatransferinei:normal2050%
- Transferina:200380mg/dlnormal
- Acidulfolic:normalpeste2ng/ml
- VitaminaB12:normal1.0002.000pg/ml
- Eritropoietina,normal536mUi/ml
- HemoglobinaA2:normal23,2%dintotalulhemoglobinei.

Rezultate false pot fi cauzate de coexisten[a la un pacient a macrocitelor #i micro


citelor la care indicii eritrocitari se pot situa `n intervalul de normalitate sau de prezen[a
autoaglutin~rii.

Metodededeterminare:
- manual~: prin calcularea rapoartelor conform formulelor introduce factori de
eroare
- automat~:corobor]ndprocedeeledescrise.

Reticulocitele

Generalit~[i:
Reticulocitele sunt eritrocite tinere care dup~ pierderea nucleului p~streaz~ resturi
deARNribozomal.
Num~rullor`ns]ngeleperifericesteunindiciualactivit~[iieritropoieticeam~duvei
osoase.

Valorinormale:
- 0,51,5%
- 1080x109/l.

145

TratatdeUrologie

Importan[aclinic~:
valoricrescutese`nt]lnesc`nhemoragiiacute#icronice,`nanemiihemolitice
valorisc~zute`nanemiiaplazice.

Rezultatefalse:
la pacien[ii cu parazi[i intracelulari, trombocite mari, leucemie limfatic~ cronic~,
porfirie,aglutinarelarece,potap~rearezultatefalscrescute.

Metodededeterminare:
manual~: se num~r~ pe frotiul colorat supravital cu albastru cresyl str~lucitor
hematiile cu con[inut de ARN ribozomal colorat #i se raporteaz~ la 100 hematii
mature.
automat~:folose#tecitometriadeflux#imarcareacusubstan[~fluorocrom~aARN
ului ribozomal este mai precis~; se poate determina #i indicele de maturitate a
reticulocitelor(RMI)util`ntransplantulmedular.

Analizatrombocitelor

Generalit~[i:

Num~rul trombocitelor `n s]ngele periferic circulant este important `n coagulopatii,


procesetrombotice,malignesauautoimune#i`nevaluareafunc[ieim~duveiosoase.

De asemenea, prezint~ importan[~ diametrul, volumul trombocitelor #i histograma


trombocitelor.

Valorinormale:
- num~rultrombocitelor:150450.000/mm3sau/l
- diametru:23
- volummediutrombocitar:6,512fl
- plachetocrit:0,1780,217%(IacobsDS,2004).

Importan[aclinic~

Trombocitopeniapoatefiasociat~urm~toarelor`mprejur~ri:
- deficitdeproduc[iedatoratunoragen[ifizicisauchimici(chimioterapie)
- cauzeimunologicedistrugerea`npurpuratrombocitopenic~idiopatic~
- sechestrareatrombocitelorlanivelulunortumoribogatvascularizate
- hipersplenism
- consumcrescut(CID)
- dup~hemoragiimari,transfuzii,infec[ii.

Trombocitozasepoate`nt]lni:
- `nst~rifiziologicedup~efort,postpartumdup~administrareacontraceptivelororale
- asplenism
- infec[ii,inflama[ii
- bolimaligne
- distruc[iitisulare
- sindroamemieloproliferative.

146

Capitolul4.Investiga[iidelaborator`nurologie

Potdeterminacomplica[iitromboembolice.

Rezultatefalse:
num~rfalscrescut`nhipertrigliceridemii
num~rfalssc~zut`ncazulprezen[eimicrocheagurilor`nprob~,alsatelitismuluiTla
neutrofile.

Metodededeterminare:
manual~:num~rare`nhemocitometrulamicroscopulopticpreciziemic~
automat~:m~surareaoptic~saubazat~pevaria[iaimpedan[ei.

Confruntarea num~rului de trombocite ob[inut pe analizorul automat sau prin


metodaclasic~cuaspectultrombocitelorpefrotiuldes]ngecolorat#iestimarealorsemi
cantitativ~esteextremdeutil~.

Num~rulleucocitelor#iformulaleucocitar~

Generalit~[i:

Reprezint~testedetriajobligatoriipentruinvestigareaoric~ruipacient.

Num~rulleucociteloresteutilpentruevaluareamielopoezei,`nurm~rireainfec[iilor
virale,bacteriene,aproceselortoxice,metabolice,astatusuluileucemic.

Formula leucocitar~ reprezint~ expresia procentual~ #i/sau `n valori absolute a


diferitelor tipuri de leucocite aflate `n s]ngele periferic circulant (granulocite neutrofile
segmentate#inesegmentate,granulociteeozinofile,bazofile,limfocite,monocite).

Valorinormale:
- num~rulleucocitelorlaadult:49.000/l(P~unR,1999);450011.000/l(IacobsDS,
2004).Intervaluldereferin[~estediferitprezentat`nsurselebibliograficeconsultate,
sestabile#telanivelulfiec~ruilaborator
- Neutrofilenesegmentate:24%
- Neutrofilesegmentate:5070%
- Eozinofile:24%
- Bazofile:01%
- Limfocite:2535%.

Importan[aclinic~:
- efortul,stresul(asociatecueliberareaadrenalinei)potcre#tenum~rulLcu25000l
- probeledins]ngelecapilarpotdavalorialenum~ruluiLmaimaricu312%dec]t`n
s]ngelevenos(IacobsDS,2004)
- cre#tereanum~ruluideleucocite`ninfec[iiacuteseasociaz~cuneutrofilie#iuneori
devierelast]nga
- `ninfec[iiviralecre#tenum~rullimfocitelor
- sc~derea num~rului L se `nt]lne#te `n boli autoimune (exemplu: lupusul eritematos
sistemic)`nso[it~deneutropenie
- leucopeniaestecomun~sindroamelormielodisplazice,leucemieiacutemieloblastice
- eozinofiliaseasociaz~cuparazitoze,afec[iunidermatologice,statusalergic
- bazofiliase`nt]lne#te`nuneleprocesemaligne.

147

TratatdeUrologie

Rezultatefalse:
prezen[a agregatelor de trombocite, a crioglobulinelor sau criofibrinogenului, a
eritrocitelornelizate,potdarezultatefalscrescute
corec[ianum~ruluideleucocite`ncazulprezen[eieritrobla#tilorsefaceprindeter
minareaformuleileucocitare#ianum~ruluideeritobla#tila100deleucocite,apoi
cuajutorulformulei(P~unR,1999):

nr.cel.nucleate/l
L/l=
x100
100+nr.eritobl/l

valori fals mai mici se pot ob[ine `n probe cu microcheaguri, `n probe p~strate `n
condi[ii necorespunz~toare `n care celulele `#i pierd integritatea sau la pacien[ii cu
sindrommielodisplazicsauapoptoz~.

Metodededeterminare:
manual~: folosind hemocitometrul, proba se dilueaz~ cu o solu[ie care lizeaz~
eritrocitele(CV=10%)
Formulaleucocitar~sedetermin~pefrotiuldes]ngecoloratexaminatlamicroscop.
automat~: folose#te varia[ia impedan[ei sau a conductibilit~[ii, dispersia luminii
emis~defasciculullaser,reac[ieicitochimice(CVpentrunr.L=13%).

Examenulmicroscopicalfrotiuluides]ngeperiferic

Furnizeaz~ informa[ii importante asupra tuturor celulelor din s]nge. Poate fi un


elementdediagnosticsaupoatesugerainvestiga[iisuplimentare.

Studiuleritrocitelorcuprinde:
- analizalordimensional~,`ncadrarea`nnormocite,macrocite(>9m),microcite(<6
m),semnalareagraduluidevaria[ieam~rimii(anizocitoz~)
- Analiza formei: modific~rile sunt importante `n diagnosticul anemiilor; trebuie
semnalat~ prezen[a sferocitelor, eliptocitelor, a stomatocitelor (forma de gur~),
schizocitelor(fragmentedeeritrocit),adacriocitelor(form~delacrim~)etc.
- Analiza concentra[iei #i a distribu[iei hemoglobinei; se descrie normocromia, hipo
cromiacarepoatemergep]n~laanulocitoz~
- Descriereapropriet~[ilortinctoriale:prezen[amacrocitelorpolicromatofile(reticulo
cite)
- Analizadistribu[ieieritrocitelor:normaluniform~
- Agregarea lor `n rulouri indic~ o paraproteinemie, iar aglutinarea `n gr~mezi AHAI
(anemiahemolitic~autoimun~)cuautoanticorpilarece
- Incluziile din eritrocite sunt anormale #i se men[ioneaz~ (exemplu: parazitul
malariei).

Studiulleucocitelorcuprinde:
- formulaleucocitar~sedescrie:devierealast]ngapentruneutrofile.
Dup~Schiling,`ninfec[ieexist~treifazedistincte:
a)fazadelupt~cuneutrofilie
b)fazadeap~rarecueozinofilie
c)fazadevindecareculimfocitoz~.
148

Capitolul4.Investiga[iidelaborator`nurologie

Semnalareaprezen[eicelulelorruptesaudegenerate,prezen[acelulelordinalteserii
(eritrobla#ti,megacariobla#ti,fragmentedemegacariocite,plasmocite)
Analiza modific~rilor de talie: granulocite gigante sau poliploide `n mielodisplazii,
postterapiecitostatic~
Descriereaanomaliilornuclearehipersegmentarealaneutrofile
Descrierea anomaliilor la nivelul citoplasmei: neutrofile hipo sau agranulare `n
infec[iisevere,mieloprolifer~ricronice,mielodisplaziisaugranula[iitoxice`ninfec[ii
severe,septicemii.

Studiultrombocitelorpermite:
controlulnum~ruluitrombocitelorprinestimareasemicantitativ~anum~ruluilor#ia
distribu[ieipefrotiu
analizadimensiunii(trombociteletineresuntmaimari)#iavaria[iilordeform~.

Asocieri de elemente semnalate pe frotiul de s]nge utile diagnosticului (P~un R,


1999):
hipocromiacumicrocitoz~sugereaz~anemiaferipriv~
hipocromia#iprezen[aeritrocitelor`nrulourisugereaz~anemiacronic~simpl~
prezen[aschizocitelor,policromatofilia,trombociterareizolatesugereaz~CID
rulouri,tablouleucoeritoblasticplasmociteatipicesugereaz~mielomulmultiplu
macromegalocitoza+neutrofilehipersegmentatesugereaz~anemiamegaloblastic~
leucocitoza+neutrofilie+rulourisugereaz~oreac[ieleucemoid~
leucocitoz~+limfocitoz~sugereaz~LLC
limfociteanormale,rulourisugereaz~mononucleoz~infec[ioas~
leucocitoza+bazofilie+devierelast]ngasugereaz~leucemiagranulocitar~cronic~.
Vitezadesedimentareahematiilor(VSH)

Generalit~[i:

VSHesteuntestdetriajpentruinvestigareafiec~ruipacient.

Recoltareas]ngeluipentruVSHseface`ntruntubvidatacoperitcudopnegrucare
con[inecitratdeNa3,8%0,5ml,iarvolumultotaldup~recoltareeste2ml.

S]ngele bine omogenizat cu anticoagulantul se plaseaz~ vertical `ntrun stativ 60


minute, dup~ care se cite#te lungimea coloanei de plasm~ r~mas~ dup~ sedimentarea
eritrocitelor.

Valorinormale:
- b~rba[isub50deani:<15mm/1or~
- b~rba[ipeste50deani:<20mm/or~
- femeisub50deani:<20mm/1or~
- femeipeste50deani:<30mm/1or~.

Sursedeeroare:
- concentra[iaanticoagulantuluimaimaredec]tcearecomandat~
- folosireaaltuicoagulantdec]tcitratul
- buledeaer`ntub
- hemoliza

149

TratatdeUrologie

abateridelaverticalitatearecipientului
temperatura`nafaraintervalului2025oC.

Factoriceinfluen[eaz~VSH:
plasmatici: fibrinogenul crescut, frac[iunile 2, #i globuline determin~ cre#terea
VSH(proteineasimetricecarescad`nc~rc~turanegativ~aeritrocitelorpoten[ialul
zetadetermin~formarearulourilorcaresedimenteaz~mairepede)
albuminascadeVSH,colesterolulcre#teVSH
factori dependen[i de eritrocite: anemia determin~ cre#terea VSH; microcitele
sedimenteaz~ mai `ncet ca macrocitele care au raport sc~zut suprafa[~volum;
eritrocitelecuformeanormale(sferocitele)sedimenteaz~mai`ncet.

Semnifica[ieclinic~(HenryJB,1996):
`n sarcin~, VSH cre#te moderat din s~pt~m]na 1012 #i revine la normal la o lun~
dup~na#tere
cre#te mult `n mielom multiplu, macroglobulinemie, `n hipergamaglobulinemii poli
clonale,`nboliinflamatorii,`nhiperfibrinogenemii
cre#te moderat `n boli inflamatorii (artrit~ reumatoid~), infec[ii cronice, boli de
colagen, neoplazii; este util `n monitorizarea lor, dar valoarea normal~ a VSH nu
excludediagnosticulacestorafec[iuni
scade`npolicitemii.

II.Determinareagrupelorsangvine

Transfuziades]nge,at]tdeimportant~`nurologie,presupune(pentruevitareaunor
accidente foartegrave)determinarea compatibilit~[ii imunologice dintre s]ngele transfuzat
#iorganismulprimitorului,ceeaceesteposibilprindeterminareagrupelorsangvineA,B,0
#iaRhului.

Determinarea grupelor sangvine A, B #i 0 const~ `n eviden[ierea antigenelor


(aglutinogenelor)prinmetodaBethVincent#iaaglutininelorprinmetodaSimonin.

Metoda BethVincent presupune reac[ia dintre serurile test 0, A #i B #i eritrocitele


pacientului. `n metoda Simonin se folosesc eritrocite test 0, A #i B #i ser de la pacient. Se
urm~re#teprezen[aaglutin~rii#iseface`ncadrarea`ncelepatrugrupeA,B,AB#i0.

Determinarea Rhului se face cu ajutorul antiserului antiD care reac[ioneaz~ cu


eritrocitelepacientului.

Aglutinareasemnific~Rhpozitiv.

Pel]ng~determinareagrupelorA,B,0#iRhladonator#ilaprimitorultransfuzieimai
este necesar~ #i proba direct~ a compatibilit~[ii (Jeanbreau) prin cercetarea aglutin~rii `n
pic~turadeserdelapacientamestecat~cueritrocitedinflaconuldes]ngecareurmeaz~afi
transfuzat(BarbuR,1979).

III.Explorareahemostazei#iafibrinolizei

Explorarea hemostazei #i a fibrinolizei face parte din screeningul preoperator al


fiec~ruipacienturologic.
150

Capitolul4.Investiga[iidelaborator`nurologie

Hemostaza, ansamblul reac[iilor #i mecanismelor careconcur~ la oprireas]nger~rii,


presupuneparticipareavasuluisangvin,atrombocitelor,afactorilorplasmaticiaicoagul~rii
#ia[esuturilor.

Mecanismelecareasigur~lizacheaguluidefibrin~formattrebuieinvestigateal~turi
dehemostaz~(BarbuR,1979).

Hemostazaprimar~,lacareiaupartevasele#itrombocitele,dureaz~24minute#i
realizeaz~oprireatemporar~as]nger~riiprinformareaunuitrombusplachetar.

A.Explorareahemostazeiprimare

1. Timpuldes]ngerareexploreaz~fazavascular~#itrombocitar~ahemostazei.
Estefolositmaipu[in`nprezentdatorit~specificit~[ii#isensibilit~[iiluireduse.

Tehnicafolosit~:
- se`n[eap~lobulurechiila3mmad]ncime#isetamponeaz~lafiecare30secundecu
h]rtiedefiltrup]n~`nceteaz~s]ngerarea.

Valorinormale:
- 25minute(CucuianuM,1994).

Importan[aclinic~

Alungireatimpuluides]ngerarese`nt]lne#te`n:
- trombocitopenii(sub80100.000/mm3)
- tratamentcuaspirin~(pentrudeterminareatimpuluides]ngerarepacientultrebuie
s~`ntrerup~tratamentulcuaspirin~cuos~pt~m]n~`nainte)
- uremie
- macroglobulinemie
- boal~vonWillebrandetc.

2. Testele de fragilitate capilar~ au aceea#i semnifica[ie, dar o valoare discriminatorie


mairedus~.Celmaidesutilizatestetestulgaroului(RumpellLeeds),`ncarerezul
tatulseapreciaz~dup~num~rulpete#iilorap~rute`ncondi[iidestaz~venoas~deo
anumit~durat~(BarbuR,1979).

3. Num~r~toareatrombocitelor(clasicsaufolosindanalizorulautomatdehematologie)
#i examenul lor morfologic pe frotiul colorat pot oferi informa[ii utile pentru c~
trombocitopeniile reprezint~ cea mai frecvent~ cauz~ a s]nger~rilor cutanate #i
mucoase.
Valorinormale:150450.000/mm3.

4. Testele func[ionale pentru trombocite (adezivitatea #i agregarea) nu se practic~ `n


laboratoareleclinice`nmodcurent.

B.Explorareacoagul~rii

Se realizeaz~ cu ajutorul testelor care investigheaz~ coagularea global~ sau


anumitesegmentealeei.

151

TratatdeUrologie

1. Timpul de coagulare a s]ngelui total LeeWhite, folosit mai mult `n trecut, permite
analizac~iiintrinseci#icomuneacoagul~rii,dararesensibilitateredus~.

Tehnic~:serecolteaz~s]nge`neprubetadesticl~de10/100mm#i seurm~re#te
dinminut`nminutmomentul`ncares]ngeleestecoagulatcomplet.

Valorinormale:612minute.

2. Timpuldecoagulareaplasmeirecalcificate(timpulHowell)areaceea#isemnifica[ie,
dar este mai sensibil dec]t testul precedent. Permite diferen[ierea tipurilor de
hemofilie#idecelareaprezen[eideanticoagulan[icirculan[i(antitromboplastinici).
Valorinormale:60120secunde(BarbuR,1979).

Celedou~testedescrisesefolosescpu[in`nprezent.`npracticadelaboratoreleau
fost`nlocuitecutestemaisensibile#imaispecifice,carevorfiexpuse`ncontinuare.

Recoltareas]ngeluipentrucoagulogram~:
Rezultatele testelor de coagulare depind `n mod esen[ial de calitatea plasmei
ob[inut~dinprobarecoltat~.
O punc[ie venoas~ care traumatizeaz~ c]t mai pu[in [esuturile sau folosirea pentru
testele de coagulare a celei de a doua eprubete recoltate #i evitarea unei linii venoase
heparinatepotoferioprob~decalitate.
Tubulvidatpentrucoagulogram~con[inecitratdesodiu3,8%#iesteacoperitcudop
albastru.
Atunci c]nd pacientului i se recolteaz~ eprubete pentru diferite teste, se respect~
urm~toareaordine:tubulcudopro#u,apoicelcudopalbastru#icelecudopmov(EDTA),
verde(heparin~)#inegru(oxalat).
Este obligatorie respectarea cantit~[ii de s]nge la recoltare `n tubul pentru
coagulogram~#iomogenizarealuiprinmi#c~rigentilecuanticoagulantul.
Nusepotprocesa`nlaboratorprobelecoagulate,hemolizatesaucele`ncarenuse
respect~volumuldes]ngelarecoltare.
Plasma citratat~ separat~ de trombocite se ob[ine prin centrifugare standard dup~
maximoor~delarecoltare#isepoatep~strane`nghe[at~maxim4ore.

3. Timpul de protrombin~ (PT) sau timpul Quick informeaz~ asupra fibrinoform~rii


ini[iale pe calea extrinsec~ #i depinde de prezen[a factorului VII #i de factorii X, V,
protrombin~#ifibrinogendincaleacomun~.
Timpuldeprotrombin~seefectueaz~ad~ug]ndlaplasmacitratat~unvolumdintro
suspensie de tromboplastin~ complet~ (echivalentul tromboplastinei tisulare factorul
tisularextras~din[esuturibogatecreier,pl~m]nsaurecombinat~).Sem~soar~timpul
de coagulare dup~ adaosul de calciu. Reactivul este, deci, un fosfolipid cu factor tisular #i
calciu.
Valorilenormale:orientativ1014;elesestabilesc`nfiecarelaborator`nfunc[iede
instrumentulfolosit(coagulometru)#idereactivuldecaredispune.Expunerearezultatelor
se poate face #i `n procente din activitatea protrombinic~ normal~ (indice de pro
trombin~);valorinormale:85100%.

Importan[aclinic~:
a. Screening pentru integritatea c~ii extrinseci (factor VII) #i comune (fibrinogen,
protrombin~,factorV#iX)acoagul~rii.
152

Capitolul4.Investiga[iidelaborator`nurologie

Pentru a observa prelungirea PT, deficitul factorului de coagulare implicat `n


coagulopatietrebuies~fie`ntre1545%,dependen[a[inedesensibilitateareactivului.
TimpulQuickestenormal`nvasculopatii,trombocitopatii,precum#i`ntulbur~riale
tromboplastinogenezeideterminatededeficitealefactorilorplasmatici(caleintrinsec~).

PrelungireaPTpoateavea:
cauzemo#tenite:
- deficituldefactorVII(APTTnormal)
- deficituldefibrinogensauprotrombin~,factorVsauX(APTTpoatefiprelungit)

cauzedob]ndite:
disfunc[iahepatic~(PTsemodific~maidevreme#imaimultdec]tAPTT)
deficituldevitaminaK(PTsemodific~maidevreme#imaimultdec]tAPTT)
coagulareaintravascular~diseminat~(CID)PTsemodific~maidevreme#imaimult
dec]tAPTT
prezen[aanticoagulantuluilupic(APTTpoatefisaunuprelungit,PTrarprelungit)
heparinaprelunge#teAPTT,mairarprelunge#tePTdepindedereactivulfolosit
prezen[ainhibitorilorspecificiaifactorilorcoagul~rii(APTTprelungit`nafaracazurilor
raredeinhibitorispecificipentrufactorulVII).

b. Monitorizareatratamentuluicuanticoagulanteorale.
Sefolose#teraportulnumitINR(InternationalNormalizedRatio):

ISI
PTpacient
INR=
PTmartor

ISI international sensitivity index = parametru al sensibilit~[ii particulare a


reactivuluifolosittromboplastinacomplet~.Seprefer~ISIapropiatde1.

Intervalul recomandat pentru efectul terapeutic al tratamentului cu anticoagulante


oraleesteINR=23.
La ini[ierea tratamentului PT/INR se determin~ zilnic sau de 45 ori pe s~pt~m]n~
p]n~c]nddozaadministrat~#iINRsuntstabile,apoiINRseurm~re#telunar.
Efectulanticoagulantseobserv~dup~45ziledatorit~timpuluide`njum~t~[iremare
alfactorilorII#iXasuprac~roraac[ioneaz~.
Deaceea,lapacien[iic~roraleestenecesarunefectanticoagulantimediatseini[iaz~
tratamentulcuanticoagulantecuefectprompt(tipheparin~)p]n~c]ndanticoagulantuloral
`#i manifest~ efectul. Heparina se continu~ p]n~ c]nd INR are valoarea dorit~ dou~ zile
consecutiv.
Supradozarea anticoagulantului oral (INR > 5) `nso[it~ sau nu de s]ngerare poate fi
corectat~ cu vitamina K sau cu plasm~ proasp~t~. Administrarea vitaminei K `n doz~ mare
determin~orezisten[~temporar~laanticoagulantoralpentrupacient(IacobsDS,2004).
-

Dozadeanticoagulantoralpoatefiinfluen[at~deunelest~ricaredepinddepacient:
hipertiroidismul,insuficien[a,cancerul,febra,deficituldevitaminaKimpunsc~derea
dozeideanticoagulantpentruob[inereacre#teriidoriteaPT/INR
hipertiroidismul sau anumite particularit~[i genetice ale pacientului pot motiva
cre#tereadozeideanticoagulantpentruob[inereaefectuluidorit.Exist~pacien[icu

153

TratatdeUrologie

rezisten[~ genetic~ la anticoagulant oral #i numai doze mari pot men[ine INR `n
intervalulterapeutic.

4. Timpuldetromboplastin~par[ialactivat~(APTT)m~soar~timpuldecoagularedela
momentulactiv~riifactoruluiXIIp]n~laformareacheaguluidefibrin~.
Este un test screening pentru integritatea c~ii intrinseci #i comune a coagul~rii,
prelungirea lui fiind datorat~ deficitului factorului VIII, IX, X #i/sau XII sau prezen[ei unui
inhibitor (anticoagulant lupic sau anticoagulant administrat `n scop terapeutic, respectiv
heparina).
APTTsedetermin~`nplasm~proasp~trecoltat~#icentrifugat~deoarecefactorulVIII
poateprelungifalsAPTT,iarvalorifalssc~zutepotfideterminatedeeliberareafactorului4
trombocitarcareneutralizeaz~heparina.
APTT este timpul de coagulare a plasmei recalcifiate cu adaos de agent de activare
prin contact a factorului XII #i Kalikreinei. Astfel de agen[i sunt suspensiile de pulbere de
caolin~,celit~,pulberedesticl~sauacidelagic#iactiveaz~caleaintrinsec~acoagul~rii.
Reactivulesteotromboplastin~par[ial~carenucon[inefactortisular,spredeosebire
de cea folosit~ pentru determinarea PT care este o tromboplastin~ complet~ #i activeaz~
caleaextrinsec~acoagul~rii.
Valorilenormale:orientativ2039;elesestabilesc`nfiecarelaborator`nfunc[iede
instrumentulfolosit#idereactivuldecaredispune.

Importan[aclinic~:
a. screeningpentruintegritateac~iiintrinseci#icomuneacoagul~rii:
pentru a observa prelungirea APTT, deficitul factorului de coagulare implicat `n
coagulopatie trebuie s~ fie `ntre 1545% (Iacobs DS, 2004), dependen[a [ine de
sensibilitateareactivului.

PrelungireaAPTTpoateavea:
cauzemo#tenite:
- deficitulfactoruluiVIII,IX,X,XII,prekalikreinei(PTnormal)
- deficitulfibrinogenului,factoruluiII,V,X(PTprelungit#iel)
cauzedob]ndite:
- anticoagulantullupic(PTnormal,deobicei)
- heparina(PTmaipu[inafectatcaAPTT)
- hirudinasauargatrobanul(PTprelungit,deobicei)
- disfunc[iahepatic~(PTmodificatmaidevreme#imaimultcaAPTT)
- deficitulvitamineiK(PTmodificatmaidevreme#imaimultcaAPTT)
- CID(PTmodificatmaidevreme#imaimultcaAPTT)
- prezen[a inhibitorilor specifici ai factorilor coagul~rii (PT normal, cu excep[ia
cazurilorraredeinhibitoriaifibrinogenului,aifactorilorII,V,X).

b. Monitorizareatratamentuluicuheparin~
Dozemicideheparin~nefrac[ionat~administrat~subcutanatprofilactic(deexemplu
5000deunit~[idedou~oripezi)nunecesit~monitorizarefolosindtestedecoagulare.
Num~rultrombocitelortrebuieurm~ritpentrucaposibilatrombocitopenieindus~s~
fiesurprins~latimp.
Heparinele cu greutate molecular~ mic~ nu prelungesc APTT #i nu produc trombo
penie.
154

Capitolul4.Investiga[iidelaborator`nurologie

Doze mari, terapeutice de heparin~ nefrac[ionat~ trebuie monitorizate cu APTT #i


num~r~toareatrombocitelor.
RaportulAPTTpacient/APTTmartorconvenabilterapeuticeste1,52,5.
De obicei, heparina se administreaz~ intravenos, `n bolus, urmat~ de doze de
`ntre[inere.APTTsem~soar~lafiecare6ore`nprimazi,la6oredup~schimbareadozei#i
apoiodat~pezip]n~laterminareaterapiei.
Maipu[infrecventseadministreaz~terapeuticheparinanefrac[ionat~subcutanatde
dou~ ori pe zi cu controlul APTT la 6 ore dup~ injec[ie, v]rful de activitate este la 24 ore
dup~ administrare subcutanat~. Dac~ pacientul tratat cu heparin~ nefrac[ionat~ `ncepe
tratamentul cu anticoagulante orale, heparina se continu~ dou~ zile dup~ ce INR are
valoarea`nintervalulterapeutic.
Rezisten[alaheparin~poatefidatorat~prezen[eiproteinelordefaz~acut~carepot
neutraliza heparina #i nu se ob[ine prelungirea APTT, sau mai rar, deficitului de
antitrombin~.
APTTse folose#te #i pentru monitorizarea tratamentului cu hirudin~, antitrombotic
utilizatlapacien[icutrombopenieindus~deheparin~.
Dozeleterapeuticeuzualedehirudin~:0,4mg/Kgi.v.,`nbolus,apoi0,15mg/Kg/or~
i.v. `n perfuzie. APTT se determin~ dup~ 4 ore de la `nceperea terapiei, dup~ 4 ore de la
schimbareadozei#iapoizilnic.RaportuldoritAPTTpacient/APTTmartoreste1,52,5(Jacobs
DS,2004).

5. Timpuldetrombin~(TT)exploreaz~etapafinal~depecaleacomun~acoagul~rii#i
depindedoardeprezen[auneicantit~[isuficientedefibrinogencoagulabil.

Valori normale: 1013 sau 1624, dependente de concentra[ia trombinei `n


reactivul folosit. Acest test prezint~ valori anormal prelungite `n caz de sc~deri de fibrino
genemie,`nprezen[aheparinei,aprodu#ilordedegradarefibrinolitic~sauaunormolecule
de fibrinogen anormale. De#i util pentru depistarea unor desfibrinogenemii, testul cu
trombin~nureprezint~oexplorarederutin~absolutnecesar~#isepractic~doar`ncazuri
rare(CucuianuM,1994).

PT, APTT #i TT pot orienta asupra tipului de coagulopatie. Precizarea deficitului


factoruluisaufactorilordecoagularesefaceprinexplor~rispeciale.

Astfel:
- PT normal, APTT prelungit #i TT normal sugereaz~ o anomalie pe cale intrinsec~.
Deficitul poate afecta urm~torii factori: VIII, IX, XI, XII, prekalikreina, kininogenul cu
greutatemolecular~ridicat~
- PT prelungit, APTT normal #i TT normal sugereaz~ o anomalie pe calea extrinsec~.
Posibil deficit de factor VII. Acest aspect poate surveni #i `n perioada de `nceput a
terapieicuantagoni#tiaivitamineiK
- PT prelungit, APTT prelungit #i TT normal sugereaz~ o anomalie pe calea comun~.
PosibildeficitdefactorV,Xsauprotrombin~.Deficitelemultipleafect]ndfactoricare
intervinpediverselec~ipotrealizaaceast~asocieredeteste
- PT normal sau prelungit, APTT normal sau prelungit, TT prelungit sugereaz~ o
anomaliecantitativ~saucalitativ~afibrinogenului.PrelungireaPT#iaAPTTindic~un
deficitseveralfibrinogenului.

6. Testespecificepentrufactoriicoagul~rii

155

TratatdeUrologie

`nprincipiu,oricefactoralcoagul~riipoatefidozatat]tprinmetodeimunologiceca
antigen,c]t#ipebazaactivit~[iisauprocesuldecoagulare(CucuianuM,1994),subaspect
cantitativ,dar#ifunc[ional.
a. Fibrinogenulestetransformat`nfibrin~dec~tretrombin~.Sc~derealuisub100
mg/dlseasociaz~cus]ngerare;poatefimo#tenit~,darmaifrecventdob]ndit~`n
insuficien[ahepatic~,CID.
Valorinormale:150400mg/dl.
DozareafibrinogenuluisefacefieprinmetodaClauss(coagulareacutrombin~a
plasmeidiluate;timpuldecoagulareesteinverspropor[ionalcunivelulfibrinogenului
`nprob~),fieprinmetodebazatepePT.
b. Factorii V, VII #i X se determin~ amestec]nd plasma de analizat cu o plasm~
deficitar~ `n factorul care urmeaz~ a fi dozat. Se determin~ PT, iar gradul de
corectare a timpului de coagulare se compar~ cu acela produs de plasma
normal~.
c. Factorii VIII, IX, XI #i XII se determin~ folosind plasm~ deficitar~ `n unul din
factorii men[iona[i; se amestec~ cu plasma de analizat #i se efectueaz~ un test
APTT:Graduldecorectareatimpuluidecoagularesecompar~cuacelprodusde
plasmanormal~(CucuianuM,1994).
d. AntitrombinaIIIesteoprotein~curolanticoagulantalc~reideficitdetermin~o
hipercoagulabilitate#icre#terisculdetromboz~.
Valorinormale:80130%sau170390mg/L(IacobsDS,2004)
Valorisc~zute`n:
- deficitfunc[ionalhepatic
- tromboze
- CID
- interven[iichirurgicale
- sindromnefrotic
- administraredecontraceptiveorale.

e. ProteinaCesteoprotein~curolanticoagulant,alc~reideficitdetermin~ohiper
coagulabilitate#icre#terisculdetromboz~.Deficitulpoateficantitativ(tipI)#i
calitativ(tipII).
Valorinormale:70140%.
Valorisc~zute:
- deficitfunc[ionalhepatic
- deficitalvitamineiKsautratamentcuwarfarin~
- interven[iichirurgicale
- tromboze
- CID.

f. Proteina S este cofactorul proteinei C. Deficitul ei determin~ o hiper


coagulabilitate#icre#terisculdetromboz~venoas~.Deficitulpoateficantitativ
(tipI)#icalitativ(tipII).
Valorinormale:70140%.
Valorisc~zute`n:
- deficitulsintezeihepaticesautratamentcuwarfarin~
- tromboz~
156

Capitolul4.Investiga[iidelaborator`nurologie

g.

CID
tratamentcuestrogeni,contraceptiveorale,sarcin~
sindromnefrotic
varicel~,infec[iacuHIV.
Rezisten[alaproteinaCactivat~#imuta[iafactoruluiVLeidenesteositua[iece
conducelahipercoagulabilitate#irisccrescutdetromboz~venoas~.
Esteprezent~la5%dinpopula[iacaucazian~#iesteresponsabil~de4050%din
trombozelerecurente.
Metodelededeterminaresebazeaz~fiepem~surareaPTT,fieprineviden[ierea
muta[ieilanivelulADN(prinPCRpolymerasechainreaction).

C.Explorareafibrinolizei

1. Timpul de liz~ a cheagului de s]nge (`n eprubet~, la 370C); `n mod normal liza se
producemait]rziude24deore;`nfibrinolizaacut~timpuldeliz~poatesc~deasubo
or~;`nfibrinolizacronic~poateap~realizapar[ial~(cheagf~r]mi[at).
2. Timpuldeliz~acheaguluieuglobulinic(TLCE),maisensibil,sebazeaz~peeliminarea
din plasma cercetat~ a inhibitorilor fibrinolizei (prin tratarea cu acid acetic), coagu
larea (prin recalcifiere) a euglobulinei r~mase (con[in]nd fibrinogen, plasmin~,
plasminogen #i activatori) #i urm~rirea timpului de liz~(normal 3 ore; `n fibrinoliz~
estescurtatsub2ore,chiarsub30minute)(BarbuR,1979).
3. Ddimerii#iprodu#iidedegradareaifibrinei(PDF)

Subac[iuneaplasminei,cheaguldefibrin~estelizat.Rezult~Ddimeri#iPDF.

Plasmina poate degrada #i fibrinogenul, gener]nd produ#i de degradare ai fibrino


genuluicaresunteviden[ia[iprintestededozarePDF.

Valorinormale:
Ddimeri<0,5g/ml
PDF<5g/ml.

Metodededeterminare:
latexaglutinare
ELISA(enzymelinkedimmunosorbentassays)
altemetode.

Semnifica[iaclinic~:
Ddimerii#iPDFprezint~importan[~`ndiagnosticulCID
Ddimerii au valoare diagnostic~ `n tromboza venoas~ profund~ #i trombolismul
pulmonar,IMA(infarctulmiocardicacut)
Ddimerii#iPDFpotfiutili`nmonitorizareaterapieitrombolitice.

Rezultatefalspozitivepotfidatedecre#tereafactoruluireumatoid(FR).
Ddimerii#iPDFpotcre#te`nbolihepatice,postoperator,lahemodializa[i.
Pacien[iicucancerpotprezentareac[iifalspozitivepentruDdimeri#iPDF.
Trombelastografia `nregistreaz~ modific~rile dinamice ale s]ngelui `n procesul
coagul~rii,subformauneicurbeac~reianaliz~permiteuneleconcluziiasupramecanismelor
hemostazei(BarbuR,1979).

157

TratatdeUrologie

IV.Doz~ribiochimiceserice/plasmatice

A. Explorarea activit~[ii func[ionale a rinichiului se poate realiza indirect prin deter


minarea unor parametrii umorali, `n men[inerea c~rora participarea rinichiului este
esen[ial~.

1.Ureea,ureeanitrogenseric~sauplasmatic~.

Generalit~[i:
Ureeaesteprodusulfinalalmetabolismuluiproteic,estesintetizat~`nficatpornind
delaamoniac#iseelimin~renalprinfiltrareglomerular~.
At]tureeac]t#iureeanitrogen(BUN=bloodureanitrogen)carereprezint~47%din
uree,potfidozate`nsersau`nplasm~prinmetodebiochimice.

Ureeanitrogensefolose#te`ncalcululosmolarit~[ii:
- Osmolaritatea=[Na++(mmol)EXx2]+BUN(mg/dl)/2,8+glicemia(mg/dl)/18.
- Normal:275295mOsm/Kg

Recoltare:
S]ngelepoatefirecoltat`ntubvidatsimplu,f~r~anticoagulant(acoperitcudopro#u)
sau`ntuburividatecuEDTA(dopmov)sauheparinatdelitiu(dopverde).
Serul,respectivplasmaseob[inprincentrifugare`ncondi[iistandard#iseparare.
Ureeaestestabil~`nser/plasm~ozilatemperaturacamerei,3zilela480C#i3lunila
200C.

Valorinormale,orientativ:
- pentruuree:2550mg/dl
- pentruureeanitrogen:823mg/dl.
Valorilenormalesestabilesclanivelulfiec~ruilaborator,`nfunc[iedeanalizorulde
biochimiefolosit#ireactivulcucarelucreaz~.

Metodededeterminare:

`ngeneral,sefolose#temetodaenzimatic~,cuureaz~caredescompuneureea`nCO2
#iNH3,urmat~deoreac[iecolorimetric~.

Metodealternative:

Cudiatilmonoxim~,cuhipobromitdesodiu,cusublimatetc.

Semnifica[ieclinic~:

Valoarea ureei depinde de: aportul proteic, de diurez~ #i de starea func[ional~ a


rinichiului.

Valoricrescute`n:
- insuficien[arenal~acut~#icronic~,de#iaresensibilitate#ispecificitatemairedus~
dec]t creatinina, evaluarea func[iei renale se face `n continuare folosind ambele
determin~ri:ureea#icreatininaseric~/plasmatic~
- insuficien[a cardiac~ congestiv~, boli infec[ioase acute, hemoragii gastrointestinale,
encefalite,diabetzaharat,boalaAddison,deshidratare,prinv~rs~turi,diareemasiv~
158

Capitolul4.Investiga[iidelaborator`nurologie

maladiifebrile,cetoacidoz~,catabolismproteiccrescut,tumori,iradieri,tratamentcu
citostatice
- tratamentecu:tetracicline,diuretice,corticosteroizi,medicamentenefrotoxice
- aportalimentarexcesivdeproteine.
Ureea prezint~ importan[~ pentru urm~rirea pacien[ilor hemodializa[i sau pentru
urm~rireaaltortratamente.

Valoricrescute`n:
- sarcin~
- insuficien[~hepatic~.

2.Creatininaseric~/plasmatic~

Generalit~[i:
Creatinina este un produs al catabolismului proteic muscular, este considerat~ un
indicatormaisensibil#imaispecificalfunc[ieirenale,valorilesalefiinddependentederata
deproducere#ideeliminare#i,practic,nefiindinfluen[at~deingestiadeproteine,aportul
lichidian sau diurez~. Reflect~ rata filtr~rii glomerulare renale. Formula este GFR=L/Crs.
GFR=rata filtr~rii glomerulare; L=`n~l[imea pacientului `n cm; Crs=creatinina seric~;
=constant~dependent~dev]rst~#isexextras~dintabele.

Recoltare:

S]ngelepoatefirecoltat`ntubvidatsimplu,f~r~anticoagulant(dopro#u)sautuburi
vidatecuheparin~(dopverde).

Serul,respectivplasmaseob[inprincentrifugare`ncondi[iistandard#iseparare.
Nupotfiprocesateprobelehemolizate.

Valori normale, orientativ: 0,61,2 mg/dl (pentru b~rba[i) #i 0,51,1 mg/dl (pentru
femei).
Valorilenormalesestabilesclanivelulfiec~ruilaborator,`nfunc[iedeanalizorulde
biochimiefolosit#ireactivulcucareselucreaz~.

Metode de determinare: Reac[ia Jaff (folose#te acid picric), metoda enzimatic~,


reac[iacuortonitrobenzaldehid~etc.`nreac[iaJaffoseriedeinterferen[epunprobleme
diagnostice.

Semnifica[ieclinic~

Valoricrescute`n:
- afec[iunirenale#iinsuficien[~renal~cusc~dereafiltr~riiglomerulare
- obstruc[iialetractuluiurinar
- sc~derea perfuziei renale `n insuficien[~ cardiac~ congestiv~, #oc, deshidratare
(v~rs~turi,diaree)
- pancreatit~acut~necrozant~
- hipertensiune,diabetzaharat,bolicardiovasculare,pacien[idepeste75deani.

Valorisc~zuteseobserv~la:
- persoanecumas~muscular~redus~`ntratamentedelung~durat~cucorticosteroizi,
bolimusculare,bolihepatice.
-

159

TratatdeUrologie

Cre#tereacreatininei`ncazulreduceriiperfuzieirenaleestemaipu[inprompt~caa
ureei.Nivelulcreatinineicre#teatuncic]ndcelpu[injum~tatedinnefroninufunc[ioneaz~.
Creatininaesteunindicatorsensibilalfunc[ieirenale.
Interferen[e cu determinarea creatininei produc unele medicamente printre care
cefalosporinele,metadona,cimetidina,guanina#ialimenteprecumcarnea,glucoza,fructo
za,acidulasorbicetc.

3.Raportulureenitrogen/creatinin~

Generalit~[i:

Raportul ureenitrogen/creatinin~ permite diferen[ierea `ntre insuficien[a de cauz~


prerenal~,renal~saupostrenal~(obstruc[ia)#iofer~indicii`nhemoragiadigestiv~.

Raportulestenormal`ninsuficien[adecauz~renal~.

Determin~rilesefac`nser#iraportulsecalculeaz~.

Valorinormale:1020.

Valoricrescutepeste20seob[in`ncazulproduc[ieicrescutedeuree#ialexcre[iei
sc~zute.
Exemple: azotemia prerenal~ (insuficien[a cardiac~ congestiv~, #oc hipovolemic,
hipotensiune,deshidratare).

Valori crescute ale raportului cu creatinin~ normal~ se `nt]lnesc `n catabolism


accentuat, `n hemoragii digestive, aport proteic alimentar mare, tratament cu tetracicline
sausteroizi.

Valori crescute ale raportului #i ale creatininei serice se `nt]lnesc `n obstruc[ii ale
tractuluiurinar#iazotemiiprerenale`nso[itedeafec[iunirenale.

Valori sc~zute ale raportului ureenitrogen/creatinin~ se pot `nt]lni la pacien[ii cu


regims~rac`nproteine,malnutri[ie,sarcin~,boliseveredeficat,hemodializa[i,cusecre[ie
inadecvat~dehormonantidiuretic.

4.Aciduluricseric

Generalit~[i:

Aciduluricesteprodusulfinal`nmetabolismulpurinelor#iseasociaz~cliniccuguta
#iinsuficien[arenal~.

Recoltare:

S]ngele se recolteaz~ exclusiv `n tub vidat simplu f~r~ anticoagulant (dop ro#u), iar
serul se ob[ine prin centrifugare `n condi[ii standard #i separare. Se evit~ consumul
b~uturiloralcoolice`naintederecoltare.

Aciduluricestestabil`nsertreizilela25oC,37zilela4oC#i612lunila20oC.

Valorinormale:orientativ3,77mg/dllab~rba[i,2,76mg/dllafemei.

Valorile normale se stabilesc la nivelul fiec~rui laborator `n func[ie de analizorul de


biochimiefolosit#ireactivulcucareselucreaz~.

Metode de determinare: spectrofotometrie sau HPLC (high performance liquid


chromatography).
160

Capitolul4.Investiga[iidelaborator`nurologie

Semnifica[iaclinic~:

`nmodnormal,uricemiavariaz~`nfunc[iedealimenta[ie,sex,v]rst~,factorigenetici,
diferitest~rifiziologice(efortfizic,menopauz~).

Valori crescute se `nt]lnesc `n gut~, insuficien[~ renal~ cronic~, leucemie, boli


infec[ioase,poliglobulie,procese`nso[itededegrad~ritisulare,precum#idup~radioterapie,
tratamente cu medicamente antimicotice #i antimetabolice, terapie cu ACTH sau hidro
cortizon;deasemenea`ntoxicozagravidic~#i`nintoxica[iilecuplumb#imercur.

Valorisc~zutealeuricemiesuntmen[ionate`nboalaWilson,dup~administrareade
medicamenteuricozurice,`nsindromulTonyDebrFanconi,`nafec[iunitubularerenale.

5.Ionogramaseric~/plasmatic~

Determinareaconcentra[ieiserice/plasmaticeaionilor(Na+,K+,Cl,bicarbona[i,Ca++,
Mg++) este foarte util~ `n prezen[a oric~rui tip de nefropatie, precum #i pentru aprecierea
func[iei rinichiului `n diferite ac[iuni sistemice (HTA, insuficien[~ cardiac~, insuficien[~
hepatic~,endocrinopatiidiverse,intoxica[iietc.).

a.Natriul

Generalit~[i:
- Reprezint~ principalul cation al lichidului extracelular; important `n men[inerea
echilibruluiosmotic;
- Aportul zilnic mediu: 510 g NaCl,nevoia zilnic~ 56 g,sursa principal~ o reprezint~
alimenta[ia,eliminareaseface`nceamaimarepartepecalerenal~(45g),dar#ipe
calefecal~#itranspira[ie.

Recoltare:
- S]ngele se recolteaz~ `n tub vidat f~r~ anticoagulant (dop ro#u) sau cu
heparinatdelitiu(dopverde),serulsauplasmaseob[inprincentrifugare`n
condi[iistandard#iseparare.

Valorinormale:
- 136145mmol/L,orientativ;valorilesestabilesc`nfiecarelaborator
Metodadedeterminare:ISE(folosindelectrozicuioniselectivi).

Semnifica[ieclinic~
Hipernatremiilese`nt]lnesc`nurm~toarelesitua[ii:
- Aportcrescut:intoxica[iicusare,perfuziicusolu[iisalinehipertone
- Eliminare sc~zut~: glomerulonefrite acute #i cronice, anurii de origine
tubular~;`nhiperfunc[iecorticosuprarenal~,tratamentACTH,corticosteroizi,
`nHTAmalign~
- Sc~dereaaportuluideap~
- Cre#terea elimin~rii apei prin pierderi cutanate #i pulmonare (transpira[ie,
arsuri,polipnee),prinpierderidigestive,diaree,v~rs~turi,fistuledigestivesau
prinpierderirenale(diabetinsipid,insuficien[~renal~,diurez~osmotic~);
Hiponatremiaseinstaleaz~dup~aportsalininsuficient,pierderidelichidebogate`n
sare (diaree, v~rs~turi, aspira[ii gastroduodenale, fistule digestive, arsuri, insuficien[~

161

TratatdeUrologie

corticosuprarenal~,nefrit~carepierdesareetc.);sechestrarealichidelorbogate`nsodiula
nivelulperitoneului,pleurei,ocluziaintestinal~,edemularsurilor.

b.Potasiul

Generalit~[i:
- Estecationulintracelularmajoritar.Importan[apotasiuluirezult~dinmultiplelesale
func[ii: rol plastic, rol `n schimburile la nivelul membranei, rol `n metabolismul
hidra[ilor de carbon, rol `n transmiterea influxului nervos #i `n excitabilitatea
neuromuscular~al~turideceilal[iioni;dependen[aestedat~derela[ia:

Na++K+
Ca+++Mg+++H+

- aportulzilnicdepotasiuestede34g,eliminareapotasiuluiesteaproximativaceea#i.

Recoltare:

S]ngeleserecolteaz~`ntubvidatf~r~anticoagulant(dopro#u)saucuheparinatde
litiu(dopverde);serulsauplasmaseob[inprincentrifugare`ncondi[iistandard#iseparare.
Serefuz~probahemolizat~.

Valori normale: 3,55 mmol/L, orientativ valorile normale se stabilesc `n fiecare


laborator.
Medodadedeterminare:ISE.

Semnifica[iaclinic~:

Urm~rirea potasemiei este util~ pentru v]rstnici, pacien[ii perfuza[i, trata[i cu


diuretice, sau pentru pacien[ii cu boli renale, `n special pentru cei hemodializa[i #i cu
insuficien[~renal~acut~.

Hiperpotasemiilepotap~rea:
- prinaportexcesiv(medicamentos)
- prin hiperproduc[ie endogen~ (distrugeri tisulare + arsuri, #oc, sindrom de
zdrobire)
- `nst~ritoxicoseptice(peritonite,ocluziiintestinale,com~diabetic~)
- prin reducerea elimin~rii (insuficien[~ renal~ acut~, insuficien[a cortico
suprarenal~acut~).

Hipopotasemiilepotaparea:
- prinaportinsuficientdeK
- prin pierdere pe cale renal~ (nefropatii tubulare, hiperaldosteronism, acidoze
diabetice,administr~riprelungitedediuretice)
- prinpierderepecaledigestiv~(v~rs~turi,diarei)
- prinhiperhidratareaaparatuluiextracelular,migrareaKincelule(perfuz~rimari
deglucoz~,com~diabetic~etc).
Deoarece valorile potasemiei nu reflect~ dec]t par[ial deficitul global de K+ din
organism, acestea se interpreteaz~ `n context clinic #i lu]nd `n considerare aspectul
electrocardiogramei(BarbuR,1979).
162

Capitolul4.Investiga[iidelaborator`nurologie

c.Calciulionic

Generalit~[i:
Este frac[iunea cu activitate fiziologic~ a calciului seric #i reprezint~ 40% din calciul
serictotal
- Intervine `n procese de excitabilitate muscular~, de permeabilitate celular~ #i
capilar~,`ncoagulare#ifibrinoliz~,`ntreos#imediulintercelularexist~schimburide
calciupermanente`nambelesensuri.

Recoltare:
S]ngeleserecolteaz~`n tub vidat cu heparin~ (dop verde) sau f~r~ anticoagulant
(dopro#u).Serulsauplasmaseob[inprincentrifugare`ncondi[iistandard#iseparare.
Probasep~streaz~`ncondi[iideanaerobioz~.
Poatefimen[inut~2zilela4oCsau2orelatemperaturacamerei.

Valorinormale,orientativ:
- 4,25,5mg/dlvalorilenormalesestabilesc`nfiecarelaborator.
Metodadedeterminare:ISE.

Semnifica[iaclinic~

Hipercalcemiilepotap~reaprin:
- mecanismendocrin(hiperparatiroidism)
- mecanismrenal:insuficien[~renal~cronic~
- administraremasiv~devitaminaDsaudihidrotahisterol
- eliberaredinos:mielommultiplu,tumoriosoase,imobilizareprelungit~.

Hipocalcemiileapar`n:
- rahitism
- nefropatiicroniceazotemice
- hipoparatiroidism
- deficitdevitaminaD.

Completarea explor~rii calciului se face prin determinarea activit~[ii parathor


monului, a fosfatazelor alcaline, a celorlal[i electroli[i (Mg++, Na+, K+), EKG, EEG, EMG
(electrocardiogram~,electroencefalogram~,electromiogram~)

d.Magneziul

Generalit~[i:
- Esteuncationimportant,la40%dinpacien[iihipopotasemiciseasociaz~hipomagne
ziemia.SepoatedeterminaMgtotalnormal#icelionic.

Recoltare:

S]ngele se recolteaz~ `n tub vidat simplu (dop ro#u), proba se centrifugheaz~ #i se


separ~serul.

Estestabilc]tevazilela26oC.

Nusepotprocesaserurilehemolizate.
-

163

TratatdeUrologie

Valorinormale:
orientativ:1,62,3mg/dl,Mgtotal;1,11,6mg/dlMgionic.
Metodededeterminare:spectrofotometrie,fluorometrie,metodeenzimaticeetc.

Semnifica[ieclinic~:

Determinarea magneziemiei este important~ `n urm~toarele situa[ii: infarct


miocardic, aritmii cardiace refractare la tratament, alcoolism, malnutri[ie, hipopotasemie,
hipocalcemiesauhiponatremierefractar~,terapiecudiuretice,tratamentenefrotoxicesau
citotoxice,iritabilitateneuromuscular~neexplicat~etc.

Deficitul global de Mg cu hipocalcemie #i aritmie cardiac~ poate fi `nso[it de valori


normalealeMgseric.

e.Fosforul

Generalit~[i:
- Prezint~ importan[~ pentru explorarea paratiroidelor, `n rahitism #i insuficien[a
renal~cronic~.

Recoltare:
S]ngele se recolteaz~ `n tub vidat simplu (dop ro#u), determinarea se face `n ser
imediatseparat.

Nusepotprocesaprobelehemolizate.

Valorinormale:
- 2,54,5mg/dl
Metodadedeterminare:fotometric~.

Semnifica[iaclinic:

Hiperfosfatemia se asociaz~ cu: efort fizic, deshidratare, hipoparatiroidism,


metastaze osoase, hipervitaminoza D, sarcoidoza, ciroza ortal~, insuficien[a renal~, diabet
zaharatcucetoacidoz~,embolismpulmonar,resuscitarecardiac~etc.
Hipofosfatemiaesteasociat~cu:hiperparatiroidism,cancercuhipercalcemie,admi
nistrarea diureticelor, a corticosteroizilor, deficitul de vitamina D, sepsis, dializ~, afec[iuni
renaletubulare,v~rs~turi,diaree,perfuziii.v.,etc.

f.Clorul

Generalit~[i:
- Clorulesteprincipalulanionalsectoruluiextracelular.

Recoltare:

S]ngelese recolteaz~ `n tub vidat simplu (tub ro#u) sau tub vidat cu heparin~(dop
verde).

Probafolosit~poatefiserul,plasmasaus]ngeletotal.

Valorinormale:
- 97107mmol/L.
Metodededeterminare:spectrofotometrie,SEetc.
-

164

Capitolul4.Investiga[iidelaborator`nurologie

Semnifica[ieclinic~:

Hipercloremiase`nt]lne#te`ndezechilibreacidobazice#ideshidrat~ricelulare.

Hipocloremiaseinstaleaz~dup~pierderidigestive(v~rs~turi,aspira[iietc.),pierderi
renale (insuficien[~ renal~ cronic~), secre[ie neadecvat~ de hormon antidiuretic, boal~
Addisonetc.

g.Bicarbonatul

Generalit~[i:
- Al~turi de clor, este anionul important pentru spa[iul extracelular, rolul lui `n
men[inereaechilibruluiacidobazicfiindmajor.

Recoltare:

S]ngele se recolteaz~ `n tub vidat simplu (dop ro#u), tub vidat cu heparin~ (dop
verde)sausering~heparinat~pentrugazesangvine.

Probafolosit~poatefiserul,plasmasaus]ngeletotal.

Valorinormale:2229mmol/L`ns]ngelevenos.

Metodededeterminare:

Se determin~ indirect prin calculi `n func[ie de pH #i pCO2 m~surate cu ajutorul


analizoruluidegazesangvine.

Altemetode:ISE,metodeenzimatice.

Semnifica[ia clinic~: valori crescute se `nt]lnesc `n alcaloza metabolic~, asociate cu


hipopotasemie, `n deshidratare dup~ v~rs~turi, diuretice sau cre#teri ale cortizolului #i
aldosteronului.

Valori sc~zute se asociaz~ cu acidoza metabolic~ (cetoacidoze), diaree, acidoz~


tubular~renal~.

`n cursul insuficien[ei renale se pot `nt]lni urm~toarele forme de tulbur~ri hidro


electrolitice:
- hiponatremia prin deple[ie (reabsob[ia deficitar~ a natriului `n cursul diurezei
osmotice, v~rs~turi, diarei, regim desodat), prin dilu[ie (reten[ie mai important~ de
ap~dec]tdesodiu)#iprinafectareacelular~ca`nacidoze
- hiperpotasemia, mai frecvent~ `n insuficien[a renal~ acut~, consecin[~ a hiper
catabolismului,adistrugerilortisulare,incapacit~[iideeliminareapotasiuluipecale
urinar~(oligoanurie)
- hipocalcemiaasociat~cuhiperfosfatemie#ihipermagneziemie#ideregl~risecundare
alefunc[ieiglandeiparatiroide
- clorul poate avea valori sc~zute `n situa[iile descrise la hiponatremie, `n alcaloze
metabolice cu hipopotasemie, `n acidoza metabolic~ renal~ predominant
glomerular~sauvaloricrescute`nacidozametabolic~renal~predominanttubular~.
Acidozarenal~`nso[e#te,`ngeneral,nefropatiiletubularecronice`ncareseconstat~
o hipercloremie, sc~derea nivelului bicarbona[ilor plasmatici #i a pH plasmatic (Barbu R,
1979).

165

TratatdeUrologie

6.Proteineleplasmaticepotoferi,deasemenea,oseriededateutile`ncazulunei
nefropatii.Sedetermin~proteineletotale,albuminele,globulinele,frac[iunileelectro
foreticesauimunoelectroforetice.

Valorinormale:
- proteinetotale6,58,3g/dl
- albumin~5560%
- 1globuline34%
- 2globuline911%
- betaglobuline1214%
- gamaglobuline1518%
- raportalbumineglobuline1,21,5.

`nsindromulnefroticseasociaz~:
- hipoalbuminemia,hiper2#iglobulinemia.
`nglomerulonefritelecronicecresc2#iglobulinele.

`npielonefritecronicese`nt]lneschipergamaglobulinemii.

7.Lipidele,`nspecialcolesterolul,prezint~interes`nsindromulnefrotic(valoripeste
300mg/dl),dar#ifosfolipidele#iaciziigra#iliberi(inconstant)(BarbuR,1979).

Valorinormale:
- lipidetotale
400700mg/dlpentrufemei
500800mg/dlpentrub~rba[i
- fosfolipide:210270mg/dl.

8.Enzimesericecusemnifica[iedeosebit~`nurologie

a.Fosfatazaacid~total~/prostatic~

Generalit~[i:

Enzimaseg~se#te`nprostat~,os,ficat,splin~,rinichi,eritrocite,leucocite,trombo
cite#iglandeendocrine.

Recoltare:

S]ngeleserecolteaz~`ntubvidatsimplu(dopro#u)saucuEDTA(dopmov).

Probafolosit~poatefiserulsauplasma,testulsevafacelascurttimpdup~recoltare.

Serurilelipemice#icubilirubin~peste2mg/dlseevit~.

Recoltareaprobeiseface`naintecapacientuluis~isefiefectuattu#eurectal,masaj
prostatic,biopsieprostatic~#.a.

Valorinormale:
- orientativ fosfataza acid~ total~ (metoda enzimatic~ de determinare): 212
unit/llab~rba[i;0,39,2unit/llafemei
- fostfatazaacid~prostatic~0,23,5unit/llab~rba[i;00,8unit/llafemei

166

Capitolul4.Investiga[iidelaborator`nurologie

Semnifica[ieclinic~:
Fosfataza acid~ total~/prostatic~ cre#te `n afec[iuni ale prostatei, carcinom, hiper
plaziebenign~,prostatit~.
Fosfatazaacid~cre#te`ncazuldistrugeriitrombocitelor`ntromboze,emboliipulmo
nare,trombastenii.
Valoarea ei diagnostic~ se refer~ la cancerul de prostat~ #i metastazele osoase ale
acestuia,alecarcinoamelorcolonului,mamar,corticosuprarenal#ipulmonar.
Dozareaantigenuluiprostaticspecific(PSA)estemai specific~#i maisensibil~ dec]t
fosfataza acid~ total~/prostatic~ `n urm~rirea evolu[iei clinice #i a tratamentului carcino
muluideprostat~.

b.Fosfatazaalcalin~seric~

Generalit~[i:

Fosfataza alcalin~ seric~ se g~se#te sub forma a cel pu[in trei izoenzime: hepato
biliar~,osoas~#iintestinal~,iar`ntimpulsarciniiseadaug~ceaplacentar~.

Recoltare:

S]ngeleserecolteaz~`ntubvidatsimplu(dopro#u),probafolosit~esteserul.Testul
seface`nziuarecolt~rii,probanusepoatep~stramaimultdepatruore,activitateaenzimei
cresc]nd`ntimp.

Valorinormale:
- orientativ:50120unit/l
Metodededeterminare:endpoint,cinetic~spectrofotometric~#.a.

Semnifica[ieclinic~:
Fosfataza alcalin~ osoas~ are valori ridicate `n cursul cre#terii, `n rahitism, hiper
paratiroidism,metastazeosoasealecarcinomuluideprostat~#imamar,osteosarcoame.
Valori crescute ale fosfatazei alcaline serice sunt utile `n diagnosticul diferen[ial al
afec[iunilorhepatobiliare.
Forma intestinal~ cre#te `n cirozele hepatice, `n ulcer duodenal #i `n excesul de
gr~simialimentare.
Formeleatipicese`nt]lnesc`nhepatoame.

V.Testeimunologiceserice(markeritumorali,hormoni)

1.Alfafetoproteina(AFP)

Generalit~[i:

AFPeste proteindominant~`nserulfetal,important~,deasemeneaca#iproteina
carcinoembrionar~.

Dinpunctdevederefizicochimicesteasem~n~toarealbuminei.

Recoltare:

S]ngele se recolteaz~ `n tub vidat simplu, f~r~ anticoagulant (dop ro#u), deter
minarearealiz]nduse`nserulproasp~tsaurefrigerat.

167

TratatdeUrologie

Valorinormale:
Orientativ,sub15ng/ml.
Metodededeterminare:
- imunoenzimatic~(EIA)
- imunofluorescen[~
- imunochemiluminiscen[~
- radioimunoanaliz~(RIA).

Semnifica[ieclinic~:

AFP se folose#te `n screeningul prenatal, `n diagnosticul #i monitorizarea


carcinomuluihepatocelular.

AFPesteutil~`ndiagnosticul#iurm~rireatumorilortesticulare(MoraruI,1980).

Astfel,AFP`nasocierecuhCG(hormonulgonadotropcorionic)potfacediagnosticul
diferen[ial`ncazultumorilorgerminaletesticulare.

`nseminoameAFPestenormal~,hCGpoateficrescut`ncazultumorilorcuelemente
trofoblastice.

`ncarcinoameleembrionareat]tAFPc]t#ihCGauvaloricrescute.

`ncoriocarcinoameAFPestenormal~,iarhCGcrescut.

`ntumorialesaculuiYolk(tumorialesinusuluiendodermal)AFPestecrescut~#ihCG
normal.

2.hCG(gonadotropinacorionic~uman~)

Generalit~[i:

hCGestesintetizat~lanivelulcelulelorsinci[iotrofoblastice.

Toatetesteledesarcin~sebazeaz~pedeterminareahCG.

hCGestemarkerpentruneoplaziiletrofoblasticegesta[ionale(GTN),pentrutumorile
testicularecucelulegerminalenonseminomatoase#imaipu[inpentruseminoame.

Recoltare:

S]ngeleserecolteaz~`ntubvidatsimplu(dopro#u)f~r~anticoagulant,determinarea
realiz]nduse`nser.Serulpoatefip~strat24deorela25oC,4zilela4oC,iarla20oCpentruo
perioad~mailung~.

Valorinormale:

Orientativsub5mUI/ml,depindedeaplica[ie#imetodafolosit~.

Metodededeterminare:

Metode imunologice `n diverse formule (EIA, MEIA, imunochemiluminiscen[~, RIA,


etc).

Semnifica[iaclinic~:

Principalaaplica[ieestediagnosticul#iurm~rireasarcinii.

`nasocierecuAFP,hCGesteutil`ndiagnosticul#iurm~rireatumorilortesticularecu
celule germinale respectiv carcinomul embrionar #i coriocarcinomul. Are valori crescute `n
circa10%dinseminoame.

168

Capitolul4.Investiga[iidelaborator`nurologie

3.Antigenulprostaticspecificseric(PSA)

Generalit~[i:

PSAesteunvalorosmarkerpentruadenocarcinomuldeprostat~.Poates~aib~valori
crescute `n entit~[i benigne #i poate avea valori normale la pacien[i cu adenocarcinom al
prostatei.

Este util `n urm~rirea evolu[iei adenocarcinomului aflat sub tratament hormonal


#i/saubrahiterapie.

NivelulPSApoates~fiecrescut`n:prostatite,cateterizareuretrovezical~,examinare
rectal a prostatei, recoltarea probelor bioptice pentru histopatologie, chirurgia prostatei,
cistoscopieetc.

Este util~ monitorizarea PSA at]t `naintea interven[iei chirurgicale, c]t #i dup~
opera[ie.

Se urm~resc: nivelul PSA, densitatea PSA (raport PSA/volumul total al prostatei


ng/ml/cm3), raportul dintre PSA total #i liber #i viteza (velocity) de cre#tere a PSA `ntro
perioad~detimp(lun~,an).

Recoltare

S]ngeleserecolteaz~`ntubvidatsimplu,f~r~anticoagulant(tubro#u),determinarea
realiz]nduse`nserulproasp~tsaurefrigerat48deore.

Recoltarea se face dup~ 4 s~pt~m]ni de la tu#eul rectal sau recoltarea probei


bioptice.Ejaculareapoatedeterminacre#tereaminor~#itranzitorieaPSA.

Valorinormale:

Se stabilesc la nivelul fiec~rui laborator, `n func[ie de reactivul, instrumentul #i


metodafolosit~.

`n general, valorile normale la b~rba[i sunt sub 4 ng/ml pentru PSA total. Limitele
normaluluicresccuv]rsta(4,5ng/mlpentrub~rba[ide6069ani#i6,5ng/mlpentrub~rba[i
depeste70ani).

Pentrumajoritateatestelor,sensibilitateaeste`ntre7384%,specificitatea5993%.

Valorinormale,orientativ,pentruPSAliber:sub0,934ng/ml.

Metodededeterminare:
- imonuenzimatice
- radioimunoanaliz~
- chemiluminiscen[~
- imunofluorometrieetc.

Semnifica[iaclinic~:

PSA este o protein~ specific~ celulelor epiteliului prostatic. Este prezent `n lichidul
seminal`nconcentra[iimari.

NivelulPSAsericsecoreleaz~imperfectcugraduldeextensieatumorii.

Densitatea PSA ob[inut~ raport]nd PSA seric la volumul prostate m~surat prin
ultrasonografie transrectal~ poate fi un indiciu util pentru alegerea conduitei terapeutice.
Datelesecoroboreaz~cuceleob[inutelaexamenulhistopatologic.

PSAesteutilpentruurm~rireaboliireziduale#iaevolu[ieipostoperatorii`ncancerul
prostatei,aapari[ieimetastazelor.

169

TratatdeUrologie

Esteunbunmarkerpentruscreening.

Urm~rireavitezeidecre#tereaPSA`ntrunanpermiteeviden[iereaprecoceaunui
adenocarcinom(cre#tereacu3ng/ml/andeexemplu)prostatic.

Se recomand~ folosirea aceleia#i metode pentru determinarea PSA total #i liber `n


dinamic~.

Determinarea PSA liber este util~ la pacien[i cu PSA `ntre 410 ng/ml sau la cei cu
volumm~ritalprostateilaexamenulultrasonografic.

ValorimicialePSAliber#ialeraportuluidintrePSAliber#iPSAtotalse`nt]lnesc`n
afec[iunibenigne(prostatite,deexemplu).

4.Eritropoietina

Generalit~[i:

Esteoglicoprotein~produs~derinichi,hormoncareregleaz~produc[iaeritrocitelor
lanivelulm~duveiosoase.

Recoltare:

S]ngele se recolteaz~ `n tub vidat simplu, f~r~ anticoagulant (dop ro#u), determi
narearealiz]nduse`nserulproasp~tsaurefrigerat.

Pu[inelaboratoaredetermin~niveluleritropoietinei.

Valorinormale:orientativ536mUI/ml.

Semnifica[iaclinic~:

Testulestefolositpentruinvestigareaanemieidininsuficien[arenal~.

Pacien[iicudeficitdeeritropoietin~potbeneficiadetratamentdesubstitu[ie(Iacobs
DS,2004).

5.Determin~rihormonaleutile`nurologie

Investigarea glandelor endocrine paratiroide, a glandelor suprarenale #i testiculului


suntutile`nurologie,datorit~rela[ieiexistente`ntrepatologiaendocrin~#iceaurologic~.
a. Hormonulparatiroidian(PTH)sedetermin~lapacien[icuhipercalcemie#ilitiaz~
urinar~.
b. Reninapoateaveanivelcrescut`nhipertensiunearenovascular~.
c. Hormonii steroizi: aldosteronul, cortizolul, adrenalina, noradrenalina trebuie
doza[ilapacien[iicutumorisuprarenale.
d. FSH se dozeaz~ la pacien[i cu azoospermie pentru a eviden[ia cauza (valori
crescute `n insuficien[~ testicular~, valori normale `n obstruc[ii) (Sakam MA,
2002).

VI.Analizaurinei

Examinareaurineiesteunadincelemaivechiinvestiga[ii`npracticamedical~util~,
pentru excluderea unor entit~[i patologice sau pentru precizarea unor elemente de
diagnosticdiferen[ial.Neg]ndimc~ceidinvechimeerau`nstares~diagnostichezediabetul
zaharat numai gust]nd urina!?... Din fericire, ast~zi avem la `ndem]n~ alte metode de
diagnosticdelaborator.Estefundamental~pentruoricepacienturologic.
170

Capitolul4.Investiga[iidelaborator`nurologie

Recoltarea probei de urin~ destinat~ examenului sumar de urin~ #i uroculturii se


face,at]tlafemeic]t#ilab~rba[i,dup~atentatoalet~ameatuluiuretral,dinjetulmijlociu.
Urina se recolteaz~ `n vase de plastic speciale, sterile pentru urocultur~. Se prefer~
recoltareadinprimaemisiematinal~,probasetransport~lalaboratorc]tmaicur]ndposibil
#iseexamineaz~urinaproasp~temis~(maxim2ore)latemperaturacamerei.
Dac~ nu este posibil~ examinarea urinei proasp~t emise aceasta va fi refrigerat~ la
o
5 C; se vor p~stra astfel elementele prezente `n urin~, dar pot precipita sub form~ de
cristales~ruricelecareerausolubile`nurin~laemisie.

Examenulsumardeurin~

1.Examenulmacroscopic(WalshCP,1999)
a. Aspectul
Urinanormal~este,`nmomentulemisiei,limpede#itransparent~.
La temperaturi joase urina normal~ se tulbur~. Apare un depozit format din s~ruri
precipitate(carbona[i,fosfa[i,ura[i#ioxala[i)careseredizolv~la`nc~lziresaunubecula,un
norfin,tulbure,ceaparelafemei,fiindformatdinceluleepitelialededescuamarealec~ilor
urinare#ivaginului.
Urina este tulbure la emisie atunci c]nd con[ine un exces de s~ruri precipitate sau
celule(epiteliale,hematii,leucociteintactesaudegradate,bacteriietc.).
b. Culoarea normal~ are nuan[~ de galben, de la galben deschis, p]n~ la galben
portocaliudatorit~pigmen[ilorurinari.

Urina hipercrom~, ro#iatic~, apare la pacien[i care inger~ pu[ine lichide, la cei cu
pierderilichidieneexcesive,`nhemoglobinurii,mioglobinurii,hematuriedup~administrarea
desubstan[ecunucleupirazolonic,furazolidon,nitrofurantoin,rifampicin~etc.Aciduluric#i
ura[ii`nexcesproducourin~tulbure,ro#ie,c~r~miziecareselimpeze#teprin`nc~lzire.

`n ictere, urina poate fi cafeniu verzuie, urina cafenie brun~ este consecin[a mela
nurieidinmelanosarcoame,iar`nalcaptonurieurinaestebrunneagr~.

Dup~administrareaalbastruluidemetilenurinadevinealbastr~verzuie.

Urina poate fi decolorat~ datorit~ elimin~rii excesive de ap~ (ingestie exagerat~ de


lichide,diabetinsipid,diabetinsipidnefrogen,fazapoliuric~ainsuficien[eirenale,nefropatii
tubularecupierderideap~.

Urinamat~cuaspectdezeam~devarz~estecaracteristic~infec[iilorurinare.

Urinalactescent~apare`nchilurie,urinastr~lucitoare,gras~,apare`nlipidurie.
c. Mirosulnormalalurineiestefad,unmirosdiscretcaracteristic.
Mirosul de aceton~ poate ap~rea `n diabetul zaharat decompensat, `n inani[ie,
mirosulfetid`ninfec[iiurinaregrave,maialesanaerobe.
Mirosulurineipoatefimodificatdealimente(hrean,usturoi,sparanghel)saumedi
camente.

2.Examenulfizic#ichimicalurinei(WalshCP,1999)
a. Densitatea urinar~ este normal~ `ntre 1015 #i 1025, cu limite extreme 10051030.
Valoarea densit~[ii depinde de diurez~, de alimenta[ie, de volumul lichidelor
ingerate.
Glicozuria #i proteinuria, eliminarea dextranului sau a substan[elor de contrast
administratedetermin~cre#tereadensit~[iiurinare.
b. Reac[iaurinei(pH)

171

TratatdeUrologie

`nmodnormal,pHulurineise`ncadreaz~`nintervalul5,87,4.
pHul acid se `nt]lne#te la persoanele cu regim carnat, dup~ efort, la diabetici, `n
gut~,lapacien[iiculitiaz~renal~(aciduric,cistin~).
pHulalcalinpoateficonsecin[aunuiregimalimentarvegetariansaualuneiinfec[ii
urinarecubacteriicareproducureaza(proteus).Ourin~constantalcalin~culitiaz~fosfatic~
recidivant~este`nt]lnit~adesea`nacidozatubular~.
DeterminareapHuluiurinaresteunindicatoralcapacit~[iideacidifierearinichiului.
c. Proteineleurinaresunt,`nmodnormal,nedozabile(80150mg/zi).
Cre#terealortranzitoriese`nt]lne#te`n:efort,expunerelafrig,febr~,dup~palparea
rinichiului,stres,ortostatismprelungit,lagravide.
Cresc patologic `n leziuni de parenchim renal, afec[iuni ale c~ilor renale, afec[iuni
extrarenale(tulbur~ricirculatorii,infec[ii,intoxica[ii,boalalupic~,mielommultiplu).
d. Glucozaeste,normal,nedecelabil~`nurin~.
Esteprezent~`nhiperglicemiadindiabetulzaharatsaudiabetulrenal.
e. Corpiicetonicinormalsuntabsen[i(acidacetoacetic,aceton~,acid)
`n st~rile de cetoacidoz~ din diabetul zaharat decompensat, din inani[ie, boli
infec[ioasegrave,narcoza,v~rs~turi,diaree,corpiicetonicipotfiprezen[i.
f. Pigmen[iibiliari:bilirubina#iurobilinogenul.
Urina normal~ nu con[ine bilirubin~ #i con[ine cantit~[i foarte mici de urobilinogen
(14mg/zi).
Bilirubina direct~ conjugat~ este solubil~ `n ap~, are greutate molecular~ mic~ #i
poateap~rea`nurin~`ncondi[iipatologice:icteremecanice#iparenchimatoase.
Bilirubina indirect~ are greutate molecular~ mare, este prezent~ `n ser legat~ de
albumin~,esteinsolubil~`nap~#inuapare`nurin~nici`ncondi[iipatologice.
Urobilinogenul este produsul final al metabolismului bilirubinei conjugate. Icterele
parenchimatoasedetermin~cre#tereaurobilinogenuluiurinar.
g. Acidulascorbicesteprezent`nurin~lapersoanelecarefactratamentcuVitaminaC.
Poate cauza reac[ii fals pozitive, hemoglobin~, determinate cu ajutorul stripului
urinar.
h. Nitritul prezent `n urin~ este sugestiv pentru multiplicarea bacterian~, iar esteraza
leucocitar~indic~prezen[aleucocitelor`nurin~.
i. Hemoglobinaesteprezent~`nurin~`nhemolizetoxice,procesesepticeetc.
Metodelefolosite`nanalizafizicochimic~aurineisunt:
- metodarapid~astripuluiurinarpermitescreeningul`nmaipu[inde2minutepentruo
seriedeparametri fizicochimiciurinari.Reac[iilepozitive ob[inute trebuieconfirmate
cutestemaiprecise
- metodedebiochimieclasic~(pentruglicozurie,proteinurieetc.)
- pHmetrie
- urodensimetrie.

3.Examenulsedimentuluiurinar
Recoltareacorect~,transportulimediatlalaboratoralprobei#iprocesareaeiadec
vat~suntetapenecesarepentruunexamendecalitatealsedimentuluiurinar.
Preparatulexaminatlamicroscopseob[ineprincentrifugareaa10mlurin~la2000
rpm(rota[iipeminut)timpde10minute#idecantareasupernatantului.
Suspensia ob[inut~ se examineaz~ la microscopul optic ca preparat proasp~t, `ntre
lam~#ilamel~,cuobiectivde40x.
172

Capitolul4.Investiga[iidelaborator`nurologie

Studiulsedimentuluiurinarfacepartedinexamenelederutin~`npracticaclinic~#i
permite ob[inerea de informa[ii utile pentru stabilirea diagnosticului, prognosticului #i
supraveghereaevolu[iei,at]t`ncazuluneinefropatii,c]t#i`nanumiteafec[iuniextrarenale.
Examinarea sedimentului urinar este o etap~ obligatorie `n investigarea oric~rei
nefropatii,darunsedimenturinarnormalnuinfirm~osuferin[~renal~(P~unR,1987).
`n sedimentul urinar `n examenul calitativ se pot eviden[ia: celule epiteliale, leuco
cite, hematii, cilindri, cristale, germeni, parazi[i. Prezen[a acestora poate modifica sau nu
aspectulmacroscopicalurinei.

a. Elementeleorganice([i[eicaM,1984):
Celuleleepitelialeprovindinepiteliultractuluiurinar:
- celulele epiteliale plate (fig.1,2,3) sunt mari, poligonale sau rotunde, izolate sau
grupate`nplacarde,cuunulsaumaimul[inucleivolumino#i.Provindinstraturile
superficialealeveziciiurinare#idinvagin
- celuleleepitelialecilindriceapar[inc~ilorureterale
- celulelecaudate(fig.4)prezint~oprelungirecitoplasmatic~`nform~derachet~
#i un nucleu voluminos. Provin din straturile profunde ale vezicii urinare #i din
bazinet,undepotfi`nt]lnite#icelulerotundecunucleuvoluminos
- celuleleepitelialerenale(fig.5)apar[intubilorrenali#ic~ilorurinaresuperioare.
Sunt rotunde sau poligonale, ceva mai mari dec]t leucocitele, au nucleu mare,
veziculos #i citoplasm~ granular~. Sunt elemente celulare patologice, indic~ o
leziunerenal~grav~#iapar`ntotdeauna`mpreun~cucilindriihialinogranulo#i.
Leucocitele(fig.6)suntrare`nurinanormal~.Num~rullorcre#te`ninflama[ii,infec[ii
urinare,uneoripotfidegradate(piocite).
Eritrocite (fig.7) apar `n urin~ ca mici discuri g~lbui cu dublu contur la mi#carea
microvizeimicroscopului.
`n urina normal~ se pot `nt]lni `n sediment foarte rare eritrocite; prezen[a lor `n
num~r crescut (hematuria) este anormal~. Hematuria poate `nso[i boli renale, ale
c~ilor urinare, sau boli generale, precum sindroame hemoragice, boli autoimune,
tulbur~ri circulatorii. Remarc~m importan[a urm~ririi hematuriei microscopice la
pacien[iicutumorivezicale.
Eritrocitele decolorate din sediment caracterizeaz~ bolile renale, cele bine colorate
apar[inc~ilorurinare.

173

TratatdeUrologie

Fig.1,Fig.2,Fig.3celuleepitelialeplate;
Fig.4celulecaudate;
Fig.5celuleepitelialerenale;Fig.6leucocite;
Fig.7eritrocite(DaiberA,1896).

Cilindrii sunt forma[iuni alungite, cilindrice, bine conturate, cu capete rotunjite sau
t~iate drept, mulaje ale tubilor uriniferi forma[i prin coagularea substan[elor albumi
noide sau mucoase secretate la nivelul tubilor renali cu diferite grade de alterare
epitelial~.Suntelementepatognomonicepentruleziunirenale.
174

Capitolul4.Investiga[iidelaborator`nurologie

Cilindriihialini(fig.8)sunttransparen[i,palizi,cuextremitatea`nform~dem~nu#i,au
structur~fin~.Apar`nalbuminuriifiziologice(staz~,ortostatism,efort)sau`ncontext
patologicrenal.
Cilindrii granulo#i (fig.9), bine delimita[i, acoperi[i cu granula[ii inegale, apar `n dege
nerescen[agr~soas~acelulelorepiteliuluirenal.
Cilindrii hematici (fig.10) sunt aglomer~ri de eritrocite sub form~ cilindric~ #i apar `n
sindroameglomerulare#ihematuriirenale.
Cilindriileucocitariapar`npielonefrite.
Maipu[infrecventse`nt]lnesc:
x Cilindrii mic#ti hialinoleucocitari (fig.12), hialinoeritrocitari, hialinogranulo#i,
eritroleucocitari
x Cilindriiepiteliali(fig.13)rezult~dindescuamareacelulelorrenale`ncadrulunui
procesdemaregravitate
x Cilindrii cero#i galbeni (fig.14), cu aspect amorf grosolan, fragili, se g~sesc `n
sindromulnefrotic,tr~d]ndostaregrav~
x Cilindriigr~so#iaugranula[iigr~soase#irezult~dindegenerareagras~acelulelor
epiteliuluirenal`nnefropatiicronice#isubacute.

175

TratatdeUrologie

Fig.8cilindriihialini;Fig.9cilindriigranulo#i;Fig.10cilindriihematici;
Fig.11cilindriileucocitari;Fig.12cilindriihialinoleucocitari;
Fig.13Cilindriiepiteliali;Fig.14cilindriicero#i;Fig.15cilindroizi(DaiberA,1896).

Cilindriitrebuiediferen[ia[ide:
pseudocilindri,aglomeratedediversesubstan[eanorganice(ura[i,fosfa[i)sauorganice,
gr~mezidegermeni
cilindroizi(fig.15),constitui[idinmucin~.
Floramicrobian~prezent~`nsediment`ninfec[iiurinare;
Parazi[isepotg~si:trichomonasvaginalis,oxiurietc.
Celulele neoplazice (fig.16) necesit~ o examinare mai atent~ intrun sediment
colorat;
Alteelementeorganice:
Filamentedemucusseg~sesc`nurinanormal~sau`ninflam[iialec~ilorurinare;
Spermatozoizii(fig.17)
Levuri
Pic~turidegr~simeseg~sesc`nsindroamenefrotice
Corpusculidelecitin~rotunzi,forma[idinstraturiconcentricese`nt]lnesc`nafec[iuni
aleprostatei.
176

Capitolul4.Investiga[iidelaborator`nurologie

Fig.16celuleneoplazice;Fig.17spermatozoizi(DaiberA,1896).

b. Elementele anorganice sunt s~ruri prezente `n compozi[ia urinei normale care


precipit~ `n oligurii sau modific~ri ale pHului sub form~ cristalin~ sau amorf~.
Identificarealoresteimportant~`nlitiazaurinar~([i[eicaM,1984).

`nurinaacid~sepotg~si:ura[i,aciduric,oxalatdecalciu#.a.

`nurinaalcalin~`nt]lnimfosfa[i,carbonatdecalciu#.a.
Uratulaciddesodiu(fig.18)aparesubform~degranula[iig~lbuicamaterialamorf.
`n cantitate mare depozitul macroscopic este roz; se dizolv~ la c~ldur~ sau la
ad~ugareahidroxiduluidesodiu.
Acidul uric (fig.19) se prezint~ sub form~ de cristale galbene polimorfe (rombice,
p~trate,cubice,haltere,rozete)inegale;sedizolv~`nhidroxiddesodiu.
Oxalatuldecalciu(fig.20)aparesubformacristalelorincoloremicisausubform~de
plic,pi#cot.
Fosfatulaciddecalciuseprezin~subform~decristaleincoloresauprismeturtite#i
alungite.
Sulfatul acid de calciu cristale incolore, aciforme, grupate `n rozet~; apar `n urina
acid~.
Fosfatulamoniacomagnezian(fig.21)precipit~subform~deprism~incolor~asem~
n~toareunuicapacdeco#ciug.
Fosfatulbicalcic(fig.22)seprezint~subform~decristaleaciforme,dispuse`ncruce
sau`nstea.
Fosfatultricalcicalbcenu#iuprecipit~subform~amorf~.
Fosfatulbazicdemagneziuaparesubform~decristalerombiceu#orrefringente.
Carbonatuldecalciu(fig.23):cristalegranularesauamorfe,albicioasecenu#ii.
Uratul de amoniu (fig.24): cristale sferice cu prelungiri aciculare; se dizolv~ `n acid
clorhidric.
Patologicpotap~reacristaledeleucin~,tirozin~,colesterol,bilirubin~saucristalede
medicamente(sulfamide):
- Leucina(fig.25):cristalegalbenbrune,sferice,custri[iiconcentrice
- Tirozina(fig.26):cristaleacefine,g~lbui;se`nt]lnescal~turidecristaleledeleucin~`n
afec[iunidegenerative
- Cisteina(fig.27):cristalesubform~detabletehexagonale,incolore;indic~tulbur~ride
metabolismproteic
177

TratatdeUrologie

Colesterolul (fig.28): cristale sub form~ de [~nd~ri de sticl~; se int]lnesc `n sindromul


nefrotic
Bilirubina(fig.29):aparecaacero#iibrune
sulfamidelesuntcristalepoliformecaresedizolv~`naceton~.

178

Capitolul4.Investiga[iidelaborator`nurologie

Fig.18uratdeNa,K;Fig.19aciduric;Fig.20oxalatdecalciu;
Fig.21fosfatamoniacomagnezian;Fig.22fosfatbicalcic;
Fig.23carbonatdecalciu;Fig.24uratdeamoniu;Fig.25leucina;
Fig.26tirozina;Fig.27cisteina;Fig.28colesterol;Fig.29bilirubina(DaiberA,1896).

179

TratatdeUrologie

c. Determinareacantitativ~aleucocitelor,eritrocitelor#icilindrilor
ProbaAddisHamburger.
Tehnica: pacientul urineaz~ dup~ trei ore de la prima mic[iune, m~soar~ volumul
pentrucalcululdebituluiurinar,iar`nlaboratorsenum~r~leucocitele,hematiile#icilindrii
caresevorraportaladebituldeurin~peminut.
Normalseelimin~:
- maxim1000hematii/minut
- maxim2000leucocite/minut
- 13cilindri/minut.

4.Doz~ribiochimice`nurinade24ore(P~unR,1987)
Diurezanormal~estede8002.500ml/24ore,respectiv25ml/kgcorp.
a. Proteinuriasepoateclasificaastfel:
- normal~:sub50mg/24ore
- minim~:sub150mg/24ore
- mic~:150500mg/24ore
- medie:0,51,5g/24ore
- mare:1,53g/24ore
- masiv~:peste3g/24ore.

Fiziologicoproteinurieminim~poateap~readup~ortostatismprelungit,efortfizic,
postprandial,lapersoanefebrile.

Patologic,proteinuriapoatefidetip:
- tubular
- glomerular
- monoclonal.
Diferen[ierea acestor tipuri de proteinurie se face cu ajutorul electroforezei
proteinelor urinare #i prin eviden[ierea proteinelor BenceJones (proteine anormale care
migreaz~ `n pozi[ia beta sau gama #i sunt constituite, de obicei, din lan[uri u#oare de
imunoglobulinelambdasaukappa).
Proteinuria poate `nso[i, de asemenea, pielitele, uretritele, neoplasmele urinare,
litiazarenal~,vezical~etc.
b. Glicozuriaapare,`ngeneral,lavalorialeglicemieidepeste170mg/dl.
c. Ureeanitrogenurinar~,normaleste617g/zi(HenryJB,1996).
d. Creatininaurinar~:normallab~rba[ieste12g/zi,lafemeieste0,81,8g/zi.
e. Clorurileurinare,normal140250mEg/zi.

Ureea, creatinina #i clorurile urinare sunt indicatori ai calit~[ii func[iei renale; `n


disfunc[iicompensareasefaceprinpoliurie.

5.Testedeeliminarecomparat~probedeclearance

Clearanceul unei substan[e reprezint~ volumul de plasm~ pe care rinichiul `l


epureaz~`nunitateadetimp(minut)deaceeasubstan[~.

Formulaeste:

UxV
C=
P

`ncare:
C=clearanceul
180

Capitolul4.Investiga[iidelaborator`nurologie

U=concentra[iaurinar~asubstan[ei
V=volumulurinei
P=concentra[iaplasmatic~asubstan[ei.

a. Clearanceulcreatinineim~soar~filtratulglomerular.
Valorilenormalesunt:
pentrub~rba[i85125ml/min/1,73m2
pentrufemei75115ml/min/1,73m2.
b. Clearanceulaciduluiparaaminohipuricm~soar~fluxulplasmaticrenal.
Valorilenormalesunt:
654165ml/minlab~rbat
594153ml/minlafemei.

6.Testeurinareutile`ndiagnosticultumorilorvezicale
(PricopC,2005;LokeshwarVB,2005)
a. Citologiaurinar~spontan~#iexfoliativ~(recoltareprinlavaj)

Pentruexamenulcitologicceluleleseob[indinurinaeliminat~spontan(nudinprima
mic[iunematinal~)`ntimpuluneicistoscopiisaupecateteruretrovezical(prinlavaj).

Metoda se bazeaz~ pe eviden[ierea direct~, pe frotiu fixat #i colorat, a celulelor


maligneexfoliate.

Pefrotiusepotg~sicelulesuperficialemari,unisaumultinucleate,celuleinterme
diare,celulebazalesauceluledinprostat~saudinuretr~.

Citologiaurinar~exfoliativ~esteutil~:
- pentrudiagnosticulcancerelordec]mpurinar
- pentrumonitorizareapacien[ilordup~tratamentulcanceruluiurotelial
- pentruscreening
- caprognosticalpoten[ialuluibiologicalcanceruluiurotelial.
Sensibilitateametodeiestedirectpropor[ional~cugraduldisplazieicelulare:3750%
pentrutumorilecugradsc~zutdedisplazie,respectiv74100%pentrucelecugrad`naltde
displazie.
b. Markeri tumorali de diagnostic care pot fi detecta[i `n probe de urin~ (Lokeshwar
VB,2005):
- BTA(bladdertumorantigen)esteoproteinadinmembranabazal~eliberat~`nurin~la
pacien[ii cu cancer vezical; se eviden[iaz~ prin test de aglutinare latex cu sensibilitate
2879%#ispecificitate4096%
- BTA stat este un test imunocromatografic cu sensibilitate 5783% #i specificitate 68
90%
- BTAtrackesteuntestELISAcusensibilitate1377,5%#ispecificitate5075%
- Antigenele tumorale M344, 19A211, LDQ19 sunt detectate cu ajutorul testului
Immunocyt,testimunocitochimiccusensibilitate86,1%#ispecificitate80%
- Proteine din matricea nuclear~ (NMP22) pot fi eviden[iate `n urin~ cu ajutorul
anticorpilormonoclonali;testularesensibilitate4884%#ispecificitate7591%
- Antigenul Lewis x (Lex) este exprimat `n peste 90% din celulele carcinoamelor
tranzi[ionale.Testulimunocitologicareosensibilitatede80%#iospecificitatede86%
folosind metode laborioase precum ADNul celulelor tumorale din sedimentul urinar
poate fi analizat precum testul FISH (hibridizarea prin fluorescen[~ insitu) care poate
eviden[ia modific~ri ale cariotipului sau prin citometrie `n flux care poate eviden[ia
aneuploidiasauhiperploidiacelulelorposibilmaligne.
181

TratatdeUrologie

Urocultura

Urinaestesteril~`ntoatesegmenteleaparatuluiurinarlapersoaneles~n~toase.Ea
sepoatecontaminalaemisiecuflorasaprofit~auretreianterioarelab~rbatsauaregiunii
vulvovaginalelafemeie(P~unR,1987).
Prelevarea urinei pentru urocultur~ se face din jetul mijlociu, `n zbor, `n recipient
steril, dup~ toaleta local~ riguroas~. Recoltarea frac[ionat~ a urinei la b~rbat poate fi util~
pentru localizarea infec[iei sau a hematuriei: primii 510 ml de urin~ con[in flora uretral~,
jetul urm~tor con[ine flora din vezica urinar~, iar flora prostatic~ se g~se#te `n proba
ob[inut~ dup~ masajul prostatei. Probe de urin~ pot fi ob[inute #i prin sondaj vezical sau
punc[iesuprapubian~aveziciiurinare.
Procesareaprobei`nlaboratorseface`nmaxim2oredelarecoltarepentruaevita
multiplicareaspontan~agermenilormicrobieniafla[i`nprobadeurin~.Dac~acestlucrunu
esteposibil,probasep~streaz~la40C.
`nlaboratoruldebacteriologie,probase`ns~m]n[eaz~cuajutoruluneiansecalibrate
pemediidecultur~careseincubeaz~la370C,1824ore.
Mediile de cultur~ folosite `n mod obi#nuit sunt gelozas]nge #i mediile lactozate
(MacConkey,AABTLagaralbastrudebromtemollactoz~)(BuiucD,1998;BurgheleTh.,
1972;Dorob~[OM,1997).
Culturilebacterieneseexamineaz~adouazidup~`ns~m]n[areaurineipemediilede
cultur~, se calculeaz~ num~rul unit~[ilor formatoare de colonii pe ml de urin~ (infec[ia
urinar~ se consider~ la peste 100.000 UFC/ml). Se continu~ cu identificarea germenilor
microbieniresponsabilideinfec[iaurinar~folosindcaractereledecultur~,testelebiochimice
etc.Infec[iaurinar~este,`ngeneral,monomicrobian~.
Antibiograma, testarea sensibilit~[ii la antibiotice a culturii bacteriene este etapa
final~aexamenuluibacteriologicutil~`norientareatratamentului.
Rezultatulantibiogrameiseexprim~calitativsaucantitativ.Esteorientativpentruc~
exist~diferen[e`ntresensibilitateainvivo#iinvitroabacteriilorlaantibiotice.
Escherichia coli, Proteus mirabilis, Klebsiella pneumoniae, Pseudomonas aeruginosa
#i enterococul sunt bacteriile cel mai frecvent implicate `n infec[ii urinare (Buiuc D, 1998;
BurgheleTh.,1972;Dorob~[OM,1997).
Uroculturapentrudiagnosticultuberculozeirenaleareoseriedeparticularit~[i.
Serecolteaz~treiprobematinaleconsecutivedeurin~dinjetulmijlociu`nvolumde
50mlfiecare.
Urinaesteunproduspaucibacilar#inecesit~etapedeconcentrareaprobei`naintea
`ns~m]n[~riiprincentrifugare.
Sedimentul neutralizat dup~ un protocol special se `ns~m]n[eaz~ pe 56 tuburi cu
mediu LwensteinJensen, iar cultura se urm~re#te p]n~ la 8 s~pt~m]ni (Buiuc D, 1998;
BurgheleTh.,1972;Dorob~[OM,1997).
Dinsedimentseefectueaz~frotiuricaresecoloreaz~ZiehlNielsen.
Semnifica[ia clinic~ a prezen[ei bacililor acidorezisten[i pe frotiuri din sediment
urinar nu este cert~, deoarece micobacterii saprofite pot contamina probele de urin~
(BurgheleTh.,1972).

182

Capitolul4.Investiga[iidelaborator`nurologie

Bibliografie

1.
2.
3.
4.
5.
6.
7.
8.
9.
10.
11.
12.
13.
14.
15.
16.
17.
18.
19.
20.
21.

B]lb`ieV,PozsgiW(subredac[ia)Bacteriologiemedical~,vol.II,EdituraMedical~,1985;218242.
BarbuRExplor~riFunc[ionale,EdituraDidactic~#iPedagogic~,Bucure#ti,1979;3852,227250,309
334.
BuiucDMicrobiologieClinic~,EdituraDidactic~#iPedagogic~,RABucure#ti,1998;270291.
BurgheleTh(subredac[ia)Patologiechirurgical~vol.VI,EdituraMedical~,Bucure#ti,1972;3876.
CucuianuM,TrifI,CucuianuAHemostaza,EdituraDacia,1994;190202.
Daiber A Mikroskopie der Harnsedimente, Wiesbaden, Verlag von J.F. Bergmann, 1896; 5285.
Imaginiprocesatepecomputerdup~fotografiidemicroscopieoptic~.
DobrescuDFarmacoterapiepractica,vol.I#iII,EdituraMedical~,1989;341357.
Dorob~[OMBacteriologiemedical~curs,1997;170203.
HenryJBClinicalDiagnosisandManagementbyLaboratoryMethods,ninethedition,W.B.Saunders
Company,1996.
Iacobs DS, DeMott WR, Oxley DK, LexiComp Laboratory Test Handbook 3rd Edition: LexiComps
DiagnosticMedicineSeries,NC,Hudson(Cleveland),OH,2004.
Lokeshwar VB, Habuchi T, #.a. Bladder Tumor Markers beyond Cytology: International consensus
panelonbladdertumormarkers,Urology,66,6A,2005;3563.
MoraruI(subredac[ia)Anatomiepatologic~,vol.II,EdituraMedical~,Bucure#ti,1980;527536.
P~unR(subredac[ia)TratatdeMedicin~Intern~Bolilerinichiului(coordonatorP~unR.),Editura
Medical~,Bucure#ti,1987;155175.
P~unR(subredac[ia)TratatdeMedicin~Intern~HematologieparteaaIIa(coordonatorColi[~D.),
EdituraMedical~,Bucure#ti,1999;9841044.
PricopC,MischianuD,Bucura#V(subredac[ia)Tumorilevezicalesuperficiale,ETPTehnopress,Ia#i,
2005;6084.
ProcaE,IliescuLUrologiecursuniversitar,EdituraUniversit~[iiTituMaiorescu,2004;3237.
SalamMAPrinciplesandpracticeofUrology,MASPublication,2002;4352.
SinescuI(subredac[ia)Urologieclinic~,EdituraMedical~Amaltea,Bucure#ti,1998;4247.
[i[eicaM,HalungaMarinescuSPracticaLaboratoruluiclinic,EdituraAcademiei R.S.R.,1984;4346,
7178,108120,178180.
WaldbyGAphorismsequotationsfortheSurgeon(editedbyMosheSchein),Cap.58Oldpatients,
2005;154.
WalshCP,RetikBA,StameyAT,VaughanEDUrineanalysisinCampbellsUrology,VIIItheditionW.B.
SaundersCompany,Philadelphia,1999;35.

183

Capitolul5.1.Explor~rileradiologicestandard

Capitolul

EXPLORAREAIMAGISTIC~
AAPARATULUIURINAR
#IGENITALMASCULIN

5.1.EXPLOR~RILERADIOLOGICE
STANDARD

Prof.Dr.CONSTANTINZAHARIA

185

TratatdeUrologie

Cuprins:

Tehniciradiologicedeinvestiga[ieaaparatuluirenourinar187

Diagnosticulradiologicalmalforma[iilorcongenitalealeaparatuluirenourinar192
Diagnosticulradiologicaltraumatismelorrenale,ureterale#ivezicale206

Diagnosticulradiologicalmodific~rilordimensiunilorrinichilor210

Diagnosticulradiologicallitiazeiaparatuluiurinar221

Diagnosticulradiologicaltumorilorrenale,ureterale#ivezicale230

Diagnosticulradiologicalafec[iuniloruretrei,veziciiurinare#iprostatei239

186

Capitolul5.1.Explor~rileradiologicestandard

Tehnicideexplorareaaparatuluirenourinar

Explorarea aparatului renourinar comport~ explor~ri conven[ionale, standard, dar


imagistica modern~ c]#tig~ teren, din ce `n ce mai mult `n detrimentul celorlalte metode.
Tehnicile de explorare conven[ionale sunt tehnici f~r~ utilizarea substan[ei de contrast #i
tehniciradiograficecareutilizeaz~substan[adecontrast.

Tehniciradiologicedeinvestiga[ieaaparatuluirenourinar

Tehniciradiologiceconven[ionaledeexplorareaaparatuluirenourinar:
radiografiarenovezical~simpl~
urografia
pielografiadirect~
pielografiaretrograd~
cistografiaanterograd~sauretrograd~
uretrografia
explor~rivasculare.

Radiografiarenovezical~simpl~(RRVS)

RRVS este o metod~ radiologic~, ce este utilizat~ fie ca atare, fie ca etap~ prelimi
nar~ urografiei intravenoase. RRVS este metoda de prim~ inten[ie radiologic~ care poate
evalua:
Pozi[ia,forma,contururile#idimensiunilerinichilor
Mu#chiipsoa#i
Existen[a,localizarea,num~rul#idimensiunilecalculilorradioopacidelanivelulapa
ratuluirenourinar
Prezen[a eventualelorcalcific~rirenale,ureteralesaudelanivelvascularoricalcifi
c~rile prostatice; existen[a unor calcific~ri pe aria de proiec[ie a rinichilor #i
ureterelorpoateimpuneefectuareadeexpunericomplementare,`ndiversegradede
oblicitate,sauchiar`ninciden[~deprofilpentrudepartajareaacestora.
Malforma[iile congenitale sau afec[iunile primare ori secundare de la nivelul verte
brelor,aoaselorbazinului,eventualacoastelor.
RRVS este efectuat~ `n decubit dorsal, `n
inciden[~ anteroposterioar~; pe radiografie trebuie
s~ se vizualizeze ultimele dou~ perechi de coaste #i
simfiza pubian~, s~ se vizualizeze bine opacit~[ile
renale #i marginile mu#chilor psoa#i. RRVS poate
detecta cu o precizie relativ~ pozi[ia, forma, contu
rurile #i dimensiunile rinichilor, delimita[i de [esutul
perirenal gr~sos, care este vizualizat ca o band~
radiotransparent~. Orice modificare cu caracter
patologicpoatefidoarsuspicionat~laanalizaRRVS,
confirmarea fiindf~cut~utiliz]ndaltemetoderadio
imagistice.

Fig.1.RRVScalculureteral.

187

TratatdeUrologie

Pentru a determina pozi[ia calculilor sau a calcific~rilor prezente pe radiografia de


fa[~,sepoateefectua,`ncompletare,oradiografiedeprofil.

Urografiaintravenoas~(UIV)

UIVestemetodaradiologic~standard,careutilizeaz~substan[eledecontrastintra
venoase iodate pentru a vizualiza `n ansamblu aparatul urinar (rinichi, uretere, vezic~
urinar~, uretr~). Acest examen se realizeaz~ jeun, cantitatea de substan[~ de contrast
iodat~ folosit~ fiind `n principiu de 1 ml/kgcorp, `ntro concentra[ie de 300 mg sau 350
mg/ml. C]nd func[ia renal~ este normal~, aproape 100% din substan[a de contrast este
excretat~ de rinichi. Substan[ele de contrast iodate sunt excretate de rinichi, prin filtrare
glomerular~,f~r~afiinfluen[at~desecre[iasaureabsorb[iatubular~renal~.
Metodaesteindicat~`ninvestiga[iiradiologicea:
malforma[iiloraparatuluirenourinar
traumatismelorrenoureterovezicale
sindromuluiobstructiv
sindromuluitumoralrenal,ureteralsaudevezic~urinar~
bolilorinflamatoriialeaparatuluirenourinar.

UIV este precedat~ obligatoriu de efectuarea RRVS, pe baza c~reia se apreciaz~


graduldepreg~tireasubiectuluiceurmeaz~s~efectuezeurografia.
Obun~preg~tireabolnavuluipentruefectuareaexamenuluiurograficimpune:
Intestinul gros trebuie s~ fie golit de con[inut, f~r~ acumul~ri gazoase #i resturi
fecaloide; aceasta se realizeaz~ fie prin administrarea de purgative, fie prin efectu
areaacelpu[indou~clismeevacuatorii.Alimenta[iaultimelor72deoretrebuies~
con[in~ alimente nefermentescibile, s~ fie evitate b~uturile carbogazoase, iar dieta
hidric~trebuies~fienormal~.
Sesuprim~oricemedica[iecucon[inutpoten[ialradioopaccucirca48deore`nainte
deexaminareaurografic~;
Nu se vor efectua niciun fel de explor~ri radiologice care utilizeaz~ substan[e de
contrast cu administrare oral~ sau rectal~ cu minimum 48 de ore `naintea
examenuluiurografic;
Sevaexplorabiochimicfunc[iarenal~cu24deore`nainteaexamenuluiurografic;
Sepoateadministramedica[ieantihistaminic~`nvedereareduceriirisculuilareac[ii
adversedatoratesubstan[eidecontrast.

Orice substan[~ de contrast administrat~ intravenos sau intraarterial are un timp


vascular, un timp tisular #i un timp excretor. `n func[ie de ace#ti timpi, UIV prezint~ mai
mul[itimpideexecu[ie:
Eviden[ierea radiologic~ a rinichiului se bazeaz~ pe timpul tisular. Primul timp este
celalnefrogrameirenale,carereprezint~opacifiereaparenchimuluirenal,fiindprodus~prin
fenomenul de filtrare a substan[ei de contrast `n lumenul tubular, de obicei `n regiunea
proximal~atubilorconvolute.Densitateanefrogrameiestedirectpropor[ional~cunum~rul
#ivolumultubilorproximali,cuconcentra[iasubstan[eidecontrastdinele.Pentruc~nefro
gramaesteunprocescareserealizeaz~lanivelultubilorproximali,eanuesteafectat~de
starea de deshidratare a pacientului. Pentru a ob[ine nefrograma renal~, se realizeaz~ o
radiografie [intit~ pe aria renal~ imediat dup~ administrarea injectabil~ a substan[ei de
188

Capitolul5.1.Explor~rileradiologicestandard

contrast,deobiceila30desecundep]n~la1minutdelainjectare.Defapt,primaimagine
urografic~seefectueaz~`nprimele3minute delainjectare.Acesttimpestecelmai fiabil
pentruam~suradimensiunilerenale,pentrudetectareaanormalit~[ilorliniilorextrarenale#i
implicitpentrudetectareamaselorrenale.
Urm~torul timp urografic este pielografia, care este produs~ de urina `nc~rcat~ cu
substan[~decontrastprezent~lanivelulsistemuluipielocaliceal.Densitateapielografieieste
directpropor[ional~cuconcentra[iasubstan[eidecontrastdinurin~#iinverspropor[ional~
cu gradul de distensie a sistemului pielocaliceal. Concentra[ia substan[ei de contrast din
urin~depindededozadesubstan[~decontrast,stadiuldedeshidratareapacientului`ntrun
raportinverspropor[ional,precum#idegradul de diurez~osmotic~produs~ desubstan[a
decontrast.Acesttimpurograficsepoateob[inerealiz]nduncli#euradiograficla5minute,
carevaeviden[iaopartedincalicelerenaleopacifiatecusubstan[~decontrast#i,implicit,
ridic~ suspiciunea unui eventual proces obstructiv, urmat de o radiografie [intit~ pe aria
renal~ la 10 minute de la injectarea substan[ei de contrast, c]nd se eviden[iaz~ `ntreg
sistemul pielocaliceal optim destins. Acest timp urografic permite eviden[ierea ureterului
umplutcusubstan[~decontrast,care,datorit~mi#c~rilorperistalticenuseeviden[iaz~pe
tottraiectuls~u.`ncazul`ncaresistemulpielocalicealnuestebinepus`neviden[~sepoate
utilizacompresiaureteral~.
`ntruntimptar
div, se ob[ine timpul
cistografic al urografiei
intravenoase efectuat,
de principiu, la 30 de
minute de la injectare,
c]nd se opacifiaz~ vezi
ca urinar~, put]nduse
apreciavolumulei,con
tururile, forma #i even
tualele anomalii sau
procese`nlocuitoarede
spa[iu.

Fig.2.UIVnormal.

Pentru ameliorarea diagnostic~ a examenului urografic #i eviden[ierea mai bun~ a


unorpor[iunialeaparatuluiurinarserecurgelaoseriedeartificiitehnice.Dintreacesteacea
mai utilizat~ este compresia ureteral~. Este indicat~ pentru o mai bun~ opacifiere a
sistemuluipielocaliceal.Pentrurealizareaeiseaplic~unruloucompresivlanivelulcrestelor
iliace, ob[in]nduse compresia ureterelor `ntre rulou #i planul dur subiacent (mas~
muscular~, os sacru). Se ob[in astfel detalii morfologice ale sistemului pielocaliceal.
Compresia este contraindicat~ `n colica renal~, la v]rstnici sau la cei cu suspiciune ori
cunoscu[i cu un anevrism de aort~ abdominal~. `n cazul utiliz~rii de substan[e de contrast
nonionice, acestea fiind normoosmolare, nu se produce o cre#tere a debitului urinar.
Realizarea compresiei va determina `nt]rzierea evacu~rii SC din sistemul pielocaliceal cu
vizualizarea mai bun~ a acestuia. O imagine aproape similar~ se poate realiza efectu]nd o
expunerecusubiectul`ndecubitventral.
189

TratatdeUrologie

Proba`nc~rc~riicuap~,indicat~maialespentrua
demonstraodisfunc[iedejonc[iunebazinetoureteral~,se
poaterealizafieprinadministrareaaminimum500mlde
ap~`ntimpulexamin~rii,fie,maibine,prinadministrarea
de 40 mg furosemid i.v. Astfel se ob[ine o cre#tere a
debitului urinar cu o eliminare mai rapid~ a SC. `n cazul
unei modific~ri morfologice de jonc[iune bazinetourete
ral~ se va produce o dilata[ie unilateral~ a sistemului
pielocaliceal#ibazinetuluidepartealeziunii.
Efectuarea de radiografii `n ortostatism ofer~
informa[iiprivindoeventual~ptoz~renal~.

Fig.3.Calculureteralpelvinst]ng
(UIV+compresie).

Istoric, `ntre artificiile tehnice ale UIV trebuie men[ionat~ #i urografia minutat~.
Aceastaeraindicat~pentruademonstraoeventual~HTAdeoriginerenal~,generat~deo
ischemierenal~.Seefectuauexpunerirepetate,dinminut`nminut,cuurm~rireasimetriei
nefrogramei #i urogramei. Aceast~ tehnic~, mult prea iradiant~, nu se mai utilizeaz~, fiind
complet`nlocuit~deecografiaDoppler.
Tomografia plan~, efectuat~ pe parcursul examenului urografic, oferea detalii mai
precise asupra dimensiunilor #i morfologiei renale #i a spa[iului `nconjur~tor renal. Tomo
grafiacomputerizat~aeliminatcompletaceast~tehnic~multpreairadiant~.

Examenulurograficestecontraindicatformal`nurm~toarelesitua[ii:
insuficien[arenal~(datorit~uneiconcentra[iiinsuficienteaSC)
colicarenal~(posibil~inhibi[ieasecre[iei#iexcre[iei)
nepreg~tirea corespunz~toare a bolnavului (cre#te riscul erorilor de interpretare
diagnostic~).

Pielografiadirect~anterograd~

Esteotehnic~radiologic~miniminterven[ional~,careserealizeaz~prinintroducerea
substan[ei de contrast direct `n sistemul pielocaliceal. Aceasta se face prin reperajul
ultrasonografic al SPC, abordarea transcutanat~ a acestuia #i introducerea unui cateter la
acestnivel.Seintroduceprincateter,subcontrolfluoroscopicaSCdirect`nSPC,urm~rindu
se opacifierea SPC #i ureterului. Avantajul metodei este c~ ofer~ informa[ii asupra c~ii
urinareunilateral,f~r~adepindedefunc[iarenal~,metodaareindica[ie`nexplorareasin
dromului obstructiv #i eviden[iaz~ foarte bine SPC #i ureterul. Sunt necesare realizarea de
condi[iideasepsie#iantisepsiecorespunz~toareoric~rortehniciinvazive,precum#iobun~
manualitateaoperatorului.

Pielografiaretrograd~

Const~`ncateterizareaureteruluipecalecistoscopic~cuintroducereaconsecutiv~a
substan[ei de contrast direct `n ureter #i vizualizarea retrograd~ a ureterului #i SPC. Are
190

Capitolul5.1.Explor~rileradiologicestandard

acelea#iindica[iica#ipielografiaanterograd~,risculpropag~riiascendenteauneieventuale
infec[iiurinarejoasefiinddestuldemare.
Ambele metode, at]t pielografia antero
grad~, c]t #i cea retrograd~, #iau pierdut `n timp
din importan[~ `n timp, odat~ cu introducerea
tomografieicomputerizate#i,maiales,auroRMN.

Fig.4.Pielografieretrograd~normal~

peparteadreapt~.

Cistografia

Cumuleaz~ tehnicile de vizualizare a vezicii


urinare. Se realizeaz~ prin opacifierea vezicii
urinare fie anterograd, ca etap~ obligatorie a exa
menului urografic, fie prin umplerea direct~ a
vezicii urinare cu substan[~ de contrast pe cale
retrograd~ pe sond~ uretral~ sau sond~ de cisto
stomie.
Calea retrograd~ permite scurtarea timpului de examinare, nu depinde de func[ia
renal~,oferinddetaliimorfologicecomplete.
Cistografia direct~ este indicat~ mai ales `n studiul refluxului vezicoureteral, care
necesit~gradedereple[ievariate#iimpuneefectuareaunuiradiografiimic[ionale.
Indica[iilemetodeisunt:
traumatismeleregiunii
studiultumorilorvezicale
studiulmalforma[iilordevezic~urinar~
suspiciuneadediverticulevezicalesaudefistule
patologiarefluxuluivezicoureteral.
Pentru suspiciunea unei ptoze vezicale se impune #i efectuarea unei radiografii `n
ortostatism.
Examenulcistograficimpunerealizareaderadiografii`ninciden[~frontal~,dar#i`n
diversegradedeoblicitate.

Uretrografia

Este tehnica radiologic~ de vizualizare a uretrei. Se folose#te `n mod curent pentru


vizualizarea uretrei masculine. Const~ `n opacifierea uretrei cu substan[~ de contrast, fie
anterograd,caetap~final~auneiurografii,fieretrograd,princateterizareauretrei#iintro
ducerea substan[ei de contrast. Sonda se plaseaz~ de principiu cu v]rful la nivelul fosei
naviculare.
Uretrografia poate fi un examen de prim~ inten[ie `n diagnosticarea stenozelor
uretrale,cabilan[`ntraumatismesaupentrueviden[iereaunorfistulelaniveluretral.

191

TratatdeUrologie

Diagnosticulradiologicalmalforma[iilorcongenitale
aleaparatuluiurinar

Clasificareaanomaliilorcongenitalerenale
1. denum~r: agenezie
supranumerar
2. depozi[ie: nerotat
malrotat
ectopiajoas~
ectopia`nalt~
3. dedimensiuni:
hipoplazia
hiperplazia
4. defuziune: rinichi`npotcoav~
ectopia`ncruci#at~
5. vasculare: anomaliiarterialerenale
anomaliivenoaserenale
6. destructur~: persisten[alobula[ieifetale
pseudotumorirenale:a.coloaneleBertin
b.hilarlips
c.duplica[iarenal~
boalachistic~congenital~:
a. displaziamultichistic~renal~
tipulpelvoinfundibular
tipulhidronefrotic
b. boalarenal~polichistic~autozomalrecesiv~
perinatal
neonatal
infantil
juvenil
c. rinichiulspongiosmedular
d. nefromul(nephroma)multilocularchistic
e. diverticululcaliceal
masesolidecongenitale
a. nephromulmezoblastic
b. nefroblastomatoza
7. obstructivealeregiuniipelviureterale.

Anomaliidenum~r

Ageneziarenal~
Agenezia renal~ rezult~ din imposibilitatea mugurelui ureteral de a ajunge la
blastemul metanefric, pentru c~ mugurele ureteral a e#uat `n formare sau a degenerat
prematur#iinducereanefronuluifunc[ionalnuapare.
Aceast~ anomalie asociaz~ `ntotdeauna anomalii ureterale sau alte anomalii, #i
anume:ureterabsentipsilateral,hemitrigonabsentipsilateral,vasdeferentabsentipsilate
ral,uterunicornsauanomaliidecolon.
192

Capitolul5.1.Explor~rileradiologicestandard

Anomaliile ureterale includ absen[a ureterului ipsilateral #i asociaz~ hemitrigon


absentsauprezen[aunuirestureteralcucap~torb,or~m~#i[~adezvolt~riiincomplete a
mugureluiureteral.
Ageneziarenal~poateexistacaataresau`ntruncomplexasociativdemalforma[ii.
Sa constatat c~ 20% din b~rba[ii cu agenezie renal~ prezint~ o alt~ anomalie asociat~, #i
anume absen[a epididimului ipsilateral, absen[a vasului deferent ipsilateral, absen[a
veziculeiseminaleipsilateralesauprezen[aasocieriiunuichistalveziculeiseminaleipsilate
rale.70%dinfemeilecuagenezierenal~unilateral~asociaz~anomaliigenitale,dintrecare
cele mai frecvente sunt: absen[a sau atrezia uterului sau vaginului, uter cu un singur corn
asociat cu absen[a sau atrezia de vagin #i ovar sau anomalii de duplica[ie ale tractului
genital. Aceste anomalii complexe de ducte mlleriene sunt considerate a fi parte a
sindromuluiMayerRokitanskyKusterHauser.
Deasemenea,`n10%dincazuri,ageneziarenal~asociaz~absen[aipsilateral~aglan
deisuprarenale.
De#i agenezia renal~ poate fi diagnosticat~ prin examen computer tomografic,
ecografiesauscintigrafie,eapoatefiremarcat~#ipeRRVS.Radiografiarenovezical~simpl~
vapune`neviden[~lanivelullojeirenalegoaleintestin.Deobicei,colonulumplefosarenal~
goal~.C]ndlipse#terinichiulst]ng,flexurasplenic~destins~degazareoconfigura[ieaparte,
ea fiind deplasat~ medial #i eventual prezent]nd bucle, iar diagnosticul este cert c]nd o
por[iunedinflexurasplenic~estesituat~medialdemicacurbur~astomacului.Deasemenea,
dislocareamedial~aflexuriihepaticeacolonuluiesteasociat~cuageneziarenal~dreapt~;
aceast~modificareestemaipu[inevident~dec]tpest]nga.
Agenezia renal~ unilateral~ r~m]ne asimptomatic~ at]t timp c]t rinichiul contra
lateralfunc[ioneaz~normal;frecvent,rinichiulcontralateraldevinehipertrofic#iaparem~rit
`n dimensiuni. De asemenea, exist~ frecvent malforma[ii congenitale la nivelul rinichiului
contralateral, iar dac~ aceste anomalii afecteaz~ func[ia renal~ se dezvolt~ insuficien[a
renal~.
Diagnosticuldeagenezierenal~peRRVSestecelpu[inhazardat,suspiciuneanecesi
t]ndexamenUIVpentruconfirmare.
Urografiaintravenoas~vaeviden[iaabsen[aunilateral~aopacifieriirinichiului`nfosa
renal~, necesit]nd un diagnostic diferen[ial cu nefrectomie `n antecedente, ectopie renal~,
ocluzia arterei renale, ocluzia venei renale, obstruc[ie ureteral~, pionefroza, pielonefrita,
pielonefrita xantogranulomatoas~, rinichiul displazic multichistic sau tumori infiltrative ale
rinichiului.

Rinichisupranumerari
Esteoanomalierar~`ncaresuntprezen[imaimultdedoirinichi,probabilcarezultat
al form~rii de doi muguri ureterali pe o singur~ parte. Cel mai frecvent, rinichiul supra
numerarestelocalizatcaudaldecelnormal,iarrinichiulcontralateralestehipoplazic.Aceas
t~anomalieestemaifrecventunilateral~.Estemaides`nt]lnit~lafemeidec]tlab~rba[i.
Diagnosticulesteexclusivurografic.Pentruvizualizareaanomaliei,examenultrebuie
efectuatfiecucompresie,fief~r~compresie,darobligatoriutrebuieefectuat~oexpunere
cubolnavul`ndecubitventral pentruomaibun~vizualizareaureterelor.Niciodat~ nefro
gramarenal~`ncazulrinichilorsupranumerarinuvafideaceea#iintensitate.
Rinichii supranumerari sunt de dou~ tipuri, `n primul tip exist~ un ureter bifid care
dreneaz~ #i cel deal doilea rinichi ipsilateral, iar `n cel deal doilea tip, rinichiul supranumerar
estedrenatdeunureterseparat,diferitdeureterulcaredreneaz~rinichiuldeaceea#iparte.

193

TratatdeUrologie

Rinichiulduplexesteomalforma[ieapelvisuluirenal,acestafiindpar[ialsaucomplet
bifid asociat cu un singur ureter, fiind cea mai comun~ anomalie renal~ `nt]lnit~. `n
duplica[iarenal~,parenchimulrenaleste`mp~r[it`ntrunsegmentsuperior#iunulinferior,
fiecaresegmentav]ndcalicelelorproprii,pelvisrenal#iureterseparate.Ureterelesepotuni
`nainte de a ajunge `n vezica urinar~ sau se pot deschide separat `n vezica urianr~. Oca
zional, ureterele se pot deschide `n afara vezicii urinare, #i anume `n uretr~, vezicule
seminale,vaginsau`nperineu.
Urografia intravenoas~ poate eviden[ia #i
alte tipuri de modific~ri #i anume un sistem
colector #i ureter unic cu un pelvis #i calice
asimetrice#ineobi#nuitdelungi,segmentulrenal
inferiorav]ndsistemcolectorcareaparedeobicei
caofloarec~zut~.Oalt~variant~esteprotuzia
segmentului superior al ureterului care se inser~
direct`nparenchimulrenalsuperior.

Fig.5.Bazinetbifidbilateral

(duplica[iebazinetal~).
ANOMALIIDEPOZITIE

Anomaliiderota[ie
Anomaliilederota[ie,malrota[ia#inonro
ta[ia rinichilor, sunt frecvente, ele rezult]nd din
lipsa de rota[ie a rinichiului `n jurul axului s~u
vertical `n timpul ascensiunii. Nonrota[ia rezult~
`ntro pozi[ionare anterioar~ a jonc[iunii pielo
ureterale,iarunelecalicevorfisituatemedialde
pelvisul renal, modific~ri care pot fi puse `n evi
den[~prinurografieintravenoas~.
Malrota[ia rezult~ prin hiperrota[ia rini
chiului `n jurul axului s~u vertical, jonc[iunea
pieloureteral~ fiind orientat~ posterior, modifi
careeviden[iabil~prinurografieintravenoas~.

Fig.6. Rinichimalrotat.

Ectopiarenal~
Este descris~ ca fiind rezultatul lipsei sau
exager~riiascensiuniinormalearinichiuluicaudo
cranial.Ectopiarenal~sepoateasociacuanomalii
de fuziune, situa[ie `n care poart~ numele de
ectopie`ncruci#at~.
Ectopia renal~ se asociaz~ frecvent cu anomalii renale contralaterale, inclusiv
ageneziacontralateral~sauectopiarinichiuluicontralateral.Ambiirinichipelvinipotfuziona.
Dac~fuzioneaz~,segmentelemedialealerinichilorpelviniseformeaz~ostructur~renal~ca
194

Capitolul5.1.Explor~rileradiologicestandard

uninel`npelvis, descris~subnumele de rinichidiscoid; poateexistaunsingururetersau


potfidou~ureterecares~drenezemasadeparenchimrenal.
Pentru c~ anomaliile de tract urinar tind s~ fie multiple, rinichiul pelvin se poate
asocia cu o inciden[~ crescut~ a obstruc[iilor jonc[iunii pelvicoureterale, refluxului vezico
ureteral, o func[iesc~zut~,toateacesteanomaliifiindeviden[iabile `ncadrulunuiexamen
urografic. Astfel se vor eviden[ia prezen[a rinichiului caudal de loja renal~, prezen[a unei
excre[ii`nt]rziate,asimetricefa[~derinichiuls~n~tos.
Ectopia `nalt~ este o malforma[ie rar `nt]lnit~, caracterizat~ de prezen[a unuia sau
ambilorrinichi`ntropozi[iemai`nalt~dec]t`nmodobi#nuit,rinichiiafl]nduseimediatsub
diafragm, dar aceast~ pozi[ie `nalt~ poate duce la o eventra[ie diafragmatic~ #i care
mimeaz~opozi[ierenal~supradiafragmatic~,descris~carinichiintratoracici.

a.
b.

Fig.7a,b.a)Rinichi dreptptozat;b)Anomaliedepozi[ierinichidrept.

Anomaliidedimensiuni

Hipoplazia
Hipoplazia renal~ este definit~ ca o anomalie congenital~ `n care unul sau ambii
rinichiprezint~dimensiunireduse,f~r~afiafectat~func[ia.Astfel,`nhipoplaziacongenital~,
umbra renal~estemic~,modificareeviden[iabil~peRRVS.Urografiaintravenoas~certific~
dimensiunileredusealerinichiului,sistemulcolectorfiindcaracterizatprincaliceminore#i
majore de mici dimensiuni, dar propor[ionale cu dimensiunile rinichiului, iar func[ia renal~
estenormal~.

Hiperplazia
Este definit~ printro cre#tere uniform~ dimensional~ a rinichilor. RRVS pune `n
eviden[~oumbr~renal~uniformm~rit~,dardiagnosticuldehiperplazienupoatefipusdoar
pe dimensiunile rinichiului, motiv pentru care se efectueaz~ un examen urografic care va
195

TratatdeUrologie

eviden[iaprezen[acalicelor#ipelvisuluim~ritepropor[ionalcadimensiunicudimensiunile
rinichiului,func[iarenal~fiindabsolutnormal~.

Anomaliidefuziunerenal~

Rinichi`npotcoav~
Este cea mai frecvent~ anomalie renal~, care predomin~ la b~rba[i, fiind rezultatul
contactului`nvia[afetal~acelordou~colec[iimetanefrotice,ceeacevaducelaunireacelor
dou~ mase renale pe linia median~. Unirea pe linia median~ sau istmul poate fi alc~tuit~
dintro band~ fibrotic~ ori din parenchim renal func[ional, care reprezint~ fuziunea polilor
caudali ai ambilor rinichi. Pe RRVS se poate doar suspiciona diagnosticul, av]nd `n vedere
anomaliadepozi[ieacelordou~umbrerenale`nraportcuconturulpsoa#ilor.
Modific~rilevizibilelaexamenulUIVsuntnonrota[ierenal~,c]ndpelvisul#icalicele
aupozi[ie`nplanmaimultsagitaldec]toblic,uretereleproximaleauini[ialuntraiectlateral,
pentrucaapois~revin~launtraiectnormal,iarpelvisulrenalacoper~proiec[iacalicelor.
Frecvent, rinichiul `n potcoav~ are pozi[ie joas~ `n abdomen ca urmare a opririi
ascensiunii normale a lui. Ascensiunea rinichiului `n potcoav~ se termin~ prematur c]nd
acesta r~m]ne fixat sub originea arterei mezenterice inferioare. Asociaz~ numeroase
anomalii vasculare renale, care rezult~ din anomalii de dezvoltare sau ascensiune
incomplet~,dar#ialteanomaliidetracturinar,cadeexemplu:obstruc[ielaniveluljonc[iunii
pieloureterale, anomalii de duplica[ie, anomalii de geometrie a rinichilor, ceea ce poate
favorizaconstituirealitiazeicustaz~urinar~consecutiv~`npelvisulrenal.

a.
b.
c.

Fig.8ad.Rinichi`npotcoav~.

Ectopia`ncruci#at~
Esteoanomaliecongenital~rar~,`ncareunuldin
rinichi traverseaz~ linia median~ #i fuzioneaz~ cu rinichiul opus;
ambiirinichifuziona[iseafl~deaceea#iparteacoloanei
vertebrale, dar ureterele sunt inserate `n pozi[ie
normal~,ureterulrinichiuluideplasattrec]nddincolode
linia median~ #i deschiz]nduse `n vezica urinar~ `n
d.
pozi[ienormal~,contralateraldecel~laltostiumureteral.
196

Capitolul5.1.Explor~rileradiologicestandard

Anomaliaestemaifrecvent~lasexulmasculindec]tlacelfeminin#ieste,deobicei,
asimptomatic~.
Exist~maimultevariantedefuziuneacelordoirinichi:
`nL
`nS
discoid.
De obicei, rinichiul st]ng trece linia
median~,l~s]ndlojarenal~goal~.
Pe RRVS, imaginea este similar~ cu
aceeadinageneziarenal~,umbrarenal~vizi
bil~av]nddimensiunimaimari`naxullung.
Examenul
urografic
tran#eaz~
diagnosticul prin punerea `n eviden[~ a
anomaliilor. Rinichiul ectopic poate prezenta
o deformare a sistemului colector #i a
pelvisului, sistemul colector schimb]ndu#i
direc[ia pe axul lung, iar calicele av]nd o
form~dem~ciuc~,arputeaficonfundatcu
rinichiul hidronefrotic sau cu deformare
caliceal~secundar~infec[iei.

Fig.9.Ectopie`ncruci#at~.

Anomaliidevasculariza[ierenal~

Anomaliile de vasculariza[ie renal~ sunt eviden[iate de angiografie, indiferent de


metod~,exameneleradiologiceconven[ionalefiindinutile`ncazuluneiastfeldesuspiciuni.

Anomaliidestructur~

Lobula[iafetal~
Persisten[alobula[ieifetalese`nt]lne#tela5%dinadul[i#ireprezent]ndunvestigiu
dedezvoltarelobar~arinichiului.C]ndpersist~lobula[iafetal~,urografiaintravenoas~pune
`neviden[~unrinichicuogrosimeaparenchimuluicudimensiuninormale,darprezent]nd
incizurirenale,caresuntnetede#iregulate.Cheiaidentific~riipersisten[eilobula[ieifetale
estereprezentat~deapari[iaincizurilorastfel`nc]tcalicelesuntcentrate`ntreincizuri.

Masede[esutrenalnormal
a.ColoaneleBertinreprezint~invagina[iide[esutcorticalrenalcareseextindedela
corticalaexterioar~lasinusulrenalfiindun[esutcarefunc[ioneaz~normal,care,deobicei,
apare la jonc[iunea `ntre 1/3 superioar~ #i cea mijlocie a parenchimului renal. Nu sunt
eviden[iabilelaexamenulurografic.
b. Hilar lips sunt colec[ii proeminente de [esut renal normal ce apar `n zonele de
fuziunecomplex~lobular~renal~,celmaimedialaspectdeparenchimrenalcare`nconjur~
sinusul renal, c]nd proemin~ `n sinus #i pot distorsiona calicele polare, mai frecvent cele
superioare #i mai fecvent pe st]nga, iar marginile sunt neted conturate f~r~ neregularit~[i
focale.

197

TratatdeUrologie

c. Anomaliile de duplica[ie sunt definite prin prezen[a a dou~ sau mai multe
elemente pielocaliceale de la pelvis bifid la ureter bifid; spectrul con[ine duplica[ie incom
plet~ureteral~,duplica[iecomplet~ureteral~cuintrarecomun~`nvezicaurinar~#iduplica
[iecomplet~cuintrareectopic~`npolulsuperioralveziciiurinare.
Frecvent,acesteanomaliisuntbilate
rale; ele pot duce la configura[ii anormale
ale parenchimelor renale, inclusiv m~rirea
rinichilor #i arii proeminente de [esut renal
normal care divide sinusul renal, `n dou~
componente separate pielocaliceale; este
similarcucoloaneleBertin.
Examenul urografic va eviden[ia un
rinichi m~rit ca dimensiuni, cu parenchim
solid renal care separ~ cele dou~ sisteme
colectoarerenale`nduplica[iacomplet~.

Boalachistic~congenital~
Este un grup de boli congenitale care
include:
Displaziarenal~multichistic~
Boalarenal~polichistic~autozomal
recesiv~
a.
Rinichiulspongiosmedular
Fig.10.a.Duplica[iebazinetoureteral~st]ng~.
Nefromachistic~multilocular~
Diverticululcaliceal.

a. Displazia renal~ multichistic~ este una din cele mai frecvente cauze de mase
abdominale la copii. Termenul de displazie renal~ multichistic~ cuprinz]nd spectrul de
anomaliirenalecareinclude:
tipulclasicpelviinfundibular
tipulhidronefrotic.

`nformapelviinfundibular~,parenchimulrenaleste`nlocuitcumultiplechisturi,de
dimensiuni variabile, care nu comunic~ `ntre ele; nu exist~ mas~ renal~ rezidual~
func[ional~,undeartrebuis~fiepelvisulrenal,nuexist~leziunechistic~dominant~,iarun
ureter atrezic exist~ pe o lungime variabil~, reflect]nd formarea incomplet~ a mugurelui
ureteral.
Modific~rileradiologicecareseeviden[iaz~`ntipulpelviinfundibularsunt:
chisturidistribuitela`nt]mplare
chisturicarenucomunic~
absen[afunc[ieirenale
ureteratrezic.

`nformahidronefrotic~,displaziarenal~multichistic~aparecaurmareauneianomaliidedezvoltarea
mugurelui ureteral, dar care apare mai tardiv `n gesta[ie dec]t forma pelviinfundibular~. Poatefio form~ de
obstruc[ieajonc[iuniipieloureterale`nuter.`naceast~form~domin~unchistcareestelocalizatpeloculpelvisuluirenal,`njurul
acestuiag~sindusealte numeroasechisturice potcomunica`ntreele.Acestechisturiseafl~pelocul

198

Capitolul5.1.Explor~rileradiologicestandard

unde ar trebui s~ fie calicele. Poate exista un minim de parenchim renal func[ional, dar
majoritateaparenchimuluiestedisplazic#inefunc[ional,iarureterulesteocluzat`nceeace
artrebuis~fiejonc[iuneapieloureteral~.
Modific~rileradiologice`nt]lnite`ntipulhidronefroticsunt:
chistuldominant`nregiuneapelvisuluirenal
chisturiradiarecarepotcomunica
posibil~minim~func[ierenal~
ureterulocluzatlajonc[iuneapelviureteral~.

Fig.10.b.Rinichimultichistici.

b. Boala renal~ polichistic~ autozomal


recesiv~ (ARPKD) este un subtip de boal~ chistic~
renal~`ncarenenum~ratechisturiorientateradial
de 18 mm diametru, se g~sesc `n parenchimul
renal,careeste`nlocuitcugradevariatededilata[ii
chistice,nefunc[ionalealestructurilortubulare.
ARPKDestesub`mp~r[it~`npatrucategorii:
perinatal~, care este forma cea mai comun~, `n care peste 90% din ductele colec
toare sunt `nlocuite cu dilata[ii chistice tubulate nefunc[ionale, av]nd o mortalitate
impresionant~
neonatal~, este forma `n care 60% din ductele colectoare renale sunt `nlocuite cu
mici chisturi, `n prima lun~ de via[~ ap~r]nd insuficien[a renal~ sever~, urmat~ de
deces`nc]tevaluni
infantil~
juvenil~func[iarenal~esteaproapenormal~.

Urografia demonstreaz~ nefromegalie cu men[inerea formei reniforme a ambilor


rinichi. Dup~ administrarea de SC se eviden[iaz~ o nefrogram~ striat~. Stria[iile rezult~ din
func[ionareanormal~caredetermin~umplereacuSCatubilorcolectorinormali,caresunt
adiacen[icelordilata[ichistic,plinideurin~#inefunc[ionali.Acestemodific~risuntcaracte
risticepentruARPKD.

c. Rinichiul spongios medular se refer~ tot la o ectazie tubular~ benign~. Acesta


rezult~dinectaziaidiopatic~atubilorcolectorirenali,fiindoanomalierelativfrecvent~.De
obice, este benign~ #i r~m]ne asimptomatic~, dar are o complica[ie major~ care este
cre#terea inciden[ei nefrolitiazei, ce rezult~ din staza urinar~ care apare `n tubii dilata[i
chistic,astfelasociindusefrecventcunefrocalcinoza.
Urografiaintravenoas~pune`neviden[~urm~toarelemodific~riradiologice:
colec[ii focale cilindrice sau saculare pline de SC, care se v~d `n medulara renal~
adiacentdecalice
caliceleadiacentesuntnormale
nefrocalcinozamedular~prezent~`ninterioruldilata[iilorchisticealetubilorcolectori
(dup~administrareaSC,acestecalcific~risuntmascatedeSC)
acestecalcific~ricresc`ntimp.
199

TratatdeUrologie

d.Nefromulchisticmultilocularesteotumor~rar~,carerezult~dintrundefectde
embriogenez~ a unui segment de blastom metanefric. Apare la din pacien[i la b~ie[ii `n
primadecad~dev]rst~#icealalt~lafemeile`ndecada34.
Radiologic,acesttipdetumor~aparecamas~renal~binecircumscris~cuopseudo
capsul~ groas~, fiind format~ din multiple chisturi cu dimensiuni variabile separate prin
septuri,hemoragia#icalcific~rilesuntdeobiceiabsente.Clasic,radiologicsedescrieasoci
erea unei hernieri a masei parenchimatoase `n pelvisul renal, f~r~ acest argument nu se
poateafirmaacestdiagnostic.

e. Diverticulul caliceal este cunoscut drept chist pielogenic, fiind o cavitate intra
parenchimatoas~ acoperit~ de epiteliu tranzi[ional `n interiorul rinichiului plin~ cu urin~,
care rezult~ din insuficien[a ampulei segmentare a mugurelui ureteric de a induce
dezvoltareanefronului`nparenchimulrenal.De#iacestecavit~[icomunic~directcucalicele,
elenusuntconectatelaductelerenalecolectoare.
Clasificareadiverticulilorcaliceali:
tipulIcuoriginea`ncaliceleminore,careestecelmaicomuntip,reprezentatprintr
undiverticulcaliceallegatdirectcucalicele
tipul II cu originea `n infundibulul caliceal, are un infundibul care comunic~ cu un
calicemajor,situatmaicentral`nsistemulcolector
tipulIIIcuoriginea`npelvisulrenal,celmairar`nt]lnit,comunic~directcupelvisul
renal,are localizarecentral~, tindes~ creasc~ #i determin~ simptome destaz~ mai
frecventdec]tcelelaltedou~tipuri.
Examenul urografic va eviden[ia `n toate tipurile ni#te cavit~[i rotunde, cu pere[i
netezi care se umplu cu SC mai t]rziu dec]t calicele normale. Diverticulul caliceal tinde s~
aib~ung]t`ngustdecomunicarecusistemulcolectornormal,duc]ndlastazaurinar~,care
predispunelalitiaz~#itrebuief~cutdiagnosticuldiferen[ialcuhidrocalixul,cetindes~aib~
conturuldiferitdecelaldiverticululuicaliceal.

Masesolidecongenitale

a.Nefromulmezoblasticesteotumor~benign~,reprezent]nd,defapt,hamartomul
rinichiului,fiindoleziuneexofitic~,deform~rotund~,caredeformeaz~conturulrenal.

b. Nefroblastomatoza este o boal~ `n care multiple focare de [esut primitiv renal


sunt `ntep~trunse cu parenchim normal. Duce la m~rirea rinichiului, cu multiple focare de
[esut nefunc[ional, care pot fi eviden[iate prin UIV, iar focarele de [esut primitiv renal pot
determinaefectdemas~cudistorsiuneacalicelor.

Anomaliiobstructivealejonc[iuniipieloureterale

Obstruc[ia jonc[iunii pieloureterale este atribuit~ unei anomalii de dezvoltare a


mugurelui ureteral prin ischemie `n uter, vase aberante `ncruci#ate, benzi fibroase care
compreseaz~ mugurele ureteral, duc]nd la un segment ureteral f~r~ kinetic~ #i rezult~
hidronefroz~#idistensieapelvisuluirenaldiagnosticatprinurografieintravenoas~saupielo
grafieretrograd~,carepun`neviden[~`ngustareafocal~laniveluljonc[iunii#ihidronefroza
supraiacent~.Cuc]tboalaestemaivechecuat]tpelvisulrenalestemaidestins,maimare,
iar ureterul superior dezvolt~ un contur spiralat, r~sucit. C]nd pe UIV se vede angularea
200

Capitolul5.1.Explor~rileradiologicestandard

abrupt~aJPUtrebuiesuspectat~asociereaobstruc[ieicuprezen[aunuivasaberant`ncru
ci#at.

Anomaliicongenitalealeureterului

Anomaliidenum~r
Variantelecongenitalealesistemuluipielocalicealsuntcelemaifrecvente,anomaliile
deduplica[iefiindreprezentatedeformeu#oare#iduplica[iicomplete.
Formele u#oare sunt pelvisul renal bifid #i
duplica[iaureteral~incomplet~:
sedezvolt~c]nddoisaumaimul[imuguriure
teraliseformeaz~dinductulmezonefrotic
`ncazulduplica[ieiincomplete,ocazional,poate
ap~reareflux;urinacarecoboar~peunureter
reflueaz~ `n sus pe cel~lalt ureter `n timpul
fazeiderelaxareaperistaltismului
acestrefluxpoatedeterminainfec[iiurinare.

Fig.11. Duplica[iebazinetoureteral~ dreapt~.

Duplica[iacomplet~aparec]nddou~uretere
dreneaz~separatunsingurrinichi:
polulsuperiorrenaldreneaz~prinureter,ale
c~rui inser[ii sunt inferior #i medial dec]t
normal; acesta este adev~ratul ureter ecto
pic`nduplica[iacomplet~
acest ureter ectopic poate dezvolta uretero
celeectopice#iinser[iiextravezicale
mairar,ureterulectopicestesusceptibillaafacereflux
ureterocelele ectopice reprezint~ dilata[ii marcate ale submucoasei `n musculara
ureteruluilajonc[iuneaureterovezical~
ureterocelul poate determina distorsiuni #i celuilalt orificiu ureteral ipsilateral,
determin]ndobstruc[ie
ureterocelelelargi potprolaba#iobstruaorificiul ureteralduc]ndla dilata[ie urete
ral~bilateral~
ureteroceleleectopicesunt,`ngeneral,cauzedeobstruc[ieaureterului`namontede
el
ureterocelulectopicneasociatcuduplica[ieureteral~estefoarterar
a doua cauz~ de obstruc[ie `ntrun ureterocel ectopic este inser[ia extravezical~ a
por[iuniiluicaudale;pentruc~acestezonesuntexpusecroniclainfec[iisedezvolt~
frecventstenoza#ifibrozalanivelulureteruluiinferior,careducelahidronefroz~`n
amonte
la b~rba[i, inser[ia extravezical~ are rar ca simptom incontinen[a spredeosebire de
femei.
Duplica[iapoatefiunilateral~saubilateral~;duplica[iacomplet~areureterecarese
deschidseparat`nvezicaurinar~,ureterulcedreneaz~segmentulsuperiorrenalareorificiul
dedeschideremaidistaldec]tureterulcaredreneaz~segmentulinferiorrenal.
201

TratatdeUrologie

Anomaliideorificii

Ureterocelul
1.Ureterocelulectopic
2.Ureterocelulsimplusauortopticoritipuladult.

Celedou~formedeureterocelsedeosebescprinloculorificiuluiureteral,`nuretero
celulsimpludeschidereaeste`nvezicaurinar~,iar`ncelectopic`nuretr~.
C]nd vezica urinar~ este plin~, uretelocelul apare ca un defect transparent care
protruzioneaz~`ninteriorlaexamenulurografic;elesteodilata[iechistic~#iinvagina[iea
segmentuluiintramuralalureteruluic]ndsevars~`nvezicaurinar~,iarc]nddep~#e#te2cm
diametrucre#terisculdeasocierecuobstruc[ieureteral~#iformaredecalculi`ninteriorul
lui. El se pune `n eviden[~ prin UIV c]nd apare ca un bulb prolabat `n vezica urinar~,
dilata[ialocalizat~alumenuluiureteralesteplin~cuSC#i`nconjurat~depereteleureteral,
care este transparent, #i mucoasa vezical~. Aceast~ dilata[ie este `nconjurat~ de o
membran~fin~carereprezint~peretelestructuriinormale.
Radiologic este important de diferen[iat de pseudoureterocele care sugereaz~
anomaliicumarfiuncarcinomcuceluletranzitoriialveziciiurinaresaulitiaz~ureteral~.
`ntrunureterocelsimplu,bandatransparent~care`l`nconjoar~trebuies~nufiemai
groas~ de 2 mm #i trebuie s~ fie regulat~ #i uniform~. Neregularitatea sau `ngro#area
localizat~aacesteimarginitransparente,sugereaz~unadinbolileanteriordescrise#iindic~
unpseudoureterocel.Celemariprotruzioneaz~#iaproapeumpluvezicaurinar~.Aparcaun
defect rotund, transparent #i cu baz~ `ngust~, ce distorsioneaz~ umplerea cu SC a vezicii
urinare,care,frecventasociaz~hidronefroz~.

Fig.12.Ureterocelbilateral
(colec[iaCliniciideUrologieFundeni).

Orificiulureteralectopic
Estemaifrecventlafemei.Ureterul
se poate deschide `n uretr~, vagin, uter,
tuba uterin~ sau `n perineu, cu excep[ia
celorlacareureterulsedeschide`nuretr~
restul prezint~ incontinen[~ #i prezint~
frecvent infec[ii; se asociaz~ cu hidro
nefroz~#iduplica[ieureteral~.
La b~ie[i nu apare incontinen[a
pentru c~ orificiul ureteral este proximal
de sfincterul ureteral extern, deschiderea
se face `n uretra prostatic~, veziculele
seminale sau ductele ejaculatorii, hidro
nefrozafiindfrecvent~,darduplica[ianu.

Anomaliidepozi[ie
DiagnosticulsepuneprinUIVsaupielografieretrograd~.

202

Capitolul5.1.Explor~rileradiologicestandard

Ureterulretrocav
Ureteruldreptareuntraiectmedialdelajonc[iuneapieloureteral~#itreceposterior,
`nconjoar~ VCI, apoi coboar~ `n jos #i lateral, travers]nd articula[ia sacroiliac~ dreapt~ #i
vaseleiliacepentrua#iurmacursulnormal.DiagnosticulestepusprinUIVsaupielografie
retrograd~,careeviden[iaz~deplasareamedial~pesteliniamedian~apor[iuniisuperioarea
ureteruluimijlociu.Rezult~oform~deSaureterului,dat~de`ncercuireaVCI;dac~exist~
dubiisepoatefacecavografieinferioar~,deobiceiaparedilata[iaureteruluideasupraVCI.
Modific~riUIV:
ureterdrept
devia[iemedial~abrupt~
traiectmedialsprepedicululvertebral
form~depe#te
hidronefroz~.
Asociereacumalforma[iilerenale
Pozi[iianormalealeureteruluiapar`nrinichiulectopic,rinichiuldiscoid,`npotcoav~
sau`nectopia`ncruci#at~,iardiagnosticulestepusprinUIV,carevaeviden[ia:
`nrinichiulectopic,ureterulestemaiscurt
`nrinichiuldiscoid,saupancake,ambeleuretereintr~normal`nvezicaurinar~,dar
suntscurte#ideviatemedialpentruc~maselerenaledeformatesuntsituateimediat
inferiordepromontoriulsacrat
`nectopia`ncruci#at~ureterulrinichiuluiectopicaretraiectnormal`npelvis,darface
ocurb~caretraverseaz~liniamedian~pentruaintra`nrinichi
larinichiul`npotcoav~,jum~tateaproximal~areuntraiectlateral#ianterior,pentru
c~ pelvisurile renale sunt situate anterior #i lateral de masele renale, iar ureterele
distaleautraiectnormal.

Anomaliidestructur~

Stricturile
Majoritateastricturilorcongenitalesuntsituatelajonc[iuneapieloureteral~#ivezico
ureteral~,daracestestricturisepotdezvolta,defapt,oriundepetraseulureterului,celede
lanivelulJPUfiindcelemaifrecventecauzedehidronefroz~fetal~,iardiagnosticulestepus
deUIVsaupielografiaretrograd~.

Diverticulul
Aceast~protruzieureteral~caunsacesterezultatuldezvolt~riianormalea
mugureluiureteral`nvia[aintrauterin~;deobiceiestelocalizatlanivelulJPU,imediat
deasupratrecerii`npelvissaulaniveluljonc[iuniivezicoureterale.

Valvele
Adev~ratelevalveureteralecongenitalesuntanomaliiextremderare,iarcriteriilede
diagnosticsunt:
1) demonstrarea existen[ei anatomice a faldurilor transversale de mucoas~ ureteral~
carehistologics~con[in~benzidemu#chineted
2) modific~rile de uropatie obstructiv~ `n amonte de valv~, cu tract urinar normal `n
avaldevalv~
3) inexisten[auneialteobstruc[iidecauz~mecanic~saufunc[ional~.

203

TratatdeUrologie

Ureterulorb
Orificiulureteral`nvezicaurinar~estenormal,darureterulestepermeabildoarpeo
distan[~scurt~#ilumenulestemai`ngustdec]tnormal;ocazionalaceast~anomaliese`nt]l
ne#te pe unul din segmentele duplica[iei ureterale, diagnosticul fiind u#or de realizat prin
pielografieretrograd~.

Megaureterul
Tipic,megaureterulprimarducelaodilata[iemasiv~atreimiiinferioareaureterului,
`ns~`ncazurilesevere`ntregureterulestedilatat.Modific~rilesunteviden[iatedeUIV,care
va demonstra cum calicele `#i p~streaz~ forma #i aparent sunt nedilatate, f~c]nd
diferen[ierea de obstruc[ia ureteral~ `n care dilata[ia calicelor apare dup~ dilata[ia
ureterului, dar poate asocia alte anomalii ca policalicoza, megacalice care mimeaz~
obstruc[ia. Megaureterul `n propor[ie de 75% este unilateral, mai frecvent pe st]nga, iar
`naintedeapunediagnosticulfinaltrebuieexclusrefluxulvezicoureteral,diferen[ierecare
sefaceprincistografiemic[ional~.

Absen[amusculaturiiabdominale
Esteoanomalieac~reicauz~estenecunoscut~;asociaz~frecventdilata[iegenerali
zat~ a ureterelor #i sistemelor pielocaliceale #i uneori a uretrei prostatice; predomin~ la
b~rba[i, iar radiologic diagnosticul se pune pe pielografie retrograd~ sau cistografie, c]nd
exist~reflux,pentruc~func[iarenal~estesevercompromis~.

Anomaliilecongenitalealeveziciiurinare

Suntfoarterare;elerezult~dintroanomaliededezvoltareembriologic~atractului
urinar inferior din cloaca primordial~, iar anomaliile cu semnifica[ie radiologic~ sunt diver
ticulul,duplica[ia,extrofia,chistuldeurac~#iabsen[amusculaturiiabdominale.
Duplica[ia poate fi par[ial~ sau complet~. Este eviden[iat~ prin cistografie cu SC #i
poatefi`nplanfrontalsausagital.
Extrofiareprezint~absen[apereteluianterioralveziciiurinare#ial`ntreguluiperete
abdominal anterior adiacent; expune orificiile ureterale #i peretele posterior al vezicii
urinare;seasociaz~cuundefectdeoasepelvinedesepara[iepubian~larg~.
Chistuldeurac~comunic~cudomulveziciiurinare#iesteeviden[iatprincistografie.
C]nd aceast~ leg~tur~ nu este eviden[iat~, chistul poate fi pus relevat prin injectarea
tractului sinusului s~u ombilical, dac~ este prezent. Obliterarea por[iunii terminale ombili
caleaurac~iaparecaoproeminen[~plin~culichiddeladomulvezicalanterior#ipelinia
median~.
Absen[a musculaturii abdominale asociaz~ dilata[ia vezicii urinare #i a tractului
urinarsuperior;frecvent,eaasociaz~obstruc[iaprimar~acoluluivezical.
Diverticululrezult~dinobstruc[iacoluluivezicalsauobstruc[ieureteral~;celconge
nitalesteimens,stazaurinar~poateducelacalculisaucistit~,iar2%asociaz~carcinom.
Diverticulul este o hernie local~ a uroteliului #i submucoasei prin locurile slabe
prezentelanivelulveziciiurinare;`nmodnormal,acestehernieritinds~apar~l]ng~orificiile
ureterale,fiindocauz~probabil~astazeiurinare,obstruc[ieiureterale#irefluxuluivezico
ureteral.
Diverticulul mare poate determina efect de mas~ asupra vezicii urinare sau poate
deplasaoriobstruaureterelepelvine.
204

Capitolul5.1.Explor~rileradiologicestandard

Radiologic, apare ca o imagine adi[ional~


cu pere[i netezi, inelari, spre deosebire de vezica
urinar~ trabecular~, diverticulul comunic~ cu
vezicaurinar~printruncanalcarepoatefi`ngust
#i imperceptibil. Diverticulul se eviden[iaz~ prin
cistografie retrograd~, c]nd nu se vede `n faza
cistografic~ a UIV, drept protruzii sacciforme ale
peretelui vezicii urinare, `n general, `n rela[ie
apropiat~cuorificiulureteral.

Fig.13.Diverticulvezical.

Anomaliicongenitalealeuretreimasculine

Stenozelecongenitale
Stenozameatuluiuretralesteceamai
comun~anomalie.Stenozadealungul`ntre
gii uretre anterioare este foarte rar~, imagi
nea radiologic~ depinde de severitatea obs
truc[iei #i de dilata[ia secundar~ stenozei,
metodeledediagnosticfiinduretrografiamic
[ional~sauretrograd~.

Fig.14.Stenoz~uretral~
(uretrografiemic[ional~).

Valveleuretrale
Seg~sescaproapeexclusivlaniveluluretreiprostatice#isuntdedou~tipuri:
1) `n forma de vel~ (p]nz~) este format~ prin fald sau falduri proeminente care se
extinddelaverummontanumlapereteleanterolateralaluretreiprostaticedistale
2) `nformadediafragm~esteceamaicomun~,fiindlocalizat~l]ng~verummontanum.
Cistouretrografia mic[ional~ este cea mai fiabil~ metod~ de eviden[iere a valvelor
pentruc~`ntimpulmic[iuniisemanifest~efectulobstructivalvalvelor.

Obstruc[iaprimar~acoluluivezical
Cistouretrografiastabile#tec~aceast~anomalienueste,deobicei,primar~,cisecun
dar~leziunilorobstructivedistale,castenozameatal~sauvalveleuretrale.

Hipospadias
`n aceast~ anomalie, uretra se termin~ ventral #i proximal fa[~ de locul obi#nuit la
v]rfulglandului.Campbelldescrietreitipuri:
1) glandularsedeschidelanivelulfrenului
2) peniansedeschide`ntre#an[ulglandular#ijonc[iuneapenoscrotal~
3) penoscrotalsauperinealsedeschidelabazapenisului.

205

TratatdeUrologie

Stenozele meatale sunt comune `n ultimele dou~ forme #i asociaz~ l~rgirea


utricululuiprostaticcusepara[iasimfizeipubiene.

Epispadias
Este absen[a peretelui dorsal al uretrei. Embriologic, este considerat o form~ de
extrofie. Epispadiasul reprezint~ primul stadiu de extrofie. Este mult mai pu[in frecvent~
dec]t hipospadias, iar diagnosticul se pune prin uretrografie. Radiologic, se eviden[iaz~, de
asemenea,separareasimfizeipubiene.

Diverticulul
`nmajoritateacazurilorseasociaz~custenoz~uretral~,elestemaidegrab~dob]ndit
dec]tcongenital.

Chistul
Adev~ratulchistcongenitalesterar#iestelegatdeglandaluiCowper,glanduluretral
anterior sau utriculul prostatic. Radiologic, el este eviden[iat prin uretrografie, c]nd comu
nic~cuuretra.

Duplica[ia
Poate fi par[ial~ (canal uretral accesoriu), sau total~ (uretr~ dubl~), iar diagnosticul
estepusdeuretrografie.

Fistula
Fistulele congenitale uretrale anterioare se asociaz~ cu stenoze uretrale. Fistulele
uretralemembranoasesauprostaticesunt,deobicei,fistuleuretrorectale#iseasociaz~cu
imperfora[iedeanussauproblemedeintersex.

Anomaliicongenitalealeuretreifeminine

Anomaliileuretreilafemeisunt:
epispadias(calab~rbat)
ureterectopiccaresedeschide`nuretr~
diverticul
uretr~caresedeschide`nvagin.

Diagnosticulradiologicaltraumatismelorrenale,ureterale#ivezicale

Traumatismelerenale

Clasificareatraumatismelorrenale:
1. Contuziarenal~
2. Dilacerarearenal~
3. Fracturarenal~
4. Rinichiulmultifragmentar
5. Afectareapedicululuivascular.

Celedou~metodefolositepentruaevaluastarearinichilorposibiltraumatiza[isunt
UIV#iCTcusubstan[~decontrast.
206

Capitolul5.1.Explor~rileradiologicestandard

UIV trebuie folosit~ la pacien[ii cu traumatisme penetrante #i care necesit~ inter


ven[ie chirurgical~ imediat~; la ace#tia, UIV este folositoare pentru a eviden[ia leziunile
traumatice propriuzise, c]t, mai ales, pentru a stabili starea rinichiului contralateral. UIV
poatedarezultatefalsnegativealerinichiuluitraumatizatprinpenetrare.
UIVestefolositoarepentruaexcludeinjuriimajorecauzatedetraumatisme`nchise,
dac~esteprezent~hematuriemasiv~lapacien[iiinstabili;dac~urografiaintravenoas~este
normal~seexcludeuntraumatismrenalmajor.Totu#i,lapacien[iitraumatiza[i,UIVnupune
`neviden[~modific~rimaifine,inclusivextravazareadesubstan[~decontrast,diminuarea
nefrogrameisauefectuldemas~,caresunteviden[iabiledoarc]ndleziunilesuntmari.
C]ndUIVesteanormal~trebuief~cutobligatoriuCT,necesar`nclasificareatipuluide
traumatism, informa[ie foarte util~ `n stabilirea tratamentului. CT trebuie folosit ca gest
diagnostic de prim~ inten[ie pentru evaluarea st~rii rinichilor #i a celorlalte viscere
abdominale`ntraumatismele`nchise.

1)Contuziarenal~
Prezint~ edem intersti[ial #i hemoragie la nivelul parenchimului renal, iar rinichiul
afectateste,`ngeneral,m~ritdincauzaumfl~rii,darcuconturregulat,liniapsoasuluifiind
p~strat~.Deasemenea,rinichiulcontuzionatestehipofunc[ional,cupielografie`nt]rziat~,cu
persisten[anefrogramei#i,eventual,diminuareaintensit~[iisubstan[eidecontrast`ncalice
#iureter.Sc~dereaintensit~[iisubstan[eidecontrastrezult~dindimunuareacapacit~[iide
concentra[iearinichiuluicontuzionat.

2)Dilacerarearenal~
Se refer~ la o ruptur~ a parenchimului renal, care inevitabil duce la formarea de
urinom sau hematom perirenal, sau la ambele. Marca dilacera[iei este extravazarea de
substan[~decontrastsaucolec[iafluid~perirenal~.

3)Fracturarenal~
Reprezint~ o form~ sever~ de dilacerare renal~. `n aceast~ situa[ie dilacerarea se
extindecompletprintoat~grosimeaparenchimuluirenal,caredividerinichiul`ndou~sau
treisegmenteseparate.UIVpune`neviden[~acelea#imodific~ricaladilacera[ie,darariile
deextravazareasubstan[eidecontrastsuntmaimari.

4)Rinichiulmultifragmentar
Esteformaceamaigrav~dedilacerare,rinichiulfiindfracturat`ntreisaumaimulte
segmente separate. Rar, rinichiul func[ioneaz~ suficient de bine pentru ca UIV s~ pun~ `n
eviden[~ segmentele fracturate. Examenul este util doar pentru a evalua morfologic #i
func[ionalcel~laltrinichi.

5)Afectareapedicululuirenal
Este asociat~ cu dilacerarea legat~ de traumatismele `nchise, c]nd apare transec[ia
saudisec[iaartereisauveneirenaleprincipale.Transec[iapoateap~rea#i`ncazultrauma
tismelor penetrante. Orice eviden[iere a diminu~rii nefrogramei UIV la pacien[i cu
traumatismesaurinichiulmutridic~posibilitateaafect~riipedicululuivascular.Urografia
intravenoas~ poate pune `n eviden[~ o nefrogram~ `nt]rziat~ #i diminuat~, precum #i o
nefrogram~ periferic~, marginal~. Nefrograma periferic~ rezult~ din persisten[a perfuziei
cortexuluiexternprinarterele renalecapsulare,caresuntfoarte rarafectatedetransec[ia
arterei renale principale, ele plec]nd foarte aproape de originea ei. Rezultatul este opaci
fiereamareacortexuluiexternfa[~derestulrinichiuluicareestehipoperfuzat.
207

TratatdeUrologie

Traumatismeleureterale

Traumatismele ureterale #i cele ale pelvisului renal reprezint~ circa 1% din traum
tismeleaparatuluiurinar#i,spredeosebiredecelelalte,traumatismeleureteruluiaudrept
cea mai comun~ cauz~ traumatismele penetrante, care pot determina dilacerare sau tran
sec[ieoriundepetraiect.
Modific~rilevizibile`ndilaceraresunt:urinomul,extravazareasubstan[eidecontrast
#idiscontinuitateaureterului.
Mai pot fi traumatismele produse prin accelerare sau decelerare, care determin~
avulsia(smulgere)ureteral~.Celmaifrecventlocderupereestejonc[iuneapieloureteral~,
urmat~procentualdeavulsialacirca4cmdistan[~peureteruladiacent(ureterproximal)#i
apoiureterulmijlociu.
Clasic,radiologicexist~otetrad~careeste`nt]lnit~`navulsie:
excre[ienormal~desubstan[~decontrast
apari[ienormal~acalicelor
substan[~decontrastextravazat~laniveluljonc[iuniipieloureteralesau`n
alt~zon~deavulsie
nevizualizareaureteruluisubnivelulextravaz~rii.
Examenul UIV nu este cel mai fiabil `n diagnosticul avulsiei ureterale. Diagnosticul
definitiv de avulsie este pus prin pielografie retrograd~, c]nd substan[a de contrast extra
vazeaz~#i`ntrerupereaureteruluiesteevident~.

Rupturadevezic~urinar~

Aparefrecvent`ntraumatismelepelvine,darpoatefi#iocazionalspontan~.
Clasificarearupturilordevezic~urinar~seface`nfunc[iedeloculextravaz~rii:
intraperitoneal~
extraperitoneal~
ambele.
Caracterizarearupturiidevezic~urinar~esteurm~toarea:
Intraperitoneal:
- recesulpelvinlateralrecesulparavezicallateralsuperiordevezicaurinar~
- linia mijlocie a saculuiDouglas posterior devezica urinar~ #i anterior de
rectosigmoid
Extraperitoneal:
- spa[iul paravezical extins anterior #i superior de vezica urinar~, p]n~ la
nivelulombilicului
- spa[iulretrorectalsaupresacrat.
Fracturadepelvis,`nparticularatuncic]ndimplic~inelulososanteriorischiopubian,
trebuies~ridicesuspiciuneadeinjurieatractuluiurinarinferior.Injuriiledevezic~urinar~
apar`n7%dincazurilecusepara[ietraumatic~asimfizeipubiene#ifracturiderampubian.
Rupturaspontan~devezic~urinar~apare#ic]ndexist~oleziunecareafecteaz~pereteleei
ca `n tumori, cistit~, inflama[ia perivezical~, obstruc[ia la ie#irea din vezica urinar~, vezica
urinar~neurogen~sauafectareaveziciiurinaredup~radioterapie.
Diagnosticulradiologicsefaceprincistografie.
Cistografia standard se face cu umplerea cu 300400 ml de substan[~ de contrast
diluat~pentruadestindevezicaurinar~.`naintedecateterizareatransuretral~pentrucisto
208

Capitolul5.1.Explor~rileradiologicestandard

grafie trebuie eliminat~ injuria uretrei. Extravazarea substan[ei de contrast `n spa[iul


perivezical este indicatorul de ruptur~ extraperitoneal~. Fractura inelului osos anterior al
pelvisului`nso[e#teaceast~form~deruptur~aveziciiurinare`n90%dincazuri.Rupturase
produce la nivelul peretelui anterolateral al vezicii urinare, extravazarea substan[ei de
contrastfrecventsecolecteaz~aproapedevezicaurinar~#ipoateaveamarginineregulate,
descrisecaoflac~r~.Dac~esteviolat~diafragmaurogenital~,substan[adecontrastpoate
s~se`mpr~#tie`nperineu,s~fuzeze`ncoaps~sauscrot.
`n ruptura intraperitoneal~ delimitarea substan[ei de contrast extravazate este
f~cut~deorganeleintraperitonealeca,deexemplu,dec~treanseledeintestinsub[iresau
chiar de c~tre ficat. Substan[a de contrast extravazat~ `n spa[iul intraperitoneal se vede
omogen~,caunnor,seorganizeaz~,deobicei,laniveluldomuluiveziciiurinare,careeste
acoperitdeperitoneu.
Folosirea cistografiei pentru diagnosticul de ruptur~ de vezic~ urinar~ nu este f~r~
probleme; se creeaz~ ambiguit~[i de c~tre fragmentele fracturate, marginea coloanei etc.
Pentru a cre#te acurate[ea examenului vezicii urinare trebuie destins~ cu substan[~ de
contrast;aceast~distensieput]nduserealizaprininstilaredirect~desubstan[~decontrast
diluat~`nvezicaurinar~.

Traumatismeleuretrei

Injuriile uretrei masculine trebuie suspectate `n traumatismele pelvine, c]nd vezica


urinar~ este destins~ la examenul fizic #i c]nd se constat~ s]nger~ri din meatul uretral.
Cateterizarea transuretral~ a vezicii urinare f~r~ asigurarea prealabil~ a integrit~[ii uretrei
este ogre#eal~, pentru c~ poate completa o ruptur~ par[ial~ de uretr~ sau poate m~ri un
hematom.
Uretrografiaretrograd~esteperfectsigur~`ntraumatismelepelvine#iesteceamai
bun~ metod~ de a stabili leziunile uretrale la b~rba[i. Introducerea substan[ei de contrast
eviden[iaz~sediulsolu[ieidecontinuitate#istenozadatorat~hematomului.
Pentru diagnosticul leziunilor de uretr~ posterioar~ este foarte bun~ uretrografia
retrograd~`npozi[iioblice.
Leziunilecareproduccontuzie #idilacerare,dar carenuimplic~`ntreagagrosimea
pereteluiuretralserefer~latipulI,peuretrografieuretraaparenormal~,darelongat~.
TipulII,celmaicomun,esterupturaclasic~deuretr~careareloclav]rfulprostatei#i
care nu afecteaz~ diafragma urogenital~. Uretrografic, extravazarea substan[ei de contrast
estelocalizat~`nspa[iulretropubian,iaruretrabulbar~esteintact~.
`n tipul III, diafragma urogenital~ este rupt~ #i substan[a de contrast extravazat~
colecteaz~`nperineu,esterupt~nunumaiuretralav]rfulprostatei,ci#iuretrabulbar~.
Pel]ng~identificarealoculuileziuniiuretrografiaretrograd~eviden[iaz~#icaracterul
par[ialsautotalalleziunii.
C]nd apare extravazarea substan[ei de contrast din uretra posterioar~, iar vezica
urinar~nuseumpledeloccusubstan[~decontrast,dilacerareasaurupturaestecomplet~.
`ntipulII,leziuneapoatefipar[ial~saucomplet~,iar`ntipulIIIestecomplet~.Diferen[ierea
`ntredilacerareatotal~#iceapar[ial~esteimportant~pentruc~,`nrupturacomplet~,care
estededou~orimaifrecvent~,estemultmaiprobabils~seformezeostrictur~scurt~(mai
mic~de2cm)#idemulteoriseprefer~uretroplastia.
Leziuniledeuretr~anterioar~potfiurmareatraumatismelornepenetrantepelvine`n
care uretra bulbar~ #i corpi spongio#i sunt strivi[i de inelul anterior osos pelvin. Cea mai

209

TratatdeUrologie

frecvent~ cauz~ este cea iatrogen~ dup~ cateterizare sau instrumental. Ea poate fi
clasificat~`ntotal~#ipar[ial~.
Fig.15.Uretrografieretrograd~ceeviden[iaz~stricturi
uretralemultiplelaniveluluretreiperineale,calefals~#i
extravazareasubstan[eidecontrast
(colec[iaCliniciideUrologieFundeni).

`n ruptura par[ial~, extravazarea substan[ei


de contrast se vede `n timpul uretrografiei, dar
uneori uretra are continuitatea p~strat~ #i uretra
proximal~leziuniiseopacifiaz~.`nrupturatotal~la
loculextravaz~riisubstan[eidecontrastseobserv~
solu[ia de continuitate #i substan[a de contrast nu
p~trunde `n uretra proximal~. `n ambele situa[ii se
potopacifiacorpiicaverno#i#ivenelededrenaj.
Traumatismeleuretreisepotcomplicacustricturi.

Diagnosticulradiologicalmodific~rilordimensiunilorrinichiului

Radiologiaconven[ional~eviden[iaz~oseriedemodific~ricucaracternespecific,`n
afec[iunile inflamatorii renale. Le denumim nespecifice pentru c~ pot fi `nt]lnite #i `n alte
afec[iuni, precum cele de etiologie vascular~, chiar #i posttraumatice. De fapt, ceea ce
frapeaz~ pe o RRVS sau UIV este marirea sau reducerea `n dimensiuni ale rinichiului,
ad~ug]ndlaaceastaoseriedemodific~rialesistemuluipielocaliceal.
Deaceea,amgrupatacestsubcapitol`n:
rinichiulmicboselat
rinichimicunilateral,cuconturregulat
rinichimici,bilaterali,cuconturregulat
rinichimare,unilateral
rinichimarebilateral,
realiz]ndundiagnosticdiferen[ialdeterminatdemodificareadimensional~#i`nleg~tur~cu
etiologia.

Rinichiulmicboselat(cicatriceal)

Diagnosticuldiferen[ialalrinichiuluimicboselat:
A.Unilateral: nefropatiedereflux
interven[iechirurgical~renal~`nantecedente

B.Bilateral: a.cucalicenormale
infarcterenale

b.cucaliceanormale

nefropatieanalgezic~

nefropatiederefluxbilateral~

necroz~papilar~.
210

Capitolul5.1.Explor~rileradiologicestandard

Deobicei,rinichiulmic,boselat,rezult~prinboalaischemic~determinat~deocluzia
micilor vase ale rinichiului, prin nefropatia de reflux sau prin nefropatia analgezic~, iar cel
care rezult~ din boala micilor vase sau nefropatia analgezic~ este bilateral. Parenchimul
direct adiacent calicelui are o grosime normal~. `n plus, calicele au vasculariza[ia lor de
supleere proprie prin vase derivate direct din artera renal~ principal~ #i din arterele
ureterale.Deci,rinichiulmiccicatricealcucicatricecentrate`ntrecalice#icucalicenormale
indic~atrofierenal~prinocluziadearter~interlobar~.

`nschimb,rinichiimici,bilaterali,cucicatricecentratepestecalicesaucucalcific~ri
medulare, indic~ diagnosticul de nefropatie analgezic~, `n plus se g~sesc frecvent necroze
papilare. Nefropatia de reflux, uneori denumit~ pielonefrit~ cronic~ atrofic~, este cauza
major~ a atrofiei renale cu contur neregulat. Cicatricile parenchimatoase pot fi cauzate de
refluxulurineifieeasteril~sauinfectat~cubacterii.

Refluxul limitat la calice duce la umflarea calicelor f~r~ atrofia parenhimului.


Modific~riledeatrofieaparenchimuluiaparc]ndrefluxulseextindeprincanaleleluiBellini
`n medulara renal~. Majoritatea canalelor Bellini sunt ca o fant~ #i au rol protector
antireflux;eleprevinr~sp]ndirearefluxuluiurinar`nparenchim.Atrofiarinichiului`naceste
zoneaparedup~operioad~lung~derefluxmasiv.AltecanaleBellinisuntcirculare#iastfel
eleauunefectantireflux mai mic. Canalele circulareaparfrecvent`ncompozi[ia calicelor.
Acestecalicecompuseseafl~deobiceilapolii(inferior#isuperior)rinichiuluiceeaceduce
la o modificare radiologic~ tipic~ pentru nefropatia de reflux. La majoritatea pacien[ilor
primul#idecelemaimulteorisingurulsemnalnefropatieiderefluxaparelanivelulpolilor
superior#iinferiorairinichiului,menaj]ndpor[iuneamijlociealui.

Carezultatalatrofieiparenchimatoase#irefluxuluicroniccalicele`#ipierdforma
normal~concav~#idevincaom~ciuc~,cumarginileconvexe.Conturulneregulatparen
chimatos poate fi determinat de hipertrofia compensatorie din ariile neafectate ale
rinichiului care poate duce la exagerarea neregularit~[ii conturului indus de nefropatia de
reflux. Modific~rile tipice ale nefropatiei de reflux vizibile la examenul urografic sau pielo
grafiecuprindunrinichimic,boselat,cucicatricecentratepestecaliceanormale;cicatricele
sedezvolt~la`nceput`n(#ipotfilimitate)lapoliirenali,dar`ncazurileavansateimplic~tot
rinichiul.

Rinichiulmic,unilateral#ineted

Diagnosticuldiferen[ialalrinichiuluimicunilateralneted:

1.cucalicenormale:
stenozadearter~renal~
trombozacronic~aveneirenale
hipoplaziarenal~
hematomulsubcapsular
radioterapia

2.cucaliceanormale:
atrofiapostobstructiv~.

Stenozadearter~renal~
UIVarat~c~modific~rilesugestivedestenoz~dearter~renal~sunt:
rinichimicneted
cunefrogram~`nt]rziat~
pielogram~`nt]rziat~
211

TratatdeUrologie

dezvoltaretardiv~auneipielogramehiperdense
crest~turiureterale.

Calicele pot fi normale sau pot fi gracile datorit~ sc~derii fluxului urinar `n rinichiul
ischemic.Pentruc~SCestelivrat~odat~cufluxulsanguinexist~onefrogram~`nt]rziat~,dar
care poate sc~pa UIV datorit~ neefectu~rii de cli#ee suficient de rapid. De aceea, cel mai
importantsemnurograficestepielogramatardiv~,adic~opacifiereacalicelor#iapelvisului;
`nt]rzierea se datoreaz~ fluxului sanguin `ncetinit prin rinichi cu sc~derea presiunii SC prin
nefroni #i ductele colectoare. `nt]rzierea #i incapacitatea de reabsorb[ie a SC prin epiteliul
tubularduceladezvoltareapielogrameihiperdense;c]ndtimpulnecesarpasajuluiprintubii
colectoriaSCcre#te,reabsorb[iaapeicre#te#iconducelaocre#tereaconcentra[ieiSC`n
tubiirinichiuluiafectatfa[~deunrinichinormal.

Crest~turile ureterului #i ale pelvisului renal pot fi cauzate de m~rirea, l~rgirea


arterelorureteralecolaterale,caresem~rescpentruasuplinis]ngele`nrinichiulischemic
elesev~dcaamprenteextrinseci,permanente#iexcentricelanivelulpelvisuluirenal#ial
ureterului.

UIVnuesteceamaibun~metod~dediagnosticaHTArenale.

Diferen[aradiologic~cuobstruc[iaacut~ureteral~estef~cut~deprezen[ahidrone
frozei#iauneipielografiidiluate(comunaunefrograma#ipielogramatardiv~).

Trombozacronic~aveneirenale
Esteoalt~cauz~deischemierenal~#idetermin~modific~riradiologicecaremimea
z~stenozadearter~renal~,inclusivpielogramatardiv~,pielogramahiperdens~#iuretere#i
calicenormale,nedilatate.

Hipoplaziarenal~
Radiologic apare ca rinichi mic, neted, cu un num~r mic de calice; rinichiul mic
func[ioneaz~ normal #i are o grosime normal~ a parenchimului, totu#i prin defini[ie, are
doarc]teva(cinci)calice`nsistemulcolectorintrarenal,nicioalt~anormalitatenuestepus~
`neviden[~.

Hematomulsubcapsularsaupagekidneyesteunaltnumepentruatrofiarenal~.
Deoarecec~capsularenal~esterigid~,unhematomsubcapsulararterialexercit~o
presiune hidraulic~ asupra parenchimului renal #i dac~ nu este tratat duce la ischemie #i
atrofie parenchimatoas~. Rinichiul `#i men[ine forma reniform~ #i calicele apar normale
radiologic.

Radioterapia

Poateducelaischemierenal~dincauzaarteriteimicilorvaseindus~deradioterapie.
Aceast~arterit~determin~atrofieparenchimatoas~#imimeaz~oricealt~leziunevascular~
care determin~ ischemie, iar semnele radiologice de radioterapie sunt cele ale coloanei
vertebrale,#ianumeosteonecroz~,caredetermin~scolioz~.Urografiavaputeaeviden[ia`n
nefritadeiradiereprezen[auneinefrogramestriate.

Atrofiapostobstructiv~

Apare la cei cu obstruc[ie ureteral~ `ndelungat~. Obstruc[ia ureteral~ cu grad `nalt


trebuinds~persistecelpu[inos~pt~m]n~pentruadeterminaatrofiaparenchimatoas~,iar
dup~ `nl~turarea obstruc[iei unele func[ii renale se reiau, dar atrofia global~ #i ectazia
212

Capitolul5.1.Explor~rileradiologicestandard

rezidual~asistemuluicolectorr~m]nevidente.Radiologic,prinurografiesaupielografie,se
pune `n eviden[~ ectazia sistemului colector cu dilata[ii caliceale, ceea ce diferen[iaz~
aceast~entitatedealtecauzederinichimic,unilateral#ineted.

Rinichiimici,bilaterali#inetezi

Atrofia important~ bilateral~ este, de obicei, asociat~ cu insuficien[a renal~; `n


general,pacien[iisuntdiagnostica[iprinCTf~r~SC,ecografiesauIRM.

Insuficien[arenal~rezult~,deregul~,dinbolimedicalerenaledeetiologievariat~ca:
GNC
Nefrosclerozasecundar~HTA
Stenozabilateral~dearter~renal~
Nefropatiaanalgezic~
Necrozatubular~acut~.

Aspectele radiologice sunt nespecifice, ele `nt]lninduse `n toate bolile cronice ale
parenchimului:
rinichimici,deobicei
asimetrie`ntreceledou~fe[e#iceidoipoli
denivel~rifocalealeconturuluirenal
cre#tereagr~simiisinusuluirenal
reducereafunc[ieirenale`nfunc[iedegravitateabolii
atrofiaparenchimuluirenal.

Rinichiulmare,unilateral#ineted
Reprezint~unrinichinormalm~ritf~r~efectdemas~localizat,alc~ruicontureste
netedsauminimlobulat,`ntromanier~asem~n~toarecupersisten[alobula[ieifetale#inu
seeviden[iaz~maserenalelocalizatecares~afectezesistemulcolector.

Cauzeledem~rireunilateral~reniform~:
obstruc[ieureteral~
anomaliideduplica[ie#ihipertrofie
infiltra[iiparenchimatoase:a.celulare
- pielonefrit~
- pielonefrit~xantogranulomatoas~
- contuzie
- infiltra[ieneoplazic~

b.edem
- ocluziaacut~aveneirenaleRVT
- ocluziaacut~arterial~#iarterite.

Obstruc[iaureteral~
Este cea mai comun~ cauz~ de rinichi mare unilateral. `n faza de obstruc[ie acut~
rinichiul este congestionat #i edematos din cauza obstruc[iei de ie#ire a fluxului urinar;
injectareadeSCdemonstreaz~unrinichim~ritcuopacifiere`nt]rziat~asistemuluicolector
#ipersisten[auneinefrogramedense,iarpecli#eeletardiveseeviden[iaz~gradevariatede
hidronefroz~, care depind de severitatea #i durata obstruc[iei. La multe persoane, gradul
`nalt de obstruc[ie ureteral~ duce la nefrogram~ striat~ unde apar transparen[e lineare

213

TratatdeUrologie

extinsedelamedulararenal~lacortexulrenalpestudiilecuSC,carerezult~dincombina[ia
edemului intersti[ial #i staza urinei neopacifiate `n tubii renali adiacen[i tubilor umplu[i cu
SC. C]nd o nefrogram~ striat~ este prezent~ trebuie f~cute cli#ee tardive dac~ se
suspecteaz~ obstruc[ie acut~ pentru a se confirma prezen[a hidronefrozei, pentru c~
celelaltemodific~rinefrograficealeobstruc[ieiseasociaz~#icucelelalteentit~[i,cumarfi
tromboza de ven~ renal~. Astfel, diagnosticul de obstruc[ie se pune efectu]nd un examen
urografic.

Fig.16.

Nefrogram~dreapt~

tardiv~.

Fig.17.

Ureterohidronefroz~

st]ng~.

Anomaliilededuplica[ie
Suntafec[iunicaredetermin~m~rirearinichiuluicarezultatalcre#teriimaseirenale.
Potfiu#ordiagnosticateprinurografieintravenoas~,datorit~celordou~sistemecolectoare
`nconjuratedegr~simeasinusuluirenalcarelesepar~#iinvagina[iilorparenhimuluirenal;se
demonstreaz~ u#or cele dou~ jum~t~[i ale rinichiului, iar RRVS eviden[iaz~ umbra renal~
m~rit~,darf~r~modific~ridecontursauastructuriloradiacente.

Hipertrofiarenal~

Hipertrofia renal~ unilateral~ apare de obicei compensator, c]nd rinichiul contrala


teraleste absentsaunefunc[ional. RRVS vaeviden[ia umbrarenal~m~rit~,f~r~modific~ri
de contur sau modific~ri ale structurilor anatomice adiacente. Examenul urografic va
demonstra`ntimpulnefrograficunrinichicudimensiunicrescute,cufunc[ierenal~normal~,
f~r~altemodific~ri#iabsen[asaunefunc[ionalitatearinichiuluicontralateral.

Infiltra[iileparenchimatoase

Pielonefritaacut~
Esteoafec[iunecare,deobicei,nuesteundiagnosticradiologic,fiindundiagnostic
clinic, iar imagistica nu modific~ tratamentul. Ocazional, poate fi descoperit~ imagistic sau
este evaluat~ `n cazul `n care nu r~spunde la tratamentul antibiotic. Examenul urografic
frecventaparenormal,iar`n30%dincazuriUIVprezint~modific~ri,darnespecifice:
m~rirearinichiului#iacavit~[ilorpielocaliceale
214

Capitolul5.1.Explor~rileradiologicestandard

calicecuaspect`nm~ciuc~
`nt]rziereasausc~dereafunc[ieirenale
nefrogram~striat~
ureterohidronefroz~ (rar, dac~ pielonefrita este produs~ de bacterii ce produc
exotoxinecarescadtonusulmuscular,trebuieavut~grij~laposibilaeroarede
diagnosticdeobstruc[ieureteral~).

C]ndestevorbadeopielonefrit~cronic~acutizat~,urografiavapune`neviden[~o
margineestompat~acalicelor#ipapilei,precum#ihipotoniepielocaliceal~.

Fig.18.AspecturograficdePNAbilateral~,
cre#tereadimensiunilorrinichilor#i
contur#tersalsistemuluipielocaliceal
(colec[iaCliniciideUrologieFundeni).

Pielonefritaemfizematoas~
Ea reprezint~ o form~ rar~ de pielonefrit~ acut~ caracterizat~ de infec[ie renal~ cu
germeniceproducaer.Aeruldinpatulrenalseeviden[iaz~peoradiografieabdominal~pe
gol,aerulpoatefilocalizatsaudifuz.Dac~aerulestelocalizat`nsistemulcolectorintrarenal
sau `n ureter este pielit~ emfizematoas~ #i se vizualizeaz~ cu obstruc[ia ureterului #i
coexisten[ainfec[iei.

Pielonefritaxantogranulomatoas~(XGP)
Apare la pacien[ii cu istoric de infec[ii urinare cronice sau recurente, frecvent cu
Proteus sau E. coli, `n 80% din cazuri coexist~ nefrolitiaza, care pare s~ fie cauza. Cel mai
frecvent XGP rezult~ din obstruc[ia cronic~, de grad mic, asociat~ cu bacteriurie cronic~.
Histologic, XGP rezult~ din `nlocuirea parenchimului renal cu histiocite `nc~rcate cu lipide,
`nlocuireceducelam~rireareniform~arinichiului#idiminuareasauabsen[afunc[iei.
SemneleUIValeXGP:
m~rirereniform~,unilateral~renal~
hipofunc[ierenal~unilateral~
nefrolitiaz~
semnulcalcululuirupt/fracturat(estefoarteimportant#iestedeterminatde
apari[iaXGPcareducelainfiltrarearapid~#iexpansiunea`nparenchimulrenal,
ceeacedetermin~ruperea#idispersiacalculilorrenaliasocia[i).
Pielografia retrograd~ demonstreaz~ un sistem pielocaliceal foarte contractat.
Examenele radiologice cu SC pot pune `n eviden[~ prezen[a unei fistule extraurinare.
Modific~rileinflamatoriisev~d`nstructurilecontigue,inclusivspa[iulperinefretic,mu#chiul
psoas#ialtestructuriretroperitoneale.

215

TratatdeUrologie

Exist~oform~depielonefrit~xantogranulomatoas~focal~,careaparelafemeilede
v]rst~ medie cu infec[ii recurente, la care examenul urografic va eviden[ia o por[iune a
rinichiuluilocalizat~,hipofunc[ional~#iprezen[alitiazeicaresedatoreaz~infec[iei.

Contuziarenal~
`nfazaacut~poateducelam~rirearinichiului;aceastase`nt]mpl~`ntraumatisme#i
deci diagnosticul este indubitabil. UIV va eviden[ia un rinichi m~rit ca dimensiuni, hipo
func[ional, cu pielografie `nt]rziat~, cu persisten[a nefrogramei #i sc~derea densit~[ii SC `n
calice#iureterdatoratesc~deriicapacit~[iideconcentra[ieaurinei.

Ocluziaacut~aveneirenale
Este cauz~ de m~rire reniform~ unilateral~ prin infiltra[ie parenchimatoas~ de tip
edem. Urografic, se pune `n eviden[~ un rinichi cu dimensiuni crescute, hipofunc[ional, cu
excre[ie`nt]rziat~sauabsent~`ncazurilesevere,cuabsen[ahidronefrozei#iureternormal,
ceeacesugereaz~etiologiavascular~,precum#iprezen[auneinefrogramestriate.

Ocluziaacut~arterial~
C]ndinfarctulrenalesteglobalrinichiulsem~re#teacut#iestenefunc[ional,ceeace
va fi u#or de eviden[iat prin examen urografic. Se poate pune `n eviden[~ prezen[a unei
nefrograme marginale, circulare care indic~ ischemia parenchimului asociat~ cu o perfuzie
rezidual~ minim~ la nivelul cortexului periferic care este supleat de arterele colaterale
capsulare. Infarctul segmentar determin~ rar m~rirea rinichiului #i are acelea#i modific~ri,
doarc~lascar~maimic~.

Rinichiulmarebilateral

Trebuie f~cut~ diferen[a `ntre pacien[ii cu multiple mase renale care determin~
m~rireabilateral~arinichilordeceicum~rireadifuz~renal~`nabsen[amaselorrenale.

A.M~rireaneted~,reniform~
Cauzedem~rirerenal~bilateral~neted~:
nefropatiadiabetic~50%
GNA
bolidecolagen
vasculite
nefropatiadinSIDA
leucemia
limfomul
boalapolichistic~renal~autozomalrecesiv~
nefritaintersti[ial~acut~
hemoglobinopatii
acromegalia
nefropatiadeura[iacut~
amiloidoza
mielomul
boalaFabry
sindromulBartter
216

Capitolul5.1.Explor~rileradiologicestandard

boalaVonGierke.

B.M~rireabilateral~renal~cumultiplemase
Cauze:
boalapolichistic~renal~autozomaldominant~esteprincipalacauz~(ADPKD)
boalachistic~renal~dob]ndit~
multiplechisturisimple
limfomul
metastazele
tumoraWilms
sclerozatuberoas~
boalavonHippelLindau
oncocitoamemultiple
nefroblastomatoza.

Abcesulrenal

Este, de obicei, urmarea unui tratament


inadecvat al pielonefritei, ceea ce determin~
lichefiere central~ #i formarea de abcese intra
renale discrete. RRVS poate eviden[ia o m~rire
focalizat~ cu boselarea conturului renal sau poate
aveaoimaginenormal~.Examenulurograficpoate
eviden[iamasechisticecuperetegrossaupoatefi
un examen normal, nefiind metoda imagistic~ de
elec[iepentrudiagnosticuldeabcesrenal.

Fig.19.AspectUIVdeabcesrenaldrept
(colec[iaCliniciideUrologieFundeni).

Abcesulperirenal

Reprezint~prezen[auneiinfec[iilocalizate`nspa[iulperirenal,deobiceicaextensiea
unuiabcesrenal.Radiografiarenovezical~simpl~(RRVS)vaeviden[iaoseriedemodific~ri#i
anume:
#tergereaumbreinormaleapsoasului
obliterareaconturuluirenalextern
scoliozacoloaneivertebrale,scoliozafiinddeparteabolnav~
imibilitatearinichiului#iadiafragmuluideparteabolnav~
deplasarearinichiuluidinpozi[iasanormal~dec~tremasaabcesului
eventual,sepoateeviden[iaprezen[adebuledegazpeariadeproiec[iealeziunii.
Examenulurografic#ipielografiaretrograd~vorpune`neviden[~deformareapelvi
suluirenal,datorit~presiuniicreatedeabcesulrenalcareaspartcapsularenal~#ieventual
prezen[aunuitraiectsinuos`ntrepelvisulrenal#ispa[iulperirenalc]ndcapsularenal~este
spart~.Toateacestemodific~risunt`ns~semneindirecte,careridic~doarsuspiciuneadiag
nostic~.
217

TratatdeUrologie

Necrozapapilar~

Este consecin[a infarctului ischemic al piramidei renale, datorat insuficien[ei de


irigareapapileirenale,carepoateap~rea`narteritadiabetic~,uropatiiobstructive,dar#i`n
abuzul de fenacetin~ #i infec[ii urinare acute. Necroza piramidei nu se extinde la corticala
renal~,r~m]nelocalizat~lapapil~,`nspecial`ncentrulpapilei;deobiceiafecteaz~maimulte
papile#iestebilateral~.
Necrozapapilar~prezint~treiforme,#ianume:
subacut~
cronic~
central~, c]nd apar mici cavit~[i `n piramid~, iar `n interiorul lor se pot forma
calculi,rezult]ndimaginiasem~n~toarecurinichiulspongios,`nburete(CacchiRicci).
RRVS va eviden[ia doar sc~derea dimensional~ a rinichilor, `n formele subacut~ #i
cronic~,dincauzaevolu[ieidelunisauaniaacestorformedenecroz~papilar~.
Examenulurograficestenormal,darnupune`neviden[~modific~rialepapileip]n~
c]nd nu `ncepe deta#area papilei. Prima modificare radiologic~, ca #i `n cazul tuberculozei
renale,este#tergereaconturuluipapilei.Urm~toareamodificareesteseparareapapilei,care
apare pe m~sur~ ce necroza progreseaz~, iar substan[a de contrast p~trunde `n #an[ul de
delimitare determin]ndapari[ia unei imagini `n arcad~, `n V sau `n inel, papila r~m]
n]ndtransparent~.
Separareacomplet~apapilei#ideta#areaeidetermin~apari[iaurm~toarelormodifi
c~riradiologice:
cavitatecucontururiimprecisela`nceput,apoicupere[inetezi
`ncazuluneinecrozelimitaterealizeaz~ni#a,c]ndcavitateaestescobit~`npapil~
iar papila deta#at~ este eviden[iat~ ca un defect de umplere `n tija calicelui sau ca
multiplefragmente`nbazinet.
`n timp apar calcific~ri `n jurul papilei necrotice determin]nd o imagine radiologic~
caracteristic~, #i anume cea de s]mbure transparent, care reprezint~ papila necrotic~,
`nconjurat~deunstratopac,cauncalculinelar.Celmaidificildiagnosticdiferen[ialestecel
cutuberculozarenal~,c]ndexist~eroziunipapilaresaucavit~[i.

Tuberculoza

Tuberculozapoateafectarinichii,ureterele#ivezicaurinar~.

Tuberculozarenal~estefrecventrezultatuldisemin~riihematogenedelaoinfec[ie
pulmonar~, gastrointestinal~ sau osoas~, `n aceast~ situa[ie tuberculoza renal~ fiind
bilateral~. Cel mai frecvent bacilii ajung prin intermediul capilarelor la nivel glomerular,
progreseaz~ determin]nd ruperea glomerurilor `n capsula Bowman #i disemineaz~ dea
lungul lumenului nefronului `n arii mai bune pentru dezvoltarea bacililor, cum ar fi ansa
Henle. Localizarea medular~ determin~ apari[a modific~rilor radiologice vizibile. C]nd pro
greseaz~ implic~ sistemul colector determin]nd `ngust~ri #i neregularit~[i caliceale ale
infundibulului#ipelvisului,eviden[iabile`ntimpulurograficalUIV.

Odat~ cu spargerea necrozei de cazeificare `n sistemul colector se poate identifica


radiologiccomunicarea`ntrepelvissaucalice#icavitateaabcesuluidinparenchim.Concomi
tent, apare reac[ia fibroas~ `n aria lezional~, care este o reac[ie de ap~rare #i izolare a
infec[iei, determin]nd apari[ia de cicatrici #i unele calice nu se mai vizualizeaz~ urografic
datorit~strangul~riiinfundibulului,pelvisul#iureteruldevinneregulatecustenozeetajate.
218

Capitolul5.1.Explor~rileradiologicestandard

Exist~ situa[ia `n care ureterul se oblitereaz~ complet, izol]nd rinichiul, determin]nd a#a
numitaautonefrectomie.

`n clasificarea anatomopatologic~, primul stadiu al tuberculozei renale este nefrita


toxic~ tuberculoas~, care radiologic este similar~ cu oricare alt~ pielonefrit~. Urmeaz~
tuberculoza renal~ parenchimatoas~, `n care nu exist~ comunicare cu bazinetul #i care
prezint~dou~forme,#ianumetuberculozamiliar~#ituberculozanodular~.

Tuberculozamiliar~serefer~lagranula[iilecorticale#isubcorticaledintuberculoza
renal~cronic~,iardac~esterezultatulefrac[ieiuneiartereradiare,cup~trundereabacililor
`n lumen, determin~ un infarct renal prin arterit~ obliterant~ tuberculoas~. Tuberculoza
nodular~ difer~ de cea anterioar~ prin faptul c~ leziunile sunt noduli den#i, proeminen[i,
aderen[ilacapsul~,dedimensiunimaimari.

Tuberculozaarboreluiexcretor,cunoscut~#isubdenumireadetuberculoz~deschi
s~,cuprindetuberculozapapilei#ifornixului,aureterului,aveziciiurinare#iauretrei.

Ultima form~ anatomopatologic~ este tuberculoza ulcerofibrocazeoas~, care aso


ciaz~tuberculozadec~iexcretoriiculeziuniprofunde,fiindunadinformelecelemaigrave.
Aceastaprezint~maimulteforme#ianume:pionefrozatuberculoas~,rinichiulmasticpar[ial
sautotal,tuberculomulrenal,caverneledeterjate#iscleroatrofiatuberculoas~.

RRVSvaeviden[iaurm~toarelemodific~ri:
modific~rideform~#iconturrenal
calcific~ripeariadeproiec[iearinichiuluireprezent]ndcavernecalcificate,ganglioni
calcifica[i,rinichiulmastic
calcific~rialeureterului,care`nso[escrinichiulmastic
calcific~ri ale organelor #i ductelor genitale: deferent, epididim, prostat~, uter sau
ovarmastic.
Urografiaintravenoas~pentruapunemaibine`neviden[~modific~rilecaracteristice
tuberculozei renale se efectueaz~ minutat. Ea va pune `n eviden[~ trei tipuri de aspecte
func[ionale(unilateralsaubilateral):
secre[ia este prezent~ #i opacifierea intens~, realiz]nd a#a numitul rinichi prea
frumos
secre[iaesteprezent~,dar`nt]rziat~#iopacifiereaslab~
secre[iaesteabsent~.

Deasemenea,seeviden[iaz~tulbur~rideexcre[ierenal~.Primeletulbur~rideexcre
[iecareaparsuntceledinamice,careseexprim~prinhipotonie#ihipodinamiecedetermin~
dilata[ie #i staz~. Astfel, cel mai precoce semn de tuberculoz~ renal~ este caliectazia, care
reprezint~ dilata[ie caliceal~, izolat~, ea interes]nd fie un calice secundar, fie un grup de
calicesecundare;caliceleafectatprezent]ndaspectuldepetal~defloaresaudeamfor~.

Urmeaz~ apari[ia de tulbur~ri mecanice #i anume: distensia #i hipotonia mecanic~,


care au drept cauz~ o stenoz~, cu sediul fie pe un calice secundar, fie pe bazinet, fie la
jonc[iunea pieloureteral~ sau pe ureter. La nivelul arborelui pielic stenozele tuberculoase
suntmultiple,eventualasociatecuostenoz~debazinet.

Tuberculozadeschis~estecaracterizat~prinasociereadeleziuniulceratice(ulcera[ii,
caverne)culeziunicicatriceale,fibroase,realiz]ndformeleulcerofibrocazeoase.Formele`n
care predomin~ leziunile distructive ulcerocazeoase debuteaz~ cu ulcera[ia, se extind prin
cavern~ #i sf]r#esc prin pionefroz~. Cele predominant fibroase produc stenoze de calice,
bazinet,retrac[iesegmentar~,stenozeureterale,pericistit~retractil~.

219

TratatdeUrologie

Cavernaesteocavitateneregulat~,estompat~,carecomunic~cuuncalice,leziunea
poatefiunic~saumultipl~.Stadiulcelmaiavansatalleziunilorulcerativeestetransformarea
unei p~r[i sau a `ntregului parenchim renal `ntro cavitate purulent~ anfractuas~ care
reprezint~pionefrozabacilar~.Excluziacaliceal~seproduceprinobstruc[iatijeiunuicalice
principal sau secundar. Aspectul urografic de UIV respirat~ este un aspect des `nt]lnit `n
tuberculozarenal~,`ncareconturulcalicelor#iuneoriabazinetuluiesteestompat.Expresia
urografic~ a ulcera[iilor este aspectul neregulat #i estompat al contururilor calicelor sau
bazinetului.Stenoza,caexpresiealeziunilorfibroase,esteeviden[iat~urograficprinconse
cin[aei,#ianumedilata[iasegmentar~supraiacent~,eaput]ndafectaat]tcalicele,bazinetul,
c]t#iureterul.C]ndstenozaestecomplet~cavit~[ilesituate`namontedeeasuntexcluse
urografic.Dilata[iasecundar~stenozeidelanivelulcalicelordetermin~oimagineurografic~
caracteristic~numit~`nfloaredemargaret~.

Examenulurograficvaeviden[iadreptmodific~rirelativcaracteristice:
eroziunile,careaparcucontururi#terse,neregulatelanivelulregiuniipapilocaliceale
ulcera[iile care apar ca opacit~[i adi[ionale de form~ neregulat~, de dimensiuni
variabile,unicesaumultiple,lanivelulsistemuluipielocaliceal
amputa[ia, care este secundar~ stenozei complete #i conduce la dispari[ia din
imagineaurografic~aunuiasaumaimultorcalicesauaregiuniipapilocaliceal~.
Tuberculozaureteral~seexprim~urograficprinmultiplestricturi,carealterneaz~cu
dilata[ii;deasemenea,potexistacalcific~ri`npereteleureteral.
Tuberculoza vezicii urinare se exprim~ printro cistit~ tuberculoas~, `n care cisto
grafia eviden[iaz~ de obicei o vezic~ urinar~ mic~,contractat~ dat~ de cicatricile extensive
care apar `n infec[iile bacilare. Dac~ interesarea vezical~ nu este uniform~, apare o
deformare asimetric~, care poate simula o leziune tumoral~. RRVSul #i urografia pot
eviden[iacalcific~rimarginalealepereteluivezical.Vezicaurinar~mic~#ineregulat~poate
fi `nso[it~ de stricturi ureterale care determin~ dilata[ii supraiacente, de obicei la nivelul
ureteruluidistal,toateacestemodific~riput]ndfieviden[iate`ntimpiiurograficitardivi.

Fig.21.Rinichidreptmastic.
Fig.20.Tuberculoz~renal~dreapt~.
220

Capitolul5.1.Explor~rileradiologicestandard

Diagnosticulradiologicallitiazeiaparatuluiurinar

Calcific~rile pot fi localizate la nivelul oric~rui segment al aparatului renourinar.


Existen[alornuesteconsecin[aobligatorieauneibolilitiazice.Prezen[aunorcalcific~ricu
sediulpeproiec[iarinichilorsauac~ilorurinareextrarenalepoatesemnificaexisten[aunor
procesepatologicediverse.Astfel,potfi`nt]lnitecalcific~rirenale`ntuberculoz~,`ntumori,
`ns~exist~#icalcific~rideetiologievascular~.Elepotaveaformediverse,dardeobiceisunt
mici,pulverulente,saulineare,scurte,rectilinii, oricurbe.Asociereaaltormodific~riradio
logice faciliteaz~ diagnosticul etiologic al unor asemenea calcific~ri. `n cazul calcific~rilor
localizate`npelvis,decelemaimulteori,doarUIVpoatetran#aapartenen[alorlaaparatul
urinarinferior.Elepotfivasculare,fleboli[i,saupotapar[inedevezicaurinar~,deorganele
genitalefemininesauprostat~lab~rba[i.

Nefrocalcinozamedular~

Este o afec[iune considerat~ mai comun~ dec]t cea cortical~. Cauzele care pot
determinanefrocalcinozarenal~sunt:
rinichiulspongiosmedular(cumedularaspongioas~/`nburete)
hipercalcemia
acidozarenal~tubular~
necrozapapilar~
tuberculoz~,hiperoxaluria
administrareacronic~afurosemidului(rar).

b.
a.

Fig.22a,b.Nefrocalcinoz~:RRVS#iUIV(colec[iaCliniciideUrologieFundeni).

Hipercalcemia
Apare`ntroseriedeboliprecum:
1) hiperparatiroidismul

221

TratatdeUrologie

2)
3)
4)
5)

sarcoidoza
intoxica[iacuvitaminaD
sindromullapteluialcalin
st~rineoplazice.

Hipercalcemiapoateduceladepozitemetastaticedecalciu`nalte[esuturinormale;
aceast~ rupere a echilibrului metabolic duce la nefrocalcinoz~ medular~, iar ca rezultat al
hipercalciurieipacien[iivoraveaoinciden[~crescut~aurolitiazei.
PeRRVScalcific~rilesuntmici,infracentrimetrice,pulverulentedeintensitatemare.
Pentru c~ este o boal~ sistemic~, calcific~rile sunt simetrice #i difuze, implic]nd toate
piramidele renale #i, `n plus, pentru c~ nefrocalcinoza este frecvent asociat~ cu o boal~
medical~renal~cronic~,rinichiiapardeobiceimaimicidec]tnormal,darnetezi(regulat).
`n acidoza renal~ tubular~, afec[iune care are mai multe subtipuri, nefrocalcinoza
medular~sedezvolt~`nsubtipulI,acidozarenal~tubular~distal~.Ace#tipacien[idezvolt~o
insuficien[~ renal~ progresiv~ #i se asociaz~ frecvent cu urolitiaz~, fiind o boal~ care are
valorianormaldemicidecitra[i`nurin~,cunoscutfiindfaptulc~citratulesteuninhibitoral
urolitiazei,#iacestdeficitexplic~dezvoltareaurolitiazei#ianefrocalcinozeimedulare.
Prezumtiv,nefrocalcinozamedular~aparecaurmareahipercalciurieicronicecombi
nat~cudeficituldecitrat.
Radiologic se vor eviden[ia calcific~ri medulare, care sunt sunt simetrice #i difuze,
implic]nd toate piramidele renale din ambii rinichi; ace#tia av]nd dimensiuni #i contururi
normale.

Rinichiulspongiosmedular
Este cea mai comun~ cauz~ de nefrocalcinoz~ medular~, fiind o boal~ congenital~,
care se asociaz~ cu un risc crescut de urolitiaz~ #i are un risc u#or crescut de pielonefrit~
datorit~stazeiurinaredintubiiectazia[i.
Este cunoscut~ #i ca ectazia tubular~ renal~ benign~, frecvent implic~ un num~r
limitatdepiramide,mairarimplic~toatepiramidele.
Ectaziaducelastaz~urinar~#iprecipitareacalciului#iaaltorminerale.
C]nd apar calcific~rile sunt de obicei rotunde, multiple, dispuse radiar, plec]nd din
papilarenal~,fiindvizibileperadiografiarenovezical~simpl~.
Pentru c~ aceste calcific~ri sunt con[inute `n interiorul tubilor ectazia[i, ele sunt
mascatec]ndesteexcretat~SC`ntimpulUIV,totu#iumbralorpares~devin~maimare,s~
creasc~peradiografiedup~injectareadesubstan[~decontrast,acestaestesemnulclasicde
calculicarecresc.
Discreteleectaziitubularesev~dcaopacit~[iliniaresauchisticedup~injectareade
substan[~decontrast,elesev~d#i`nabsen[acalcific~rilormedulare.
Lamajoritateapacien[ilor,rinichiiaudimensiuninormale,darpoateap~ream~rirea
bilateral~arinichilor`nrinichiulspongiosmedular,iarungrupmicasociaz~hemihipertrofie,
decim~rireaunilateral~arinichiului.

Nefropatiaanalgezic~
Esteoafec[iunecarepoatecauzanefrocalcinoz~medular~,eaestedeterminat~de
ingestiacronic~deantiinflamatoriinesteroidiene,poatecoexistanecrozapapilar~.
Radiologic,UIVpune`neviden[~rinichimici,frecventbosela[i#irarregula[i,bilate
ral. Secre[ia poate fi normal~, simetric~ sau asimetric~. Pot ap~rea modific~ri caliceale
caracteristicenecrozeipapilare.
222

Capitolul5.1.Explor~rileradiologicestandard

Hiperoxaluria
Eaesterezultatuluneibolimetaboliceenterohepaticeceducelacre#tereasecre[iei
urinaredeoxala[i,determin]ndformareacalculilordeoxala[i#inefrocalcinozamedular~,rar
poatedetermina#inefrocalcinoz~cortical~.

Tuberculozarenal~
Asociaz~calculiaitractuluiurinar`naproximativ10%dincazuri.
Aceast~ form~ de tuberculoz~ secundar~ `ncepe `ntrun singur rinichi, de obicei la
niveluluneisingurepapilerenale;cuc]tinfec[iasedezvolt~,easeextindelacalicelerenal,
determin]ndnecrozapapilar~,iarinfec[iasepoateextindedealunguluroteliuluidetermi
n]ndini[ialinflama[ie,apoifibroz~.
Astfel,radiologicsedezvolt~hidronefroza#ieventualautonefrectomia,#idac~apar
calcific~rile,suntfocale#iunilateralecudispozi[ienebuloas~,pulverulent~#iaparpelocul
pieliteiacutesaumodific~rilortardivedefibroz~.

Nefrocalcinozacortical~
Cauzelecaredetermin~apari[iaacesteiafec[iunisunt:
Glomerulonefritacronic~(GNC)
Necrozacortical~acut~
Hiperoxaluria
SindromulAlportrar
Rejetulcronicdetransplantdestulderar.

GNC
Este cea mai frecvent~ cauz~ `n apari[ia nefrocalcinozei corticale: asociaz~ insufi
cien[~renal~cronic~,iarexamenulUIVeviden[iaz~marcat~atrofierenal~,opacit~[ilerenale
fiind de mici dimensiuni, iar raportul corticomedular este mult diminuat, rinichiul prezen
t]nd`ns~contururiregulate,dimensiuninormalesau,eventual,dedimensiunimaimici.
Peosecven[~UIV,raportulcortical~/medular~sepoateapreciautiliz]ndliniainter
papilar~aluiHodson,careune#tepunctelecelemaiextremealecalicelor.
Raportul dintre distan[a `ntre linia Hodson #i diametrul transvers al rinichiului
constituieindiceleparenchimatos.
RRVS va pune `n eviden[~ calcific~rile care se dezvolt~ `n cortexul renal, fiind mici
nebuloase:eleaparinconstant#ilaunnum~rmicdepacien[i.

Necrozacortical~acut~
Este o alt~ cauz~ major~ de apari[ie a nefrocalcinozei renale: ea este rezultatul `n
principalalhipotensiuniisevere,carepoateap~reacaurmareaunorcomplica[iilana#tere
ca sepsisulsau hemoragiasever~, dar mai poate ap~rea #i ca urmarea ingestiei de nefro
toxice.Laace#tipacien[iinsuficien[arenal~cronic~esteinevitabil~,iarcalcific~rilecorticale
suntconsecin[anecrozeicorticale.
Modific~rileradiologice,inclusivcalcific~rile,suntidenticecuceledinGNC.

Urolitiaza
Esteceamaicomun~cauz~desidromobstructiv,iar90%dincalculiitractuluiurinar
suntradioopaci,respectivvizibilipeRRVS.

223

TratatdeUrologie

`nfunc[iedestructur~,calculiisuntmaiintenssaumaipu[invizibiliradiologic,eifiind
clasifica[idup~cumurmeaz~:

Clasificareacalculilor
defosfatcalcic
oxala[i#ifosfa[idecalciu
oxalatdecalciu
struvit~
cistin~
aciduric

%
10
40
30
1
10
10

radioopacitatescar~04
4
34
3
23
1
0

Majoritateacalculilorsuntunamestecdeoxalat#ifosfatdecalciucudensitatemai
mic~.
Calculiidinfosfatcalcicpur#idin monohidratsunt ceimaiden#i pevolumcalculi,
fiind cei mai radioopaci. Acest lucru este important deoarece calculii puri de fosfat calcic
r~spundmaipu[inlaESWLdec]tceilal[icalculi.
Calculiicon[in]ndoxalatdihidratdecalciuprezint~frecventspiculi;suntconsidera[i
fragili#isuntfragmentatu#orcuESWL.
Calculii de struvit~ (amoniofosfat de magneziu) au o opacitate sc~zut~ sau pot fi
complet radiotransparen[i. Ace#ti calculi se formeaz~ par[ial ca rezultat al infec[iilor cu
bacterii care secret~ ureaz~. Aceast~ enzim~ determin~ alcalinizarea urinei favoriz]nd
formareadecalculi.Princre#terealor,eipotdeveniramifica[i,mul]ndarborelepielocaliceal.
Fosfatulcalcicsepoatedepunepestestruvit~#iastfelaparcalculiistratifica[i.
Calculii de cistin~ nu con[in calciu #i pot fi slab radioopaci datorit~ con[inutului `n
sulf.Eisuntmultmaipu[inopacidec]tceidecalciudeacelea#idimensiuni#iauodensitate
omogen~;suntdescri#icafiindsimilarigeamuluimat.Nusuntfragmenta[iu#ordeESWL
#isuntconsidera[iceimaipu[infragilicalculiaitractuluiurinar.Potfirugo#i,prezent]ndun
conturnet,darfinneregulat.
Calculii radioopaci sunt u#or detectabili pe RRVS. Ei se constituie ca opacit~[i cu
conturregulat,bineprecizat,saucuconturneregulat,chiarcumicispiculi.Laformarealor
calculiiiauformacon[in~torului.
Dinaceast~cauz~,calculiiculocalizarebazinetal~iauforma,maimultsaumaipu[in
exact~,abazinetuluicuprelungiri`ntijelecaliceale.
Calculii mici, infracentimetrici, cu sediul `n calice, au o form~ rotund~ sau rotund
ovalar~.Calculiipotfiunicisaumultipli.
Calculii renali multipli pot, prin cre#terea lor `n dimensiune, s~ conflueze. Ace#tia
suntcalculiirenalicunoscu[isubtitulaturadecalculicoraliformi.
Calculiiureteraliau,deobicei,oform~maialungit~,darpotfi#irotunzisaurotund
ovalari.
Localizarea calculilor pe o RRVS se poate face doar aproximativ. Pentru calculii cu
localizare bazinetal~ se utilizeaz~patrulaterul Bazy Moyrand. Acestaseconstituie `ntre
dou~ linii transversale care trec prin corpurile vertebrale L1, respectiv L2 #i dou~ linii
verticale,unamedian~,trec]ndprinapofizelespinoasealevertebrelor#ialtaparamedian~,
la circa 6cm de prima. Atunci c]nd calculii sunt situa[i `n pelvis, c]nd se suspicioneaz~
existen[aunuicalculintramural,seutilizeaz~patrulaterulRobertGayet.Acestpatrulater
seconstituie`ntredou~liniiorizontale,unatrec]ndprinmargineasuperioar~aacetabulelor
#i alta prin fosetele ligamentului rotund ale capetelor femurale. Liniile verticale ale
224

Capitolul5.1.Explor~rileradiologicestandard

patrulaterului sunt linia median~ #i liniile care tec prin marginile interne ale g~urilor
obturatorii.
Structuracalculilorestedeobiceiomogen~.Exist~#icalculicustructur~stratificat~.
UIV are rolul de a preciza sediul calculilor, existen[a #i gradul de obstruc[ie deter
minat de ace#tia. Pe UIV calculii determin~ o lacun~ cu contur regulat. Lacuna reproduce
formacalculilor#iajut~`nstabilireadimensiuniloracestora.
Dilata[ia c~ilor urinare permite stabilirea gradului de obstruc[ie. Ca semne radio
graficesemaipoateconstatanefrograma`nt]rziat~,darchiar#ionefrogram~maidens~.`n
cazulcalculilordemicidimensiuni,neobstructivi,situa[i`nc~ileurinareintrarenale,ace#tia
potfi`nneca[i`nsubstan[adecontrast.
10% din calculi sunt radiotransparen[i pe RRVS #i nu pot fi decelabili prin aceast~
metod~.Ace#ticalculisuntforma[idinaciduricsauxantin~,oriaumatricenemineralizat~.
Dac~exist~osuspiciunedelitiaz~urinar~,cuoRRVSnormal~,`nlipsaecografieisepoate
practicaUIV.
UIV poate preciza indirect prezen[a calculilor radiotransparen[i. Aser[iunea de
indirect deriv~ din aspectul radiologic determinat de calcul. Imaginea este de defect de
umplere,olacun~carereproduceformacalculului,d~dimensiunealui#istabile#tegradul
deobstruc[ie.Lacunanueste`ns~patognomonic~pentrucalculiiradiotransparen[i.

Fig.23.

Calculcoraliform

drept

radioopac

(RRVS).

Fig.24.
Calculcoraliform
bilateral.

Fig.25.Calculiureterovezicali.

Fig.26.Calculureteralpelvinst]ng.

225

TratatdeUrologie

Fig.27.
Litiaz~coraliform~
dreapt~dincistin~
(ClinicadeUrologie
Fundeni).

Fig.28.
Litiaz~
bazinetal~
dreapt~
radioopac~.

Fig.29. Calculbazinetaldreptradioopac.

Altedefectedeumplere

Defectele de umplere, de etiologie diferit~ de cea litiazic~, pot, prin caracterele lor
radiologice, furniza informa[ii privind sediul parietal al leziunii. Defectele de umplere
lacunare,caresuntcomplet`nconjuratedeSC,reprezint~proceseintraluminaletipice.Dac~
leziunilesuntinseparabiledemucoasaureteral~,darfacununghiascu[itcumucoasa,sunt
leziuniledemucoas~tipice.Leziunileinseparabiledemucoas~,darcarefacununghiobtuz
frecventsuntleziunisubmucoasesauintramurale.Leziunilecarefacunghiobtuz#iasociaz~
deviere de ureter sunt determinate de procese extrinseci care amprenteaz~ excentric
ureterul. Aceste semne indirecte trebuie obligatoriu confirmate de tehnici imagistice com
plementare;astfel,pentruleziunileprobabilextrinseci,ceamaibun~metod~deexplorare
226

Capitolul5.1.Explor~rileradiologicestandard

imagistic~esteCTsauIRM;pentruevaluarealeziunilordemucoas~,ceamaibun~esteendo
scopiaintraluminal~.

Defectedeumpleref~r~leg~tur~cuuroteliul

Cheaguriledes]nge
`ngeneral,provindins]ngerarearenal~.Cheagurileureterale`ngeneralauoform~
alungit~,ca#iformaureterului.Elepotdeterminaobstruc[ieureteral~cusimptometipice
de colic~ ureteral~. Cheagurile de s]nge apar diferit la examin~ri repetate, modific]ndu#i
dimensiunile#ichiarforma,iarrezolu[iacomplet~apare`nc]tevazile.

Necrozapapilar~
Aparefrecventlabolnaviidediabet,cuanemiicucelule`nform~desecer~(falci
form~),saudup~abuzdeanalgezice.Poateafectaunsegmentsautoatepapilele.PeRRVS
potfivizualizatemicicalcific~riinelare,cudiametrede56mm.LaexamenulUIV,tipicpapila
are o form~ triunghiular~, av]nd contururi nete, bine definite. Pot ap~rea mici plusuri de
umplere `n aria papilar~. Calicele pot fi alungite, av]nd contur fin, neregulat. Prezen[a
defectului de umplere ureteral asociat cu modific~rile de necroz~ papilar~ sugereaz~ o
papil~sludged.

Conglomeratedefungisaudetritusurifungice
Sunt produse mai ales `n infec[iile cu Candida sau Aspergillus. Tipic apar la imuno
deprima[i sau la cei cu diabet. Diagnosticul nu este radioimagistic, ci este confirmat de
urocultur~.Depozitelefungicepotduceladefectedeumplere`ncalicesauuretere.Aspectul
radiologic nu este patognomonic. Conglomeratele fungice determin~ apari[ia unor defecte
deumplerecare`ncaliceaparcam]n~`nm~nu#~,pentruc~tinds~iaformacavit~[ii`n
careseafl~,iarSCle`nconjoar~caunstratsub[ire`ncalice.Laniveluluretereloraspectul
radiologicestesimilarcuceldeterminatdecheaguriledes]nge.

Buledeaer
Potap~readup~investigarearefluxuluiureteral,c]ndbuledeaerpotreflua`nureter
sau`nsistemulcolector.Elepotfiintroduseprininstrumentesauprinfistulecucolonulsau
fistulecutanate.Buledeaermaipotfiprodusedeinfec[iicugermenicareproducaer.Acest
tipdeinfec[ie(pielitaemfizematoas~)poatefiprodus~deE.coli,Proteus,Klebsieladar#ide
anumi[i fungi. Spre deosebire de pielonefrita emfizematoas~ aerul este limitat la nivelul
ureterului #i sistemului colector renal. Diagnosticul prin metode radiologice conven[ionale
estedificil,elfiinddedomeniultomografieicomputerizate.

Proceseleextrinseciadiacente
Potdeterminadefectedeumplere.Celemaifrecventesuntdeterminatedepatologia
vascular~. Vasele segmentului sau cele de vecin~tate care `ncruci#eaz~ produc frecvent
amprenteextrinsecipeureter.Defecteledeumpleredeetiologievascular~celemaicomune
suntsecundareectazieivaselor ureterice dinstenoza de arter~renal~, din tumorile renale
hipervascularesaumalforma[iiarteriovenoase.Deasemenea,defectedeumplereureterale
potfidate#idem~rireavenelorgonadale,carepoateducelaamprenteureterale,lafelca
#i`ncazulvaricelortesticularesauovariene,`nsindromulveneiovariene#i`ntromboflebita
veneigonadale.

227

TratatdeUrologie

Defectedeumplereprinleziuniuroteliale

Edemulureteral
Poatefideterminatprinirita[iedirect~,fieprinpasajulunuicalcul,fieiatrogenic,prin
folosirea instrumentelor. Poate duce la apari[ia unor pustule mucoase cu aspect bulos,
determin]nd defecte de umplere micronodulare, sau uneori poate fi striat, determin]nd
defectedeumplereliniare.

Leucoplakia
Esteoleziunerar~urotelial~determinat~deometaplaziescuamoas~premalign~a
uroteliului care rezult~ din irita[ia cronic~ a acestuia. Tipic ea se asociaz~ cu istoric de
urolitiaz~sauinfec[iicronicealetractuluiurinar,cumarfischistostomiaza.Celmaifrecvent
se`nt]lne#telanivelulveziciiurinare,darpoateap~realanivelulureteruluisausistemului
colectorrenal.Leziunilesubmucoasesaumuralepotduceladefectedeumplerealeurete
rului.Radiologicsepotconstatafineneregularit~[ialeconturului,absolutnecaracteristice.

Ureteritachistic~saupieloureteritachistic~
Defectele de umpleredinaceast~ afec[iuneaudreptcauzeleziuni postinflamatorii
uroteliale. Se asociaz~ cu infec[ii cronice ale tractului urinar. `n evolu[ia afec[iunii se
constituiecolec[iifluidesubmucoasesterile,determinatedeinflama[iaintramural~,careduc
la `nchistare #i extensie submucoas~ a epiteliului tranzi[ional. Aspectul radiologic tipic al
acestorleziuniestededefectedeumpleremulticentrice,cuconturnet,regulat#irotunde.

Hemoragiaintramural~
Aspectulradiologicrealizatdeaceast~afec[iuneestesimilarcuceldinpieloureterita
chistic~,iardiagnosticulestesugeratdeistoriculbolii.Pacien[iisuntdeobiceisubtratament
anticoagulantsausufer~deocoagulopatie.Clinicaasociaz~celmaifrecventhematurie.

Malacoplakia
Esteoalt~afec[iunerar~urotelial~.Leziuneaesteintramural~,careaparesecundar
uneiinfec[iicronicedetracturinar.Determin~rilesuntmultiple,cani#tepl~ci,#isuntdate
de macrofage modificate, care realizeaz~ o fagocitoz~ incomplet~. Microscopic se eviden
[iaz~ macrofage defecte care au fagocitat incomplet E. coli; incluziile intracelulare con[in
acestebacterii#isuntcunoscuteca#icorpiMichaelisGutmann.Prezen[alorpunediag
nosticul. Aceste leziuni tind s~ regreseze spontan dup~ rezolvarea infec[iei. Poate interesa
vezicaurinar~,ureterul,sistemulcolector#iparenchimulrenal.Producedefectedeumplere
focale`nlumenulureteral,f~r~caracteredespecificitate.Leziuniletinds~impliceureterul
pelvinadiacentveziciiurinare,`ntimp ceendometrioza implic~ureteruladiacentligamen
teloruterotubale,caresuntlac][ivacentimetridevezicaurinar~.

Neoplasmeleuroteliale
Suntcelemaifrecventecauzedeleziunedemucoas~.De#inuestecelmaifrecvent
neoplasmurotelial,carcinomulcuceluletranzi[ionaledetermin~celmaifrecventleziunide
mucoas~decelabileradiologic.Carcinomulcuceluletranzi[ionalearedou~forme:
form~papilar~,carereprezint~2/3dinacesttipdeneoplazie#icaresedezvolt~cao
leziune polipoid~, are extensie intralumenal~ #i determin~ un defect de umplere
marginal
form~ infiltrativ~, reprezent]nd restul de o treime din carcinomul cu celule tranzi
[ionalecareproducestenoz~alumenului.
228

Capitolul5.1.Explor~rileradiologicestandard

Litiazaveziciiurinare

Ca #i `n litiaza renal~, la formarea calculilor vezicii urinare staza urinar~ #i infec[ia


constituiefactorifavorizan[i.Deexemplu,calculiidestruvit~sauapatit~aparmaialesc]nd
exist~infec[ieurinar~,`nparticularcuProteus.Olocalizareaparteacalculilorveziciiurinare,
datorit~inciden[eimaridestaz~urinar~#iinfec[ie,oconstituiediverticulelevezicale.
Tehniciledevizualizareaeventualilorcalculivezicalisunt:
RRVS,pentrucalculiiradioopaci
fazacistografic~aUIV
cistografia.
PeRRVS,calculiiradioopacisev~dcaopacit~[irotundesaurotundovalare,unicesau
multiple,localiza[ipelvindecliv,cutendin[~deaglomerarepeliniamedian~.Pozi[ialateral~
acalculilor,`nspecialdac~suntuniifa[eta[i`nproximitate,sugereaz~localizarealor`ntrun
diverticul. Un calcul mare radiotransparent, dar cu marginea radioopac~ simuleaz~ pere[i
vezicalicalcifica[ipeRRVS.Calculiisuntmaipu[inopacidec]tsubstan[adecontrast,#ideci,
aparcadefectedeumplereaveziciiurinarelacistografiesau`nfazacistografic~aUIV.

a.

b.

Fig.30a)Calculvezicalradiotransparent;b)calculvezicalradioopac
(colec[iaCliniciideUrologieFundeni).

b.

Oproblem~adiagnosticuluilitiazeiveziciiurinareestediferen[iereadealteprocese
`nlocuitoare de spa[iu. Diferen[ierea calculilor de mase cu baza pe mucoas~ se face prin
mobilitatealorpeRRVSsauecografic.

Litiazauretral~

Calculiiuretraliprovinfiedinmigrareacalculilorvezicali,situa[ie`ncareobstruc[ia
uretral~ apare brusc, fie se formeaz~ de novo, c]nd exist~ condi[ii predispozante ca diver
229

TratatdeUrologie

ticul,pseudodiverticul#istricturiuretrale;einudetermin~simptomatologieacut~pentruc~
seformeaz~lent.
Celemaibunemetodedediagnosticsunt:
cistouretrografia
uretrografiaretrograd~
cistouretroscopia.
Majoritateacalculilorsuntradioopaci#iaparcadefectedeumplerefixesaumobile
`n uretrografiaretrograd~.Lafemei,celmaifrecventseg~sesc`ntrundiverticulaluretrei
mijlocii, iar la b~rba[i cel mai frecvent se g~sesc `n uretra bulbar~ sau
prostatomembranoas~.

Diagnosticulradiologicaltumorilorrenale,ureterale#ivezicale

Sindromultumoralrenal

Sindromul tumoral renal cuprinde totalitatea semnelor radiologice #i imagistice


determinate de prezen[a unei tumori renale, tumor~ care poate fi benign~ sau malign~.
Important pentru stabilirea tipului de tratament este determinarea naturii benigne sau
maligneaforma[iuniitumoralerenaleexistente.
Mijloacele radioimagistice de explorare a unei tumori renale sunt reprezentate de
ultrasonografie, radiografia renal~ simpl~ continuat~ de urografie intravenoas~, computer
tomografia,angiografiarenal~#irezonan[amagnetic~.

Radiografiarenovezical~simpl~
Reprezint~ cea mai simpl~ investiga[ie radiologic~, ce poate eviden[ia, de cele mai
multe ori indirect, prezen[a unei tumori indiferent de caracterul benign sau malign al
acesteia.
Aceast~metod~estelipsit~derisculapari[ieireac[iiloradverselasubstan[eleiodate,
este foarte ieftin~, dar nu ofer~ dec]t extrem de pu[ine date referitor la tumorile renale.
Oricum,esteradiografiacareprecedeefectuareauneiurografiiintravenoase.
Indiferent de sindromul tumoral, benign sau malign, radiografia simpl~ poate
eviden[ia cre#terea `n dimensiuni a rinichiului, de obicei `n diametrul craniocaudal sau
modificareaformeireniformeprinprezen[auneiboseluriaorganului.
At]t `n tumorile benigne, c]t #i `n cele maligne se poate eviden[ia prezen[a calcifi
c~rilor,caresuntvizualizatecaopacit~[iliniaresauarciforme,orineregulate,deintensitate
mare,proiectatepeumbrarenal~.Acestecalcific~risuntcelmaifrecventperiferice#isub[iri
`ncazultumorilorrenalebenigne#icentrale#ineregulate`nneoplasmelerenale.
`n sindromului tumoral benign, cu excep[ia modific~rilor deja descrise, se mai pot
eviden[ia, `n cazul unor forma[iuni de dimensiuni mari, `mpingerea structurilor adiacente
rinichiului(deexempluansedeintestinsub[ire).
`n mod excep[ional, pot fi eviden[iate #i modific~ri ale scheletului osos sub forma
prezen[eiunorosteoame,deobiceilanivelulcaloteicraniene#icoloaneivertebrale.
Sindromul tumoral malign este caracterizat pe radiografia renovezical~ simpl~, `n
cazulneoplasmeloraflate`ntrunstadiuavansat,de#tergereaconturuluimu#chiuluipsoas
#idemodific~riosoase.
Modific~rileosoasesuntdeterminatedeobiceiprindiseminareneoplazic~hemato
gen~#iseprezint~subformaunorleziuniliticelanivelulscheletuluiosos,celmaifrecvent
230

Capitolul5.1.Explor~rileradiologicestandard

vizibile la nivelul coloanei vertebrale. Ele se prezint~ sub forma unor zone de liz~ cu
contururineregulate,#tersespreosulnormal,carenumodific~dimensiunile#iformaosului.

Urografiaintravenoas~
Urografiaintravenoas~reprezint~ometod~radiologic~,destuldefidel~,deinvesti
ga[ieasindromuluitumoralrenal,caredeobiceiurmeaz~radiografieirenovezicalesimple.
Ea are ca inconveniente principale posibilele reac[ii adverse, `nt]lnite la substan[ele de
contrastiodateadministrateintravenos,iradierearelativimportant~datorit~efectu~riiunui
num~r relativ mare de cli#ee radiologice, precum #i necesitatea unei preg~tiri adecvate a
pacientului. Aceast~ metod~ este suficient de exact~ `n evaluarea dimensiunilor, contu
rurilor,func[ieiambilorrinichi,precum#iprezen[auneiforma[iunitumorale,indiferentde
caracteruleibenignsaumalign.
`n sindromul tumoral benign urografia intravenoas~ deceleaz~ de obicei o protu
beran[~localizat~,careseextindedinrinichi#ideplaseaz~structurilerenalenormale.Astfel
sepun`neviden[~calicealungite,amprentate,uneorideformate.Protuberan[aestetradus~
prinm~rirealocalizat~,deobiceiaunuipolrenal,adimensiunilorrenale,cup~strareaunui
contur net, dar boselat. Conturul anormal (boselat) este mai bine eviden[iat `n timpul
nefrografic.`ncazultumorilorbenignefunc[iarenal~nuesteafectat~.
Sindromultumoralmalignestereprezentatdetumorilerenaledetipexpansiv#icele
detipinfiltrativ.
Tumorileexofiticemalignerenaledetermin~unconturboselat#iom~rire`ndimen
siuniarinichiului,conturulrenalput]ndfinetsau,maifrecvent,#ters.
Deasemenea,acesttipdetumorieste`nso[it`ncazulcelordedimensiunimicisau
`ntrunstadiuincipientdeunsistempielocalicealcucalicealungite,dilatate,deformate#io
func[ie renal~ relativ normal~, `n timp ce cancerele de dimensiuni mari sau `ntrun stadiu
avansatdetermin~hidrocalixsauamputa[iecaliceal~`nso[it~deosc~dereafunc[ieirenale.
Toateacestemodific~risuntdecelatecuu#urin[~deurografiaintravenoas~.
Tumorile uroteliale pielocaliceale infiltrative se manifest~ din punct de vedere uro
grafic `n primul r]nd printro func[ie renal~ mult diminuat~ sau chiar absent~, astfel `nc]t
opacifierearegiuniiimplicate`ntimpulnefrograficestediminuat~sauabsent~.
`nplus,eledetermin~omodificareaproapetipic~pentruacestetumori,#ianumeo
strictur~infundibular~urmat~dehidrocalix#iamputa[iecaliceal~.
Pentruc~acesteneoplasme`#iauorigineasauinvadeaz~calicele,urografiaeviden
[iaz~ defecte de umplere caliceale, iar efectul de mas~ este nul sau minim #i deformarea
contururilorrenaleestedeobiceiabsent~.
Toateacestemodific~ripotfipuse`neviden[~deurografiaintravenoas~efectu]ndu
seat]ttimpulnefrografic,c]t#icelurografic.

Sindromultumoralrenalcuprindetotalitateatumorilorrenale.Acesteasuntclasifi
catefunc[iedediversecriterii.
Uncriteriuarconstadinstabilirealoculuidedezvoltareatumorii.
Astfel,sedistingtumorialesinusuluirenal#itumorialeparenchimuluirenal,celeale
sinusuluirenalfiindreprezentatede:
1. Chisturilesinusuluirenal
2. Angiomiolipomul
3. Teratomul
4. Lipomul#iliposarcomul

231

TratatdeUrologie

5.
6.
7.
8.

Fibromul#ifibrosarcomul
Neuromul#ineurosarcomul
Leiomiomul#ileiomiosarcomul
Histiocitomulfibrosmalign.

Tumorile proprii parenchimului renal prezint~ o sub`mp~r[ire `n tumori exofitice #i


tumoriinfiltrative.
Ceamaiuzitat~clasificareesteceacaredepindedeprognosticulbolii,#ianumecea
care`mpartetumorile`nbenigne#imaligne.
Tumoribenigne:
Chisturilerenale
Angiomiolipom(hamartom)
Oncocitom(adenomtubularproximal)
Nefrommezoblastic(hamartomfetal)
Nefromchisticmultilocular
Reninom(tumor~cucelulejuxtaglomerulare).
Tumorimaligne:
Carcinomrenal
TumoraWilms(nefroblastom)
Sarcom
Limfom
Leucemie
Metastazerenale
Tumorilesistemuluicolector.

Chisturilerenale

Chisturilerenalesuntconsideratetumoribenigne#i,func[iedelocalizare,seclasific~
`n chisturi renale corticale, cunoscute #i sub numele de chisturi renale simple #i chisturile
sinusuluirenal.Acesteadinurm~suntreprezentatedechisturileperipielice,chisturilepara
pielice#iceleurinifere.

Chisturilerenalecorticale
Se `nt]lnesc `n 50% din cazuri la persoanele de peste 50 de ani, au dimensiuni
variabile#ipotcre#tecanum~r#idimensiuni`ntimp,fiindsituate`nplinparenchimrenal.
Examenele radiologice standard, #i anume, radiografia renovezical~ simpl~ #i uro
grafiaintravenoas~,auunrolmic`ndetectarea#idiagnosticuldechistrenalcortical,elepot
eviden[iadoaroeventual~m~riredimensional~arinichiului,prezen[aunuiconturboselat,
caresevedemaibine`n timpulnefrografic,func[iarenal~fiindnormal~,eventualelecalcifi
c~riperiferice.
Estecunoscutfaptulc~,`ntropropor[iedecirca25%,chisturilesimplepotprezenta
calcific~ri.Acesteasunt`ntotdeaunacurbilinii#icelmaifrecventperiferice.

232

Capitolul5.1.Explor~rileradiologicestandard

Fig.31.
Chisturi
renale.

Fig.32.

Tumor~

benign~rinichi

drept(chist).

Chisturilesinusuluirenal
Chisturile sinusului renal sunt peripielice, parapielice #i urinifere. Dintre acestea
adev~ratulchistdesinusrenalestecelparapielic.Elecon[influid#isuntconsideratecafiind
deoriginelimfatic~,congenitale#irareorisimptomatice.
Radiografia renovezical~ simpl~ continuat~ cu urografie intravenoas~ eviden[iaz~
eventuala m~rire dimensional~ a rinichilor, iar ca modific~ri relativ caracteristice sunt cele
ap~rutelanivelultijelor#igrupelorcalicealecareaparamprentate,alungite#ideformate,
f~r~afiamputate,iarfunc[iarenal~estenormal~.Acestemetodenupotface`ns~diferen
[ierea`ntrechisturilesinusuluirenal#ilipomatozasinusal~,doardac~peRRVSnuseeviden
[iaz~radiotransparen[agr~simiisinusale.

Oncocitomul

Oncocitomul reprezint~ o tumor~ renal~ benign~ sau la limita dintre benign #i


malign, f~r~ poten[ial de metastazare. Din punct de vedere histopatologic, reprezint~ un
adenomdezvoltatdinceluleletubulareproximale,iardiagnosticulpreoperatoresteaproape
imposibildatorit~faptuluic~,dinpunctdevedereimagistic,caracteristicileluisuntaproape
identicecucelealecarcinomuluirenal.Chiar#ibiopsiapreoperatoriearevaloarediagnostic~
redus~deoarece#icarcinomulrenalare`nstructurasaelementeoncociticecarenupotfi
diferen[iatedeoncocitom.Caleziunepoatefiunic~saumultipl~.Efectuareaurografieiintra
venoase este util~ doar pentru detectarea prezen[ei masei renale #i definirea contururilor
netealeei.

Nefromulchisticmultilocular

Esteotumor~rar~,carerezult~dintrundefectdeembriogenez~aunuisegmentde
blastommetanefric.Radiografiarenovezical~simpl~#iurografiaintravenoas~eviden[iaz~o
m~rireunilateral~devolumrenal,rinichiulafectatprezent]ndcontururiboselate,extremde
rarsepotvedeafinecalcific~ricurbilinii.

233

TratatdeUrologie

Angiomiolipomul

Este o tumor~ benign~, `nt]lnit~ `n 80% din cazuri la adul[i, cel mai frecvent fiind
afectatefemeile.V]rstadeelec[ielacareeste`nt]lnit~aceast~tumor~estede3050deani.
Dinpunctdevederehistologic,angiomiolipomulestealc~tuit`npropor[iidiferitedin
angioid,mioid#ilipoid,fiindconsideratehamartoamelerinichiului.Uneledintreelecon[ino
component~important~angioid~,caracteristicfiindhipervasculare.
`n 20% din cazuri angiomiolipomul este asociat celor care sufer~ de scleroz~
tuberoas~,fiind`nacestecazurideobiceibilateral.`nrest,tumoraesteunilateral~,celmai
frecvent situat~ subcortical, purt]nd denumirea de angiomiolipom izolat `n accep[iunea
#colii franceze de imagistic~ medical~. `n radiologia conven[ional~, reprezentat~ de radio
grafia renovezical~ simpl~ #i urografia intravenoas~, modific~rile pot fi inexistente, c]nd
tumoraaredimensiunimici,sauladimensiunimarisepoteviden[iamodific~ridecontururi
renale,acesteaap~r]ndboselate.Modific~riledimensionalesuntdeobiceireprezentatede
m~rirea `n diametru, de obicei longitudinal, al rinichiului. Dup~ injectarea substan[ei de
contrasti.v.sepotvedeadevierialetijelorcaliceale,func[iarenal~r~m]n]ndindemn~.
Diagnosticulimagisticdecertitudineestecomputertomografic,datorit~eviden[ierii
prezen[ei gr~simii intratumorale, aceasta fiind uneori singura caracteristic~ ce face diag
nosticul diferen[ial `ntre angiomiolipom #i carcinomul renal. Pentru cele hipervasculare,
important~esteefectuareaunuiangioCT,careeviden[iaz~iodofiliacrescut~atumorii.

Carcinomulrenal

Originealuieste`nepiteliultubularrenal#ifrecventsedezvolt~`ncortexulrenal.
Explorarearadiologic~`ncepecuoradiografierenovezical~simpl~,carevaeviden[ia
maimultetipuridemodific~ri.Lanivelrenalpune`neviden[~boselareacontururilorrenale,
cre#tereaumbreirenale,precum#ieventualelecalcific~ri,carepotfiperiferice,centralesau
mixte, periferice #i centrale. De asemenea, examenul poate eviden[ia `mpingerea
structurilor adiacente, #i anume a structurilor intestinale, #tergerea conturului mu#chiului
psoas.Oalt~categoriedemodific~riradiologiceposibilvizibilepeRRVSsuntcelescheletale.
Este cunoscut~ diseminarea hematogen~ a carcinomului renal put]nd produce leziuni
secundaredetiposteoliticlanivelulscheletuluiosos.
Urografiaintravenoas~eviden[iaz~caprincipalemodific~ri:
mas~exofitic~
dezorganizareacalicelor,compresiasauamputarealor
func[iediminuat~,dac~venaesteocluzat~.
DimensiunealacarecarcinoamelerenalepotfidetectateUIVestedinp~catemare,
literatura notific]nd o dimensiune minim~ de circa 3 cm. Fiind o mas~ exofitic~, ea deter
min~deformareaconturuluirinichiului,carevaprezentaoconvexitatepecontur.Conturul
anormal,boselatestemaibineeviden[iat`ntimpulnefrografic.
Carcinomulrenalseextindedeobiceianteriorsauexclusivposteriordinrinichi,dar
nupoatefiapreciatUIVdatorit~superpozi[ieivalveirenalenormale.Detec[iauneimaseUIV
estedefaptnespecific~.
Calcific~rile sunt relativ frecvente, dar nespecifice. C]nd UIV sugereaz~ un chist
simplu, se face ecografie pentru a confirma sau nu diagnosticul. Dac~ masa nu `ntrune#te
acestecaracteristici,atunciprobabilitateadeafiuncarcinomrenalnuestea#ademare#i
conduitaimediat~recomandat~esteexplorareaCTsauIRM.
234

Capitolul5.1.Explor~rileradiologicestandard

Celelalte semne UIV de carcinom renal sunt secundare efectului de mas~, fiind
reprezentatede:
incizurialepelvisuluirenal#iureter
obstruc[iasauinvaziasistemuluicolector
sc~dereasauabsen[afunc[ieirenale.
Incizurilerezult~dinm~rireavaselorureterice#ialepelvisuluirenal,caretrebuies~
dreneze carcinomul renal hipervascular, #tiut fiind faptul c~ peste 78% din aceste tumori
sunthipervasculare.Hidronefrozafocal~saudifuz~deobiceirezult~dincompresiapecareo
face carcinomul renal pe calicele majore, pelvisul renal sau ureterul proximal. `n aceste
cazuri apar stricturile maligne ale sistemului colector #i sunt secundare `nvelirii #i invaziei
uroteliului.Existen[auneifunc[iirenalesc~zuteglobalasociat~cuomas~renal~sugereaz~
diagnosticul de tumor~ Grawitz. Carcinomul renal are predilec[ie pentru invazia venoas~.
Trombiitumoralidinvenarenal~suntceamaifrecvent~cauz~deabsen[~afunc[ieirenale
`ntrun rinichi cu tumor~ Grawitz, mai rar diminuarea sau absen[a func[iei renale este
determinat~dehidronefrozaindus~decarcinomulrenal.

Neoplasmeinfiltrative

Sunt reprezentate de carcinomul uroteliale cu celule tranzi[ionale, cel mai frevent,


carcinomulcucelulescuamoase,caredifuzeaz~din uroteliu `nparenchimulrenal,carcino
mul medular renal, care a fost descoperit recent, unele metastaze, leucemia, limfomul #i
carcinomuldeductecolectoare.Cuexcep[ialimfomului#iametastazeloracestetumorisunt
aproape `ntotdeauna unilaterale #i solitare. Neoplasmele uroteliale, inclusiv carcinomul cu
celule tranzi[ionale #i carcinomul cu celule scuamoase, cu originea `n sistemul colector
intrarenal,disemineaz~`nparenchimulrenal`n25%.Aproapetoatecarcinoamelecucelule
tranzi[ionale ale sistemului colector au o cre#tere exofitic~, papilar~; odat~ ce leziunile
invadeaz~ parenchimul renal, o fac prin infiltra[ie. 90% din neoplasmele uroteliale sunt
carcinoamecuceluletranzi[ionale,10%suntcarcinoamecucelulescuamoase.RRVSvapune
`neviden[~,lafelca#i`ncazulcarcinomuluirenal,`mpingereastructuriloradiacente,#ter
gereapsoasului,precum#iboselareacontururilor#icre#tereaumbreirenale.

Fig.35.Tumor~deuroteliu

Fig.33.Tumor~Gravitz.
Fig.34.Tumor~ Wilms.
bazinetalst]ng(colec[iaClinicii

deUrologieFundeni).

235

TratatdeUrologie

Examenul urografic le eviden[iaz~ ca defecte de umplere intraluminale atribuite


tumorii sau s]ngelui, eviden[iaz~ de asemenea calice obliterate sau amputate care rezult~
din strictura infundibular~ malign~. `n cazul tumorilor infiltrative ale sistemului colector
diagnosticul pozitiv este pus de urografia intravenoas~ sau pielografia retrograd~, iar
hidronefroza sau dilata[ia unor calice poate fi unicul semn radiologic. Aceste neoplasme
localizatecentralfrecventsuntheterogene,darcon[incalcific~risub2%,iarcomponentade
[esutmoaledinsinusulrenaloblitereaz~#ideplaseaz~gr~simea.

Neoplasmeleureterale

Neoplasmeleprimareureterale`#iauoriginea`noricare[esutcareformeaz~aceast~
structur~,darmajoritateasunturotelialecaorigine#ipapilomatoase(carcinomulpapilarcu
celule tranzi[ionale). Ele pot fi politopice #i 50% dintre ele sunt localizate `n treimea infe
rioar~aureterului.Neoplasmeleureteralesuntprezentesubdou~forme,#ianume:forma
papilar~#iformainfiltrativ~.Formapapilar~reprezint~2/3dintumorilecuceluletranzi[io
nale#iseprezint~caoleziunepolipoid~,careprezint~oextensie`nlumen.
ExamenulUIVsaupielografiaretrograd~vaeviden[iaundefectdeumpleretranspa
rent #i neregulat, substan[a de contrast `l delimiteaz~ uneori ca un deget, fiind greu de
diferen[iat de litiaz~ #i cheagurile de s]nge. Este considerat~ un tip de tumor~ exofitic~,
determin]nd la examenul radiologic prezen[a unei lacune cu contururi neregulate,
`nconjurate de mai mult~ sau mai pu[in~ substan[~ de contrast, iar caudal de tumor~
ureterul este dilatat, realiz]nd o imagine `n cup~, cunoscut sub numele de semnul lui
Bergam.Formainfiltrativ~semanifest~caostenoz~,determin]ndconstric[ialumenuluiure
teral.Urografiasaupielografiaretrograd~vaeviden[iaostenoz~cucontururineregulatela
nivelul ureterului, necesit]nd un diagnostic diferen[ial cu stenozele inflamatorii sau cica
triciale.

Fig.36.UPRdrept
Fig.37. Pieloureterografiedescendent~

forma[iunetumoral~ureteral~:
tumor~malign~ureterst]ng.

ureterlombardrept.
236

Capitolul5.1.Explor~rileradiologicestandard

Tumorileveziciiurinare

Clasificare
A.Maligne
1.Comune:
Carcinomulcuceluletranzi[ionaleTCC
CarcinomulcucelulescuamoaseSCC
2.Rare:Adenocarcinomul
B.Benigne
1.Comune:
Leiomiom
Polipfibroepitelial
2.Rare: Hemangiom
Feocromocitom
Adenom.

Tumorilemalignealeveziciiurinare

Aparcadefectedeumplerelocalizatedinpunctdevedereradiologic.Cadiagnostic
diferen[ialdefecteledeumplerelocalizatealeveziciiurinarepotfi:
1.Comune:
Tumori(maligne)
Litiaz~edemulmural
Cheagurides]nge
M~rireaprostatei
2.Rare: Cistit~localizat~
Ureterocel
Tumori(benigne)
Endometrioz~
Conglomeratedefungi.

Carcinomuldevezic~urinar~prezint~urm~toarelecaracteristici:
celmaifrecventcanceraltractuluiurinar
90%suntcarcinoamecuceluletranzi[ionale
75%suntleziunipapilaresuperficiale
25%suntinvazive
tumorimetacronedetractsuperiorapar`n23%dincazuri
cancerelesuperficialerecidiveaz~#i15%progreseaz~,devenindinvazive
etiologie:carcinogenichimici(acrolein~,aminearomatice,nitrosamine)#ifumatul.

Neoplasmele vezicii urinare reprezint~ 4% din toate neoplasmele, au o frecven[~


maxim~ la grupa de v]rst~ 5069 ani, sunt mai frecvente la b~rba[i dec]t la femei `ntrun
raport de 3:1, pot fi clasificate `n dou~ categorii: cele epiteliale #i cele nonepiteliale sau
mezenchimatoase.95%potficarcinoamenoninvazive(papilare,pediculatesausesile)sau
invazive`nmu#chiulvezicii.
Neopalsmele uroteliului vezical pot fi neinvazive sau invazive `n mu#chiul vezicii
urinare(detrusor).Celeneinvazivepotfipapilare,pediculatesausesile.Celeinvazivepotfi
nodulare, ulcerate. Neoplasmele epiteliale pot fi clasificate dup~ tipul de celule: urotelial
(celuletranzi[ionale),scuamossauglandular(adenocarcinoame).90%dintoateneoplasmele
veziciiurinaresuntTCC,5%suntscuamoase#i2%suntadenocarcinoame.

237

TratatdeUrologie

Neoplasmele neepiteliale reprezint~ sub 5% din cele de vezic~ urinar~, cele mai
frecvente fiind leiomiomul, urmat de limfom, iar rabdomiosarcomul este cea mai comun~
tumor~aveziciiurinarelacopiide26ani.
Tumorilevezicalesecundareprezentelanivelulveziciiurinarepotaveacapunctde
plecare:
carcinomul de prostat~, care poateinfiltra dea lungul uretrei posterioare sau colul
vezical,sauprintrigon
canceruldecol(cervical)sauuterimplic~pereteleposterioralveziciiurinarepelinia
median~
neoplasmuldecolonsaurectcareafecteaz~peretelelateralst]ngalveziciiurinare
cancereledestomac#is]nsuntcelemaifrecvente,caredaumetastazeladistan[~`n
vezicaurinar~.
RRVS are o valoare mic~ `n detectarea cancerului de vezic~ urinar~, dar poate
eviden[iacalcific~rilefocalecareseasociaz~cuotumor~papilar~`n0,76,7%.
UIVesteometod~performant~,darposibilitateadeeviden[iereatumorilormicieste
redus~, cele mai bune metode diagnostice sunt cistografia #i cistografia mic[ional~, fie ca
atare,fiecatimpiaiurografieiintravenoase.CelmaifrecventpeUIVaparecaundefectde
umplere polipoid sau sesil neregulat, secven[ele cu vezica urinar~ `n semireple[ie #i post
mic[ionalsuntdeajutor.
Cea mai frecvent~ localizare a TCC este trigonul #i peretele posterolateral, iar 2%
carcinomulapare`ndiverticul.
Unaltsemnradiologicvizibilesteinfiltra[iaperetelui,careducela`ngro#arealui#i
sc~derea distensibilit~[ii, motiv pentru care dimensional vezica urinar~ va fi mai mic~, iar
peretelevaprezentarigiditate.
Prezen[a obstruc[iei la nivelul jonc[iunii ureterovezicale #i hidroureterul de obicei
implic~ invazia neoplazic~ a muscularei, un alt factor care determin~ rigiditate parietal~
localizat~. Detectarea de leziuni multifocale ale tractului urinar superior #i hidronefroz~
secundar~obstruc[ieiesteunmotiv`nplusdeob[inereaurogramei.
Tumorile sincrone sau metacrone ale tractului superior se `nt]lnesc `n 27% din
tumorile de vezic~ urinar~, acestea au o inciden[~ mai mare de cancer multifocal sau de
recuren[ealeneoplasmuluidevezic~urinar~.

Fig.38.UIVTumor~`nhemivezica
st]ng~.

Fig.39.Tumor~devezic~urinar~.

238

Capitolul5.1.Explor~rileradiologicestandard

Tumorilebenignealeveziciiurinare
Papilomul cu celule tranzi[ionale este rar #i poate fi dificil de diferen[iat de carci
nomulpapilarcugradredusdeanaplazie,fiindotumor~deobiceiunic~cudiametrulde0,5
2cm.
Sunt tumori ata#ate superficial de mucoas~ printrun pedicul fin, sunt localizate pe
pere[iilaterali,radiologicav]ndaspectuluneilacunecucontururiregulate,nete.
Ecograficnupotfidiferen[iatedeTCC.

Leiomiomul este cea mai frecvent~ tumor~ benign~ de origine mezenchimal~, ea


apare ca o mas~ intramural~, izolat~, bine definit~, care poate atinge c][iva cm ca dimen
siuni,suntincapsulate#iauform~oval~sausferic~,radiologicprezent]ndacelea#icaracte
risticica#ipapilomul.

Diagnosticulradiologicalafec[iunilorveziciiurinare,uretrei#iprostatei

Vezicaurinar~

`ngro#~riledifuzealepereteluiveziciiurinare
Cauzelecomuneale`ngro#~rilordifuzedeperetesunt:
nedistensia
trabecula[ia
pancistita
hemoragiasauedemul
infiltra[iacarcinomatoas~.

Trabecula[ia
Esteoafec[iunecaresevedecelmaifrecventlaceicuobstruc[ielaie#iredinvezica
urinar~ sau cu vezica urinar~ neurogen~. Radiologic, la cistografie, fie ca moment al
urografieiintravenoase,fieretrograd~semnulprincipalesteneregularitateageneralizat~a
conturuluiinternalveziciiurinarec]ndvezicaurinar~esteplin~.`ngro#areapere[ilorvezicii
urinare rezultat~ din contrac[ia detrusorului sau relaxarea incomplet~ este normal~ la o
vezic~urinar~neumplut~.
Cistometriaarat~orela[ie`ntretrabecula[iaradiologic~#iinstabilitateadetrusorului,
definit~ prin presiune de peste 15 cmH2O `n timpul umplerii vezicii urinare. `n absen[a
instabilit~[ii detrusorului, obstruc[ia jetului din vezica urinar~ cu presiune crescut~ intra
vezical~produceacela#iefectasupradetrusorului#i,deci,trabecula[ie.Trabecula[iarezult~
din hipertrofia detrusorului, ca rezultat al cre#terii rezisten[ei la fluxul de ie#ire din vezica
urinar~, ea frecvent acompaniaz~ alte cauze de obstruc[ie ale vezicii urinare. Hiperplazia
prostatic~ benign~ este cea mai comun~ cauz~ de obstruc[ie, alte cauze care `ngusteaz~
uretraprostatic~determin]ndobstruc[iaveziciiurinaresuntadenocarcinomuldeprostat~#i
prostatita.
Radiologic,cu excep[iatrabecula[iei, care indic~ obstruc[ie la nivelul prostatei,sunt
`nt]lnite#ialtesemne,#ianume:
amprentaprostatic~lanivelulbazeiveziciiurinare
ureterelejuxtavezicale`nJsau`nc]rligdeterminatederidicareatrigonului
reziduupostmic[ionalmare.

239

TratatdeUrologie

Cistitele
Sunt definite ca fiind inflama[ii ale tuturor p~r[ilor pere[ilor vezicii urinare. Clasifi
careacistitelorsepoateface`nfunc[iedeetiologiesaupebazacriteriilorclinicopatologice.
Clasificareacistitelor`nfunc[iedeetiologieesteurm~toarea:
a.infec[ioase
bacterian~,inclusivmalacoplakia
viral~
protozoare(schistosomiaz~)
fungi(candida)
b.neinfec[ioase
iritative sau mecanice corpi str~ini cum ar fi sonda Foley sau calculi
vezicali#iproceseinflamatoriiperivezicale
toxiceciclofosfamida
iradiere
alergic~intersti[ial,eozinofilic
Clasificareaclinicopatologic~acistiteloreste:
acute
cronice
hemoragice
buloase
emfizematoase
polipoide
cistitachistic~
cistitaglandular~
metaplaziascuamoas~
`ncrusta[iilealcaline.
Aceast~adouaclasificareestefolosit~`nspecialpentrucistitelecuetiologiemultipl~
sau necunoscut~, de exemplu cistitele virale, de iradiere, dup~ ciclofosfamid~ sunt cistite
hemoragice, cistitele buloase se refer~ la colec[iile pline cu fluid sau edem fluid `n sub
mucoas~, `n timp ce cistitele polipoide sunt hiperplazii uroteliale reactive care protru
zioneaz~`nlumenulveziciiurinare(pseudotumor~polipoid~).
Cistitelechistic~,glandular~#ifolicular~serefer~lavarianteparticularehistopato
logicedecistit~cronic~,carepoatefimaibinecaracterizat~caform~demetaplazieurote
lial~,iarunadincelemaicomunec~ideadescriecistitaestedurata.Cistitaacut~serefer~
la inflama[ia cu simptomatologie recent~ sau de scurt~ durat~. Din punct de vedere
radiologic, vezica urinar~ este de multe ori normal~, `n ciuda modific~rilor g~site la cisto
scopie ca ulcera[iile, pete#iile sau eritem. `n cazul cistitei cronice, care implic~ un proces
inflamator de lung~ durat~, luni sau ani, se pot eviden[ia `ngro#area pere[ilor #i sc~derea
capacit~[ii vezicii urinare. Complian[a vezicii urinare frecvent este sc~zut~ la cei cu cistit~
cronic~ #i presiunea intravezical~ crescut~ poate determina dilata[ie ureteral~ #i reflux
vezicoureteral.Proceseleinflamatoriipotafectato[ipere[iiveziciiurinarerealiz]ndceeace
senume#tepancistit~.

Ocazional, cistita este mai mult sau mai pu[in vizibil~ ca leziune focal~ radiologic,
rezultatul poate fi o leziune focal~, care se poate s~ nu fie diferen[iat~ radiologic de
carcinomuldevezic~urinar~.Unexemplucomunesteedemulbuloscareacompaniaz~frec
ventpancistitadediferitecauze.
240

Capitolul5.1.Explor~rileradiologicestandard

Modific~rileatribuitecistiteifocalemuralesunt:
edemulbulos
leziunilepremerg~toare(herald)
pseudotumorapolipoid~
cistitachistic~sauglandular~
malacoplakia.
Cistitelemecanicerezult~frecventdinirita[iadeterminat~deuncorpstr~incumarfi
uncateter;elesuntprocesefocale.

a.Cistiteleinfec[ioase
Sunt cele mai frecvente dintre cistite, germenii patogeni frecven[i sunt E. coli,
Klebsiella#iPseudomonas.Suntafec[iunimaifrecventelafemeiactivesexual#iseproduc
deseoriprinmigrarearetrograd~afloreinormalevaginale.Acestaestemotivulpentrucare
lafemeiexameneleradiologicenusuntutilizatepentruainvestigaocistit~dec]tdac~este
recurent~saudificildeeradicat.
Spre deosebire de femei, la b~rba[i cistita apare de obicei ca o consecin[~ a
obstruc[ieilaie#ireaveziciiurinare,tipicefiindhiperplaziabenign~deprostat~sauvezic~
neurogen~. De aceea, evaluarea vezicii urinare #i a uretrei la primul episod de cistit~ este
indicat~ la b~rba[i pentru a exclude anomalii sau obstruc[ii de tract urinar inferior. La
majoritatea persoanelor cu cistit~ acut~ vezica urinar~ apare normal~ la examinarea prin
cistografie,ecografiesaulaexamenulcomputertomografic. Totu#iexist~forme severede
cistit~bacterian~caresunt`nso[itede`ngro#areapereteluiveziciiurinare,carepoateap~
reaneregulatsaunodularlaexamenulradiologiccusubstan[~decontrast.

Malacoplakia. O manifestare neobi#nuit~ a infec[iilor bacteriene recurente este


malacoplakia, un proces inflamator granulomatos care afecteaz~ vezica urinar~ #i ureterul
inferior,careaparelaimunodeprima[i#iseasociaz~cuinfec[iacuE.coli.Patogeniamalaco
plakiei este un deficit func[ional al lizozimului din macrofage, determinat de r~spunsul
ineficient #i cronic la infec[ia tractului urinar. La examenul UIV sau cistografie apare ca
multiple defecte de umplere care protruzioneaz~, dar sesile de 510 mm diametru. Este
posibil~ vizualizarea ombilica[iilor centrale ale acestor leziuni plate, aflate cu predilec[ie la
baza vezicii urinare, iar c]nd malacoplakia intereseaz~ ureterul inferior se pot vedea arii
contiguedestrictur~ureteral~.

Cistitele virale. Se `nt]lnesc mai des la copii, c]nd disuria #i hematuria urmeaz~
viremiei,elesuntdeterminatedeadenovirusul11lacopii#ivirusulinfluenzatipAlaadult.
La examenul cistografic se g~sesc modific~ri ale unei cistite agresive, capacitatea vezicii
urinareestemultsc~zut~,iarnodularitateamural~poates~iaformaunormultipledefecte
de umplere polipoide, f~c]nd dificil~ diferen[ierea de sarcomul botryoides: o important~
diferen[iere este capacitatea vezicii urinare care `n cistit~ este sc~zut~, iar `n rabdomio
sarcomestenormal~.

Schistosomiaza.Esteoafec[iunefrecvent~`n[~rilesubdezvoltate.

Cistitatuberculoas~.Urmeaz~infec[ieirinichilor#iureterului#ipoatefi`nt]lnit~`n
1020%dincazuri.ExamenulUIVsaucistografiapoteviden[iatuberculoamelemucoasecare
determin~ defecte de umplere murale, focale, neregulate, care se pot vedea `n stadiile
incipientealecistiteituberculoase#ipotmimaneoplazia.Dac~procesulinfec[ioscontinu~
241

TratatdeUrologie

acestavaevoluatransmural#iaparefibroz~asociat~cusc~dereacapacit~[iiveziciiurinare,
iarc]ndprocesuldefibroz~esteneuniformapareoconfigura[iebizar~aveziciiurinare.De
asemenea,apare frecventsc~derea complian[eiveziciiurinare,careasociaz~refluxvezico
ureteral #i obstruc[ie ureteral~. Radiologic, pe RRVS, calcific~rile sunt prezente `n 10% din
cazuri#idac~suntprezentesev~d#imodific~riletuberculoasedinrinichi#iureter.

b.Cistitaneinfec[ioas~
Cunoscut~#isubnumeledecistit~mecanic~,implic~uncontactiritantfie`n~untrul
ei, fie exterior vezicii urinare. Datorit~ faptului c~ inflama[ia implic~ rar `ntreaga vezic~
urinar~, cistita mecanic~ este frecvent un proces localizat. Factorii iritan[i din interiorul
veziciiurinaresuntsondaFoley,calculiisaucorpiistr~inidup~opera[ii,cumarfimaterialul
de sutur~. De asemenea, bolile paravezicale ca diverticulita, abcesul pelvin, enterita regio
nal~, cancerul de prostat~ sau neoplasmele ginecologice, pot determina prin inflama[ia
produs~edembulos#i`ngro#areapereteluivezicalfocal~saunodular~,leziuneaheraldse
refer~ la o asemenea inflama[ie focal~ la nivelul adventicei #i muscularei. Este cunoscut
faptulc~tratamentulcuciclofosfamid~poatedeterminaocistit~care`n412%dincazurise
asociaz~ cu o hematurie masiv~, ceea ce va duce la apari[ia de cheaguri de s]nge care,
radiologic,sev~dcadefectedeumplereintraluminale.Dinpunctdevederealexamenului
cistografic,pere[iiveziciiurinareapar`ngro#a[i#isev~ddefectedeumplerenodulare,iar`n
stadiiletardivesedezvolt~fibrozapere[ilorveziciiurinare,careesteireversibil~.

Cistitaintersti[ial~
Este definit~ ca o pancistit~ idiopatic~ ce apare frecvent la cei cu alergii; ea se
asociaz~cuPAN, artrit~ reumatoid~, lupus eritematos sistemic (LES), iar triada diagnostic~
este:
simptomedeleziuneiritativ~cronic~
urin~steril~
cistoscopiaarat~ulcera[iiurotelialesaupete#ii.
`n faza ini[ial~, vezica urinar~ apare normal~ la cistoscopie, `n faza tardiv~ vezica
urinar~ devine contractat~ #i capacitatea este redus~, iar c]nd apare fibroza se vede
`ngro#area nodular~ a peretelui vezicii urinare, modific~ri eviden[iabile la cistografie. Din
p~catecomplica[iileseverealecistiteicronicepotproducemodific~riradiologicecareoface
denediferen[iatdecarcinomuldevezic~urinar~.

Cistitachistic~
Este un rezultat al inflama[iei de lung~ durat~, `n care apar celule uroteliale hiper
plasticenumiteceluleleBrunn,careseformeaz~`nsubmucoas~,iarc]ndaparenecroza,`n
centrul acestora se formeaz~ structuri pseudochistice umplute cu fluid, ceea ce define#te
cistitachistic~.

Cistitaglandular~
Define#te forma de cistit~ care apare c]nd celulele Brunn se formeaz~ ca structuri
glandulare. Metaplazia chistic~ sau glandular~ este indicativ de instabilitate mucoas~, care
`ns~ frecvent este reversibil~. Spre deosebire de hiperplazia urotelial~ submucoas~, meta
plazia scuamoas~ este o modificare a uroteliului vezicii urinare cu celule scuamoase
produc~toaredekeratin~.Modific~rilehiperplastice#imetaplazicetinds~apar~devreme
#ipredomin~`ntrigon#ilabazaveziciiurinare.

242

Capitolul5.1.Explor~rileradiologicestandard

Imaginiadi[ionalealepereteluiveziciiurinare

Clasificareaacestoraesteurm~toarea:

1.Comune: diverticule
cistocel
herniereaveziciiurinare

2.Rare:
diverticuldeurac~.

Diverticulele
Prin defini[ie, diverticulul este o herniere focal~ a uroteliului #i a submucoasei prin
locurileslabenormalealeveziciiurinare.
Caracteristicilediverticulilorvezicalipotfisintetizatedup~cumurmeaz~:
rezult~dinobstruc[iacoluluivezicalsauauretrei
congenitalesteundiverticuluria#
poatedeterminaobstruc[ieureteral~saureflux
stazaurinar~poateducelalitiaz~saucistit~
2%asociaz~carcinom.
C]nd este dob]ndit, diverticulul se dezvolt~ pe o cre#tere cronic~ a presiunii intra
vezicale,#iacestehernieritinds~apar~l]ng~orificiileureterale.
Diverticulul are un poten[ial important de determinare a stazei urinare, obstruc[iei
ureterale,precum#iarefluxuluivezicoureteral.C]ndaredimensiunimaripoateexercitaun
efect de mas~ extrinsec asupra vezicii urinare sau poate deplasa sau obstrua ureterele
pelvine,ureterulinferiorpoatefideviatlateral,darcelmaifrecventestedeviatmedial.
Radiologic, la examenele cu substan[~ de contrast diverticulul este definit ca o
imagine adi[ional~ care are pere[i netezi, spre deosebire de vezica urinar~ trabeculat~ din
care`#iareoriginea.Dimensiunilediverticulilorsuntvariabile,potaveac][ivacm#irarpoate
ajungeladimensiunimaimaridec]tcelealeveziciiurinare.
Imaginile adi[ionale ale vezicii urinare mai mici de 2 cm sunt considerate a fi mai
degrab~ funduri de sac ale mucoasei (pseudodiverticule) dec]t diverticule, de#i patogenia
esteaceea#i.Defecteledeumpleredindiverticulepotfideterminatedecalculi#i,mairar,
de carcinom. Diverticulul comunic~ cu lumenul vezicii urinare printrun colet, care este
`ngust#iimperceptibil.
Toateacestemodific~risuntdeprincipiuvizibile`nfazacistografic~aUIV,dardac~
nusev~delepotfidemonstrateprincistografie.Evacuareapar[ial~asubstan[eidecontrast
din diverticul dup~ evacuarea vezicii urinare este important~ pentru decizia de interven[ie
chirurgical~.

Cistocelul
Este o anomalie care const~ `n prolapsul vezicii urinare `n vagin, por[iunile care
prolabeaz~frecventsunttrigonul#icolulvezical.Prolapsulconcomitentalveziciiurinare#i
al uretrei, care poart~ denumirea de cistouretrocel, este frecvent `nso[it de incontinen[~
urinar~ de stres. `n plus, cistocelul se poate asocia cu obstruc[ia vezicii urinare sau
hidronefroz~,`nspecialc]ndgraduldeprolapsestesever.
Diagnosticul este cistografic, examinarea fiind mai fiabil~ c]nd se execut~ cli#ee `n
inciden[ele laterale dec]t pe cele anteroposterioare. Radiologic este definit ca o parte a
veziciiurinarecareatingeramulinferiorpubian`ntimpulmic[iunii#iarediferitegradedife
rite#ianumedelaminimp]n~lasever,`nfunc[iedegraduldecobor]reaveziciiurinare.

243

TratatdeUrologie

Herniaveziciiurinare
Este o hernie inghinal~, femural~ sau inghinoscrotal~ care con[ine vezica urinar~,
fiindcauz~deapari[ieauneiasimetriilocalizateaveziciiurinaresauapari[iauneipseudo
imaginiadi[ionaleprinangajareaveziciiurinare`ncanalulinghinal.
Se eviden[iaz~ `n timpul cistografic al UIV sau prin cistografie retrograd~, mai ales
c]nd colul herniei este `ngust #i nu este `n pozi[ie adecvat~. Pentru un diagnostic pozitiv,
cistografiaanterograd~(UIV)serealizeaz~`nortostatism.

Aerulintravezicalsauintersti[ial

Cauzeledeproduceresunt:
iatrogen(cateterizarerecent~sauinstrumente)
fistulecolonicesauvaginale
cistitaemfizematoas~(rar,determinat~degermenicareproducaer).

Fistulavezicoenteric~
Ofistul~fiedinintestinulsub[ire,fiedincolonpoatedeterminaocistit~cronic~sau
fecaluria.
Cauzeledeproduceredefistule`ntrevezicaurinar~#iintestinsunt:

1.Comune
- iatrogenic
- diverticulita
- carcinomderectsausigmoid
- enteritaregional~sauboalaCrohn
2.Rare
- complica[iileradioterapiei
- boliinflamatoriipelvine
- abcesulpelvin(apendicita)
- neoplasmeledevezic~urinar~
- schistosomiazasautuberculoz~
- cancerulcervical.
Bolile rectosigmoidiene duc la formare de fistul~, care implic~ peretele st]ng sau
posterior al vezicii urinare, `n timp ce infec[iile sau inflama[iile cecului, apendicelui sau
intestinuluisub[iredistalafecteaz~parteadreapt~aveziciiurinare,fieanterior,fielateral.
Fistulele `ntre vezica urinar~#i intestinsuntgreu de eviden[iat prin cistoscopiesau
radiologic,cistografia#iirigografialeeviden[iaz~doar`n3060%dincazuri.
Uretrocistografia este mai fiabil~ c]nd se efectueaz~ cli#ee radiologice `n pozi[ii
oblicesaulaterale.

Fistulavezicovaginal~
Aparecelmaifrecventcaocomplica[ieachirurgieipelvine,darpoaterezulta`nca
drulformeloravansatedecancerdevezic~urinar~saucervical,darrecunoa#te#icauzerare
cum sunt leziunile obstreticale, radioterapia, corpi str~ini (sonda Foley) #i cistita tubercu
loas~.
Pentru diagnostic, cistouretrografia mic[ional~, de obicei, este suficient~ pentru a
eviden[iafistula,caresevede`ninciden[eleoblicesaulaterale.

244

Capitolul5.1.Explor~rileradiologicestandard

Cistitaemfizematoas~
Este o form~ rar~ de cistit~ bacterian~ care apare la cei cu diabet necontrolat, de
obiceiestedeterminat~deE.coli#imairardeAerobacteraerogen#iCandida.
Radiologic, aerul se vede `n pere[ii vezicii urinare #i uneori #i `n interiorul vezicii
urinare ca o radiotransparen[~, care poate avea form~ liniar~ sau multichistic~ dac~ este
localizat`nperetelevezical.Sepoateasociacuprezen[aaerului`nuretereleproximalesau`n
pelvisulrenal.

Calcific~rilepereteluisaulumenuluiveziciiurinare

Cauzeledeterminantesuntreprezentatede:
litiaz~
carcinomulcuceluletranzi[ionale
cistite
corpistr~ini(asociaz~`ncrusta[iirar)
amiloidoza(rar).

Schistosomiaza
Cistita determinat~ de ea este cea mai frecvent~ cauz~ `n lume de calcific~ri de
peretevezical.
Schistosoma haematobium este cea care determin~ infec[ie primar~ la nivelul
tractuluiurinarinferior,eatr~ie#te`nvenaport~#imezenteric~#imigreaz~prinsistemul
venosajung]nd`ntractulurinarinferior,prostat~#itractulgastrointestinalinferior,femelele
depoziteaz~ou~`nmicilevenuledinpereteleveziciiurinare,iarr~spunsulhistopatologicla
acesteou~esteformareadegranuloame,endarteritaobliterant~#ifibroza.
Primamodificarevizibil~cistograficesteunconturalpereteluiveziciiurinareneclar,
p~tat,carerezult~dinedemulsubmucos.Radiologic,caracteristicesuntcalcific~rile`ncoaj~
de ou `n submucoasa vezicii urinare #i a pere[ilor ureterali, care pot fi variate #i dense,
striatesauserpiginoase.Primapor[iuneaveziciiurinareafectat~estebaza,iarcaracteristic~
estecalcificarea`ntreguluiperetevezical,50%dintreace#tipacien[iaucalcific~ricaresev~d
pe RVS. Capacitatea vezicii urinare r~m]ne normal~ #i `n timpul mic[iunii se contract~ `n
ciuda prezen[ei calcific~rilor. Orice form~ de carcinom vezical poate complica schisto
somiaza, dar mai ales carcinomul cu celule scuamoase. Suspiciunea de malignitate apare
c]ndsev~ddefectedeumplereunicesaumultiple,asimetricesauneregulate,sau`ntreru
perilocalizatealecalcific~rilormuraleliniare.

Modific~riradiologicesuntvizibile#ilanivelulureterelor,acesteafiind:
persisten[aopacifierii 1/3inferioareaureterelor este o modificarevremelnic~pe
UIV
aceastapoateprogresadetermin]nddilata[iefix~
se pot dezvolta stricturi localizate, care sunt `ntotdeauna prezente la `nceput pe
ureterulinferior
combina[ia de dilata[ie #i tortuozitate determinate de strictur~ sau reflux au fost
descrisecacapdecobr~lanivelulureteruluidistal
apoi implicarea progresiv~ a ureterului proximal cu stricturi #i dilata[ii, ureter care
estebordatcucalcific~riliniare15%.

245

TratatdeUrologie

Carcinomuldevezic~urinar~
Calcific~rileapar`ntumorilevezicale`n0,5%,celmaifrecventseasociaz~cucalcifi
c~ridistrofice,caresuntlocalizate#ipotfiliniare,punctiformesaumari.
Statistic70%dincarcinoameledeurac~prezint~calcific~ri.

Cistitacu`ncrusta[iialcaline
Este definit~ ca fiind inflama[ia peretelui vezicii urinare care con[ine arii focale de
necroz~ ce pot duce la calcific~ri distrofice. Acest tip de calcificare apare mai degrab~ `n
condi[iile unei urine cu pH alcalin, pentru c~ gr~be#te precipitarea s~rurilor de fosfat de
calciusaustruvit~,deci`ninfec[iilecuProteus,careproducureeaz~#idetermin~ariifocale
saudifuzedenecroz~.Poateap~rea#ilaceicuantecedentederadioterapie,tratamentcu
ciclofosfamid~,instila[iicumitomicin~C.Calcific~rile,carenusev~d`ntotdeaunaradiologic,
suntliniaresaunodulare,acestecalcific~riregreseaz~#idisparcurezolu[iainfec[iei.

Cistitatuberculoas~
Cistitatuberculoas~sepoateasociacucalcific~rialepere[ilorveziciiurinare,tardiv`n
evolu[ie.

Compresiaextrinsec~saudeplasareaveziciiurinare
Cauzelecepotdeterminacompresiaextrinsec~saudeplasareaveziciiurinaresunt:
1.Comune:
- hematomsauurinompelvin
- mas~pelvin~,abcessautumor~
- diverticuldevezic~urinar~
2.Rare:
- limfadenopatia
- modific~rilepostoperatoriisaupostradioterapie
- trombozadeVCI
- lipomatozapelvin~
- hipertrofiademu#chiiliopsoas

Fig.40.
Neoplasmuterin
invadant`n
vezicaurinar~.

Fig.41.
Tumor~pelvin~
carecomprim~
vezicaurinar~,
ureterohidrone
froz~bilateral~.

246

Capitolul5.1.Explor~rileradiologicestandard

Bolineuromusculare

Clasificareabolilorneuromusculareceafecteaz~vezicaurinar~este:
1.Vezicaurinar~spastic~:
- hiperreflexiadetrusorului#idissinergiasfincterului
- boal~SNCsaulanivelulveziciiurinaresauirita[iepelvin~
2.Dissinergiasfincterului:
- hiperactivitatedetrusor
- dissinergiasfincteruluiveziciiurinare
3.Vezicaurinar~flasc~:
- areflexiadetrusoruluicu/f~r~obstruc[ieinfravezical~determinat~depro
lapsulveziciiurinare
- leziunisaubolialeconuluimedular,coad~decal,nerviisacra[isaunervii
periferici.
Vezicaurinar~neurogen~sauneuropat~ esteovezic~urinar~care`#ipierdecapa
citatea de umplere, depozitare sau golire sub control voluntar din cauza bolilor neuro
musculare, clinic se manifest~ prin incontinen[~, presiune, urgen[~, frecven[~ #i reten[~
urinar~.
Hiperreflexiaveziciiurinareesterezultatulleziunilorlanivelullobilorfrontaliantero
mediali,cerebel#iganglionilorbazali,iarradiologicsemanifest~prin:
mucoas~din[at~,careini[ialestelanivelulpereteluiposterioralveziciiurinare
saucaindenta[iiproeminen[eureterale
capacitateaveziciiurinareestemic~datorit~contrac[iilornecontrolate
conturulveziciiurinareestepersistentrotund
pere[iiveziciiurinaresuntdeobiceinetezi
trabecula[iaveziciiurinareesterar~,darsepoatevedea`nformeleavansate,de
lung~durat~alebolii.

Hiperreflexiadetrusoruluiasociat~cu
dissinergia sfincterului vezicii urinare este
rezultatulafect~riim~duveispin~riilanivelul
saudeasupraT12#iradiologic:
celedinhiperreflexie
dilata[ia colului vezical `n timpul con
trac[iilor detrusorului datorit~ dissi
nergieisfincteruluistriat.
C]nd exist~ o obstruc[ie cronic~ de
ie#ire din vezica urinar~ (litiaz~,cistit~ croni
c~) apare hipertrofia detrusorului #i trabecu
la[iaveziciiurinare.
Sechelele tractului superior urinar `n
vezicaneurogen~suntprezenteradiologicca:
ectopiaureteral~
refluxulvezicoureteral
pierderea [esutului parenchimatos ca
rezultat al litiazei, refluxului sau obs
truc[iei.
Fig.42.Vezic~neurogen~.

247

TratatdeUrologie

Vezicaflasc~esterezultatulbolilorconuluimedular,coziidecal,nervilorsacra[isaua
nervilor periferici, ea se nume#te vezica neurogen~ autonom~, iar vezica urinar~ are un
detrusorinadecvat,carepoatedep~#ipresiuneaintrauretral~doarlavolumfoartemare#i
radiologicseeviden[iaz~:
vezic~urinar~neted~cucapacitatemareestetipic~
ea apare #i `n leziuni extinse de nervi pelvini din rezec[iile complicate sau histe
rectomieradical~,neuropatiediabetic~,neuropatiealcoolic~sauinfiltra[ietumoral~.

Vizualizareaconfigura[ieichristmastreearecapatogenieobstruc[iainfravezical~:
estetipic~pentruleziuniledeneuronmotorinferior
poatefi`nt]lnit~at]tlaceicuhiperreflexie,c]t#icuareflexieadetrusorului
datorit~hiperdistensieisevereaparariifocaledeperetevezicalslabe,careaucedat
ceduclatrabecula[ie,sacula[ie#ieventuallaconfigura[iadepin.

Anomaliideurac~

Uraca este o termina[ie a vezicii urinare fetale, ventrocefalice, care comunic~ cu


alantoida la nivelul ombilicului. Ea este o structur~ extraperitoneal~ care este delimitat~
anteriordefasciatransversalis#iposteriordeperitoneu.
vestigiiextraperitonealealearterelorombilicalesaualantoidiene
anomalii de `nchidere: uraca deschis~, sinusul ombilical, diverticulul #i chistul de
urac~
frecventdescoperitedatorit~infec[iilorsecundare
Adenocarcinomuldeurac~:
- componentecuatenuaresc~zut~cerezult~dinmucin~
- calcific~ridistrofice`n70%dincazuri
- prognosticprost
- invazietransmural~vremelnic~
- esteomalignitatefoarterar~
- 1/3dinadenocarcinoameleprimaredevezic~urinar~`#iauorigineadin[esutul
uracal
- localizareaeste supravezical~ #i frecvent pe linia median~, imediat posterior de
liniaalb~
- descoperirea de mucus, `n cantitate mare sau microscopic `n urin~, sugereaz~
diagnosticul.

Stricturiledeuretr~

Etiologiastricturilordeuretr~poatefi:
1.Infec[ioas~sauinflamatorie
- uretritanegonococic~
- uretritagonococic~
- uretritatuberculoas~
- uretrabulbar~
- stricturimultiple#i`nserie
2.Iatrogenic
- chirurgical
- instrumental
- cateterizare
248

Capitolul5.1.Explor~rileradiologicestandard

3.Traumatic~
- aparedup~ruptur~complet~,estemic~#iscurt~.

Uretritelegonococicesaunegonococice
Infec[iacugonococ`ncepe`nmucoasa#iglandeleperiuretraleLittre,laceinetrata[i
apareextensialocal~lauretraposterioar~,veziculeleseminalesauepididim.
Uretrita negonococic~ este diagnosticat~ c]nd exist~ inflama[ia uretral~, dar nu se
eviden[iaz~gonococul`nculturi,eaestemaicronic~dec]tceagonococic~#isecomplic~cu
stricturi `n 0,55% din cazuri. `n uretrita gonococic~ 70% este localizat~ la nivelul uretrei
bulbaredatorit~uneiconcentra[iimarideglandeperiuretraleaici.
Radiologicseutilizeaz~uretrografiamic[ional~,catimpalurografieiintravenoasesau
aluretrografieiretrograde,metodecarevorpune`neviden[~stricturiuretrale.Acesteapot
fimultiple,scurtesaudec][ivacentimetri;frecvent,stricturilesunt`nserie.
Deasemenea,uretrografiapoateopacifiaglandeleLittre`nprezen[aunorasemenea
stricturidatorit~dilata[ieiinflamatoriiaostiumuluiductal,poatedemonstraprezen[areflu
xului`nductesaulanivelulglandelorproximaldestrictur~.
Uretrita gonococic~ determin~ hiperplazie a mucoasei rezult]nd uretrit~ polipoid~
sauchistic~,ceaparecadefectedeumplerenodularesauplatefiindgreudediferen[iatde
carcinom.

Uretritatuberculoas~
Aparela2%dinceicutuberculoz~detracturinar,fiindposibil~#iextensiadirect~de
laprostat~lauretraprostatic~saudin[esutulperineallauretrabulbar~.
Tuberculoza avansat~ a uretrei #i [esutului perineal produce numeroase traiecte
fistuloasedinuretr~`n[esuturilemoiperineale.

Stricturaiatrogenic~
Apare frecvent `n por[iunea uretrei care anatomic este fix~ #i `ngustat~ (mem
branoas~ #i jonc[iunea penoscrotal~ a uretrei anterioare), ea nu are caracteristici radio
logice,poatefifocal~#iscurt~,multifocal~saulung~.

Stricturaposttraumatic~
Acesttipdeleziunedeobiceiesteunic~,subdoicmlungime,#iflancat~desegmen
teuretralenormaleca#icalibru,tipiceleseformeaz~mairapidcaceleinflamatorii.

Complica[iileobstruc[ieiuretralesecundarestricturiisuntreprezentatede:
abcesperiuretral
pseudodiverticul
fistula
extravazareaurinei
intravazareavenoas~
pasajfals
reflux`nducte#iglande.

Defectedeumplereauretrei

Cauzelecedetermin~defectedeumplerelaniveluluretreisunt:
1.Comune

249

TratatdeUrologie

- calculi
- polipi
2.Rare
- carcinomul
- condilomatozaacuminata
- uretritapolipoid~
- malacoplakia
- uretritachistic~
- metastaze
- amiloidoz~.

Polipulfibros
Cunoscut #i ca polipul congenital, este frecvent pedunculat, cu baza l]ng~ verum
montanum,radiologicaparecaundefectdeumplerebinedefinit,neted,decirca11,5cm,
estemobillamic[iune#ipoatedeterminaobstruc[ieinfravezical~.

Papiloamele
Sunttumoribenigne,calocalizaresuntfrecvente`nfosanavicular~#iparameatalla
b~rba[i #i `n 1/3 distal~ la femei, ele apar uretrografic ca defecte de umplere unice sau
multiple,netede,sesile.

Carcinomuldeuretr~
Caracteristicilecarcinomuluideuretr~sunt:
25orimaifrecventlafemeidec]tlab~rba[i
2/3originaredinuretrabulbomembranoas~
seasociaz~custricturauretreianterioare
75%estecarcinomcucelulescuamoase
15%estecarcinomcuceluletranzi[ionale.

Carcinomuldeuretr~feminin~
Estesinguramalignitateepitelial~atractuluiurinarcareestemaifrecvent~lafemei
dec]t la b~rba[i, apare la v]rste cuprinse `ntre 4060 ani, factorii favorizan[i sunt irita[iile
cronice#iinflama[iile.
Adenocarcinomul este cea mai frecvent~ malignitate care apare `ntrun diverticul
uretral.
Radiologicaparecadefectedeumplereunicesau`nserieneregulateeviden[iatela
uretrografie.Radiologicsepotpune`neviden[~#istricturi,daracesttipdeleziuneesterar~.
Pentru a stabili extensia local~ a tumorii #i cea ganglionar~, trebuie evaluat~ prin
examencomputertomograficsauIRM.
Diseminarealimfatic~apare`nainteaceleihematogene,carcinoamelecuoriginea`n
1/3 distal~ se extind preferen[ial `n ganglionii inghinali superficiali #i profunzi, iar cele cu
originea`n2/3proximaleseextindpreferen[ial`nganglioniiiliaciinterni#iexterni.

Carcinomuldeuretr~masculin~
Este aproape exclusiv prezent la persoanele cu v]rsta de peste 50 ani, 80% din ele
suntcarcinoamecucelulescuamoase,iar2/3`#iauoriginea`nuretrabulbar~saumembra
noas~#imajoritateaseg~sesc`nuretraanterioar~,`nspeciallanivelulfoseinaviculare.15%
din carcinoamele de uretr~ la b~rba[i sunt carcinoame cu celule tranzi[ionale #i `#i au
originea`nuretraposterioar~.
250

Capitolul5.1.Explor~rileradiologicestandard

Diagnosticulestepusprinuretrografiesauuretroscopie,carcinomuluretrallab~rba[i
apare ca un defect de umplere neregulat, care poate fi excentric sau circumferen[ial, este
suspectatc]ndmarginilestricturiisuntneregulate#iprostdefinite.
Diseminareaesteini[iallimfatic~,carcinomuluretreipenienedisemineaz~`ngangli
oniiinghinaliprofunzi#iiliaciexterni#iceaauretreibulbare#iposterioaredisemineaz~`n
ganglioniiiliaciinterni#iobturatori.

Condilomatozaacuminat~
Are transmitere sexual~, 5% din cei cu condilomatoz~ penian~ dezvolt~ leziuni
uretrale, care de obicei se limiteaz~ la uretra anterioar~, ea precede sau este prezent~ la
16%dinfemeilecucarcinomcucelulescuamoasedevulv~,radiologicaparecadefectede
umpleresesile,multiplealeuretreianterioare.

Metastazeleuretrale
Apar prin contiguitate de la neoplasmele de vezic~ urinar~ sau colorectale, de
asemenea,poatefiinvadat~secundardecanceruldeprostat~,cervical#ivaginal.

Imaginiadi[ionalealeuretrei

Clasificare:
1.Comune (pseudo)diverticul
- fistula
2.Rare
ducteleCowpersaugland
- glandeleLittre
- vestigiimlleriene(utriculsauchistmllerian).

Prostata

Carcinomuldeprostat~
Urografiaintravenoas~,`ntimpiis~itardivi,vaeviden[ia`ncarcinomultipicinfiltra[ie
difuz~ a glandului, care `ngusteaz~ uretra at]t `n diametrul anteroposterior, c]t #i lateral,
frecventlungimeauretreicre#te,astfel`nc]tcistografiaarat~`ngustareacupierderealiniei
normale,potfiprezente,deasemenea,neregularit~[idealunguluretrei,iarc]ndinvadeaz~
VU,aceastavaprezentadefectedeumplerecuconturneregulat.

EvaluareastadiilorC#iDalecanceruluideprostat~:
1. diseminareaextracapsular~
ecografietransrectalcubiopsie
RMcuanten~endorectal~
2. noduliimetastatici
CTsauRM
biopsiepercutan~dac~ganglionul
estemaimarede10mm
disec[ielaparoscopic~sauchirurgical~
3. metastazeosoase
testulantigenicspecificprostateiini[ial
apoiCTdeoase.

Fig.43.Cancerdeprostat~,diverticulevezicale.

251

TratatdeUrologie

Hiperplaziaprostatic~benign~
UIV este utilizat pentru evaluarea tractului urinar superior #i a vezicii urinare,
majoritatea modific~rilor g~site sunt chisturi benigne renale, diverticulele vezicii urinare,
gradediferitedeobstruc[ie#ilitiaz~renal~.M~rireaprostateidetermin~ridicareatrigonului
vezical, rezult]nd ridicarea, devin drepte ca traiect #i `n final forma de J a ureterelor
distale. Datorit~ hipoperistaltismului ureteral secundar obstruc[iei medii de la nivelul
jonc[iunii ureterovezicale, `ntregul traiect ureteral se vede pe un singur film urografic;
aceasta se nume#te hipotonie ureteral~. Dac~ obstruc[ia la nivelul jonc[iunii este sever~,
atunciaparedilata[iaureteral~#idup~untimp`ndelungatureteruldevinetortuos.Dac~se
complic~cunefropatieobstructiv~,atunciaparedilata[iapielocaliceal~cuatrofiecortical~.
Timpulcistografic alUIVapreciaz~dimensiunile,conturul pere[ilorveziciiurinare#i
impresiunea prostatic~. Trabecula[ia #i prezen[a sacula[iei pere[ilor vezicii urinare se
coreleaz~cuobstruc[iasubvezical~cronic~#iindic~hipertrofiadetrusorului.Deasemenea,
pot ap~rea diverticule vezicale urinare, care se afl~ cel mai des posterior #i superior de
trigonlajonc[iuneaureterovezical~#ilaniveluldomuluivezical.
Hiperplazia prostatic~ benign~ determin~ de obicei o amprent~ bine definit~ dea
lungul podelei vezicii urinare (marginea inferioar~), se poate observa un contur neregulat
saunodular,careridic~`ns~suspiciuneadecancersausepoatevedeaundefectdeumplere
mairotunddeterminatdem~rireaa#anumituluilobmediansaulobulAlbarran(subcervical)
caremimeaz~omas~intraluminal~veziciiurinare.
Absen[a reziduului postmic[ional nu exclude
obstruc[iasubvezical~pentruc~hipertrofiadetrusorului
poateficompensat~decre#terearezisten[eilaie#ire.
Cistouretrografia mic[ional~ este performant~
doar c]nd se suspecteaz~ reflux vezicoureteral sau pen
tru informa[ii mai precise despre localizarea #i dimen
siunilediverticulilorveziciiurinare.

Fig.44.Adenomdeprostat~.

Prostatita
Clasificareaprostatiteloresteurm~toarea:
1. prostatit~acut~
2. prostatit~cronic~
3. prostatodinia.

Prostatitaacut~

Radiologic, pe RRVS se pot pune uneori `n eviden[~ prezen[a calculilor pe aria de


proiec[ieaprostatei,carepotfisolitarisaudifuzi.Deasemenea,cre#terea`ndimensiunia
prostatei din cadrul acestei afec[iuni poate determina o amprent~ regulat~ pe conturul
inferior al vezicii urinare, vizibil~ la examenul cistografic. De asemenea, dac~ gradul de
obstruc[iealveziciiurinareestesemnificativ,cistografiamaipoateeviden[iaovezic~urinar~
destins~,iarreziduulpostmic[ionalpoatefi`ncantitatemare.

Prostatitacronic~#iprostatodinia

Sunt diagnostice clinice #i ale examenelor de laborator, imagistic fiind imposibil de


eviden[iatunastfeldediagnostic.
252

Capitolul5.2.Investiga[iaultrasonografic~

Capitolul

5.2.INVESTIGA[IA
ULTRASONOGRAFIC~

Dr.ADRIAND.ST~NESCU

Dr.ANCACRISTINACHIRION

253

TratatdeUrologie

Cuprins:

1.Introducere.No[iunideultrasonografie255

2.Anatomiaultrasonografic~255

3.Anomaliicongenitalealetractuluigenitourinar258

4.Artefactecemimeaz~opatologierenal~ 264

5.Patologiainfec[ioas~ 265

6.Uropatiaobstructiv~ 270

7.Litiazarenal~ 270

8.Nefrocalcinoza271

9.Litiazavezical~271

10.Patologiatumoral~273

11.Traumatismele282
12.Leziunilevasculare283

13.Rinichiultransplantat 286

14.Prostata290

15.Altetipuridepatologievizibilecuecografiatransrectal~295
16.Canceruldeprostat~ 295

17.Organelegenitalemasculineexterne 297
18.Aspecteecografice`npatologiascrotal~#itesticular~298
19.Penisul307

Bibliografie309

254

Capitolul5.2.Investiga[iaultrasonografic~

1.Introducere.No[iunideultrasonografie

O explorare imagistic~ a aparatului urinar, `n zilele noastre, nu poate fi conceput~


f~r~ aportul ultrasonografiei, metod~ de vizualizare a structurilor corpului ce se bazeaz~ pe
emisiaultrasunetelor.Acesteasuntundemecanicecufrecven[ecedep~#esc20.000Hz(20
KHz),adic~pestepragulaudibilsuperior.`nultrasonografie,undispozitivnumittransductor
(sautraductor),`ncontactcutegumentul,emiteultrasunetecufrecven[e`nalte(deordinul
milioanelordeHz,adic~almegahertzilor)subform~depulsuriscurte.Totelrecep[ioneaz~
imediatultrasunetele,carese`ntorcsubform~deecouri,delastructuriledinprofunzime.
Fenomenul este posibil, deoarece corpul este alc~tuit din structuri cu densit~[i fizice mai
multsaumaipu[indiferite,fiecaresuprafa[~deseparare`ntredou~astfeldemediirepre
zent]ndloculundesuntgenerateecouri.
Denumit~#iecografie(posibilitateainscrip[ion~riiimaginilorcuajutorulecourilor),
ultrasonografia este, `n esen[~, o metod~ de apreciere a morfologiei unor organe #i
structuri,fiziologicesaupatologice.Reamintimc~vitezadepropagareaultrasuneteloreste
cunoscut~ (circa 1.540 m/sec. `n structurile din corp, cu diferen[e datorate densit~[ilor,
elasticit~[ii[esuturilor,temperaturiilordiferiteetc.)#i,cunosc]ndtimpulscursdelaemisia
undei #i p]n~ la recep[ia ecoului, se poate afla ad]ncimea la care se situeaz~ suprafa[a de
separare ce a generat acel ecou. `nsum]nd #i proces]nd cu ajutorul calculatorului toate
ecourilecese`ntorcdinprofunzimelaunmomentdat,sepoateob[ineoimagineasec[iunii
(atuturorsuprafe[elordeseparare)dinzona`ncaresefaceexplorarea.`nimagineaob[inut~
pemonitorulecografuluiserecunosc,`necografiabidimensional~,`ntimpreal,organele#i
structurilecudensit~[ifizicediferite,subformaunorimagini`ntonuridegri(fiindposibile#i
alteculoridestudiu).

Intensitatea tonurilor de gri este oarecum propor[ional~ cu densitatea structurilor


reprezentate pe ecranul aparatului. Structurile cu densitate mai mic~ sunt reprezentate `n
scaladegri,mai`nchiselaculoare(hipoecogene)cumaximumdeintensitateaculoriinegru
pentrustructurilichidiene(numite#itransonice).Structurilemaideschiselaculoare(numite
hiperecogenesaureflectogene)corespund,deobicei,structurilorcudensitatecrescut~,dar
#istructurilorcarecon[ingaze.

De#i se situeaz~ `n profunzime, ocup]nd la nivelul retroperitoneului lojele renale


(`mpreun~ cu glandele suprarenale, ureterele, gr~simea retroperitoneal~), rinichii sunt
suficient de mari pentru a fi u#or vizualiza[i ecografic, dac~ se alege o cale de abord
(fereastra de transmisie a ultrasunetelor) adecvat~. Fiind organe pereche, aprecierea unei
modific~ri morfologice unilaterale este u#urat~ prin compara[ie. Specialistul urolog care
practic~ ecografia trebuie s~ fie familiarizat cu structura normal~ complex~, #i astfel s~
poat~faceoapreciereexact~amodific~rilorpatologice.

2.Anatomiaultrasonografic~

Rinichii

Cuunaxlungmediulaadultde11cm(0,5cm),ogrosimemediede3,5cm(0,5
cm) #i un diametru transvers mediu de 5 cm ( 0,5 cm) (Gray H, 2000), rinichiul este un
organperechesituat`nretroperitoneu,`ntrefasciaGerota#ifasciaZukerkandl,deoparte#i
dealtaacoloaneivertebraletoracolombare.Fiziologic,seadmiteodiferen[~decirca11,5
cm `n plus pentru axul lung al rinichiului st]ng fa[~ de cel drept, explicat~ prin prezen[a
255

TratatdeUrologie

ficatuluipeparteadreapt~(ceeacear`mpiedicadezvoltarearinichiuluidrept)sauprinfluxul
arterialrenaldiferit(Fig.1).
Ambii rinichi sunt angula[i at]t `n
plan sagital, c]t #i axial. Parenchimul
hepaticpentrurinichiuldrept#i`ntromai
mic~ m~sur~ (`n caz de splenomegalie)
parenchimulsplenicpentrurinichiulst]ng
ofer~ ferestre bune de transmisie pentru
explorareacuultrasunete.Colonulascen
dent#idescendentestesituatanteriorde
rinichiul drept #i, respectiv, st]ng, f~c]nd
adesea imposibil~ vizualizarea lor printr
unabordanterioratuncic]ndcadrulcolic
estedestinsdegaze.
Fig.1.Vasculariza[ienormal~`nregiunea

hiluluilaexamenulDopplercolor.

Cursa respiratorie a rinichilor, de circa 23 cm, face ca uneori polul superior al


ambilorrinichi(`nspecialcelst]ng,ceareopozi[iefiziologic~maicranial~cu12cmfa[~de
rinichiul drept) s~ se vizualizeze ecografic doar `n inspir for[at. Rinichiul situat `n pozi[ie
normal~prezint~convexitateamaxim~lateral#iou#oar~convexitateafe[eianterioare#i
posterioare.Medial,rinichiulareunconturconcav,aicifiindvizualizateelementelehilului.

Ceea ce remarc~ ecografistul `n primul r]nd este sistemul colector, mai ales dac~
acestaprezint~ungraddedistensie(pelvisulrenal#iinfundibululcaliceal)(Fig.2).

Interfa[a de separare `ntre pelvis


#i urin~, ca #i cantitatea de gr~sime din
jurul pelvisului renal fac aceast~ regiune,
denumit~ `n buletinele ecografice ca
regiunea (sau zona) pielocaliceal~, s~
apar~
foarte
reflectogen~
(sau
hiperecogen~). Regiunea pielocaliceal~
estepar[ialcircumscris~(superior,inferior
#i lateral) de parenchimul renal, format
din piramidele medulare #i cortexul
renal.

Fig.2.Dilata[iasistemuluipielocaliceal.

La r]ndul lui, cortexul prezint~ o por[iune periferic~, ce con[ine glomerulii renali,


situat~imediatsubcapsularenal~,#itrimitemaimulteprelungirispreinteriorulrinichiului,
cunoscute sub numele de coloane Bertin #i intercalate printre piramidele medulare. Pira
midele medulare con[in tubuli renali, vase de s]nge #i [esut de sus[inere #i sunt mai
hipoecogene (slab reflectogene) dec]t cortexul renal #i coloanele Bertin. La r]ndul lor,
acestea din urm~ sunt mai hipoecogene dec]t regiunea pielocaliceal~ nedestins~ de urin~.
Diferen[a cea mai pregnant~ apare `ntre piramidele medulare (hipoecogene) #i regiunea
pielocaliceal~(hiperecogen~).Esteunuldinmotivelepentrucare,uneori,piramidelemedu
lare,datorit~hipoecogenit~[iilor,suntconfundatecustructurilichidiene(calicedestinsesau
256

Capitolul5.2.Investiga[iaultrasonografic~

forma[iuni chistice). Alteori, hiperecogenitatea fiziologic~ a structurilor vasculare #i a


gr~simiidinregiuneapielocaliceal~ridic~suspiciuneaexisten[eiunorcalculilaacestnivel.`n
mod normal (c]nd nu sunt procese patologice difuze care s~ produc~ modific~ri de
ecodensitate), cortexul renal este u#or mai hipoecogen dec]t parenchimul hepatic (Dalla
Palma I, 1990). Rinichiul prezint~ o capsul~ proprie, sub[ire, fibroas~, vizibil~ ecografic
datorit~diferen[eidedensitatefa[~decortexulrenal#ifa[~degr~simeaperirenal~.

Particularit~[ileanatomoecograficealerinichiuluilanoun~scut#icopil

Diametrul maxim (axul lung) al rinichiului la noun~scutul la termen este de circa 5


cm`nprimalun~devia[~,elcresc]ndprogresiv,astfelc~lav]rstadeunanajungelacirca6
6,5cm.Ulterior,rinichiulcre#temailent,axullungm~rindusecucirca11,5cmlafiecare4
5 ani (circa 8 cm la 6 ani, 9 cm la 10 ani, 10 cm la 16 ani) (Hayden CK Jr, 1984). La copil,
vizualizarea rinichilor este u#urat~ de apropierea lor de suprafa[a corpului. Cantitatea de
gr~sime mai redus~ la nivelul pelvisului renal, comparativ cu adultul, face ca regiunea
pielocaliceal~s~fiemaipu[inreflectogen~, fiindadeseau#ordestins~.Serealizeaz~astfel
aspectul `nt]lnit la adultul bine hidratat. `n acela#i timp, la copil, corticala apare mai
hiperecogen~difuzprinconcentra[iacrescut~deglomeruli#i,implicit,deghemuricapilare.
Piramidele medulare sunt mai mari dec]t la adult #i au un aspect mai hipoecogen put]nd
creafoartefrecventconfuziicustructurilichidiene.

Ureterul

De#ilaadultesteunconductmuscularcuolungimedecirca3034decm(Bechtold
RE, 1996), diametrul redus (36 mm) #i traiectul profund fac ca ureterul normal s~ fie
vizualizat ecografic doar `n anumite situa[ii (sisteme ecografice performante, lipsa
interpozi[ieidegazedintubuldigestiv).Aproapeconstant,ureterulnormalsevizualizeaz~`n
treimeasuperioar~imediatsubjonc[iuneapieloureteral~(peuntraiectdec][ivacentimetri)
#i `n treimea inferioar~, la nivelul micului bazin, precum #i la intrarea `n peretele vezical.
Atuncic]ndnuestefoartecudat,traiectulureteruluipeflancuripoatefiinterceptatprintro
sec[iune coronaloblic~, paralel cu marginea intern~ a mu#chiului psoas. La nivelul micului
bazin,un reperanatomicimportant`ng~sireaureteruluiestearterailiac~comun~(uneori
artera iliac~ extern~) pe care ureterul o `ncruci#eaz~, trec]nd anterior de acestea (Dalla
PalmaI,1990).

C]nd este destins, ureterul se


poatevizualizarelativu#orpetottraiec
tul,adeseap]n~lanivelulobstruc[iei.
Totu#i, pentru a avea certitudi
nea c~ structura investigat~ este urete
rul #i nu o structur~ vascular~, exame
nul Doppler este binevenit (Fig.3). `n
lipsa lui, se indic~ cercetarea ureterului
de la limita cranial~ (din bazinet) sau
caudal~ (inser[ia `n vezic~), urm~rind,
prin sec[iuni longitudinale seriate din
aproape `n aproape, tot traiectul vizibil
alacestuia.
257

Fig.3.`nhilulrenal,examenulDoppler
diferen[iaz~vaseledeureteruldilatat.

TratatdeUrologie

Vezicaurinar~

Esteunorgancavitar,aproximativsfericatuncic]ndesteumplut~cuurin~#ipoatefi
vizualizat~ `n pelvis, posterior de simfiza pubian~ ca o structur~ transonic~ cu un perete
propriu.Peretelevezicalareogrosimeuniform~decirca46mmpetoat~`ntinderea,nemo
dificat~cuv]rsta(AmiesESJr,1991;JequierR,1987).Grosimeapereteluivezicaldifer~u#or
(12mm)`nfunc[iedegraduldedistensievezical~.
Abordulecograficalveziciisefacesuprasimfizar,prinsec[iunitransversale#isagitale,
suficient de `nclinate anteroposterior (transductor orientat retrosimfizar) pentru a putea
explora#iovezic~par[ialumplut~.
`n vezic~, cele dou~ orificii ureterale,
`mpreun~cuceldealtreileacorespunz]nd
uretrei, formeaz~ trigonul vezical (Amies
ES,1987).Celedou~orificiiureteralefiind
locul pe unde urina intr~ `n vezic~, pot fi
identificate prin examen Doppler color ce
detecteaz~ flux intermitent la intrarea
urterelor`nvezic~(Fig.4).Orificiulureteral
corespunde colului vezicii urinare. La
b~rbat, peretele inferior al vezicii urinare
se afl~ `n contact direct cu (uneori
amprentat de) prostata, `n vreme ce la
femeie peretele posterosuperior poate fi
amprentatdeuter.

Fig.4.Jeturinarintravezicallanivelulmeatuluiureteral.

Estemotivulpentrucare,atuncic]nd exist~suspiciunea unormodific~rialeacestor


organe (ex.: de la o patologie de vecin~tate), se indic~ o ecografie transrectal~ sau trans
vaginal~.

Pentruapreciereareziduuluivezical,trebuiereamintitc~debitulurinar`nvezic~este
decirca12ml/min,ceeacefacenecesar~m~surareareziduuluiimediatdup~golireavezicii.
Unreziduuvezicalmaimicde1015mlesteconsideratfiziologicat]tlaadult,c]t#ilacopil.

Uretra

Uretramasculin~estede24orimailung~dec]tceafeminin~,av]ndtreisegmente
descrise:prostatic~,membranoas~#ipenian~.Lungimeatotal~auretreimasculinevariaz~
cuv]rsta#italia,fiindcuprins~`ntre8cmlacopil#icirca20cmlaadult.
La femeie, uretra m~soar~ 45 cm #i poate fi v~zut~ ecografic prin metoda trans
vaginal~sautransperineal~.
Transperineal sau transrectal poate fi v~zut~ #i uretra masculin~ (prostatic~ #i
membranoas~),segmentulpenianput]ndfiexaminatlanivelulpenisului`nsec[iunilongitu
dinalesautransverse.
Pentruomaibun~vizualizareserecomand~compresiaintermitent~auretreidistal,
pentru a observa distensia tranzitorie a uretrei `n amonte de nivelul compresiei (Doubilet
PM,1991).
258

Capitolul5.2.Investiga[iaultrasonografic~

3.Anomaliicongenitalealetractuluigenitourinar

Hipoplaziarenal~

Reprezint~oanomalieaparenchimuluirenal,caracterizat~prinsc~dereanum~rului
de nefroni. Este mai frecvent unilateral~, rinichiul afectat fiind de dimensiuni reduse (`n
generalcuaxullungmaimicde5cm).
Pentrudimensiunilesale,rinichiulafectatareofunc[ieacceptabil~,apreciat~celmai
binescintigrafic,prinstudiicuaciddietiltriaminopentaacetic(DTPA)cuplatcutechnetium
metastabil(99mTc).
Se ob[ine o nefrogram~ izotopic~ pe care se pot aprecia parametri diferi[i: faza de
perfuzierapid~,perfuzialent~corespunz]ndp~trunderiiradiotrasorului`nglomeruli,nivelul
maximalradioactivit~[iicomparative#icurbadeexcre[iearadiotrasoruluidinambiirinichi
(DominguezFC,2006)(Fig.5).

Studiul ecografic poate


uneori s~ nu pun~ `n eviden[~
rinichiulhipoplazic,dincauzadi
mensiunilorreduse,interpozi[iei
de gaze din tubul digestiv,
asocierii cu ptoza sau ectopia
etc.Pentruanufaceconfuziecu
agenezia renal~, `n continuarea
unui examen ecografic negativ
pentru depistarea unui rinichi,
este necesar~ o alt~ investiga[ie
imagistic~ cu substan[~ de con
trast(FriedlandGW,1990).

Fig.5.Scintigrama(nefrograma)izotopic~cu99mTcDTPA.

Aspectulcurbelorderadioactivitatecorespunz]ndp~trunderiiradiotrasorului`nrinichi(curba

ascendent~),captareamaxim~#iexcre[iaradiotrasorului(curbadescendent~).Seremarc~

aspectulsimetricalcurbelorpentruceidoirinichi(captare#iexcre[ienormal~).

Hipertrofiarenal~compensatorie

Reprezint~ o modificare a parenchimului renal normal, care cre#te `n volum cu


scopul da a suplini func[ia altor zone de parenchim sau a unui `ntreg rinichi contralateral
afectatdeunprocespatologicsauexcluschirurgical.Hipertrofiacompensatoriesemanifest~
focalsaudifuz,laun`ntregrinichi.
Formadifuz~`nso[e#tedeobiceidisplazia,hipoplaziasauageneziarenal~unilateral~.
Se mai poate `nt]lni `n transplantul renal (apare hipertrofia fiziologic~ a grefonului dup~
minimumdou~s~pt~m]nidelatransplant)(SchwengerV,2006).
Forma focal~, numit~ #i hipertrofie compensatorie nodular~, `nso[este adesea
nefropatiadereflux.
Ecograficsuntdescrisezonedeparenchim`ngro#at,custructur~normal~,intercalate
printrezonecicatriciale(zonecuparenchimabsentsauabruptdiminuat#ihiperecogenprin
fibroz~local~).
259

TratatdeUrologie

Ageneziarenal~

C]nd este unilateral~ este compatibil~ cu via[a, subiectul av]nd o func[ie renal~
acceptabil~,prinhipertrofiadifuz~compensatorie.Diagnosticulecograficdeageneziepoate
fistabilitdup~ceecografistulaexclusohipoplazie,oectopiesauoptoz~renal~,cuajutorul
uneiinvestiga[iiscintigraficesauradiologicecusubstan[~decontrast.

Un element ecografic care s~ sus[in~ diagnosticul de agenezie, pe l]ng~ absen[a


vizualiz~rii rinichiului, `l reprezint~ absen[a fluxului urinar (la examenul Doppler color) `n
zonaorificiuluiureteralvezicaldeparteaincriminat~.
Men[ion~mc~lipsavizualiz~riioriginiidinaort~aartereirenaledeparteaexaminat~
nureprezint~uncriteriudecertitudine,arterarenal~put]ndaveaorigineadintrunpachet
vascularmaredevecin~tate`nsitua[iauneiectopiirenale.

De remarcat c~ `n situa[ia ageneziei renale, glanda suprarenal~ poate lipsi #i ea de


aceea#iparte,`np]n~la17%dincazuri(FriedlandGW,1990).

Ocazional,ageneziarenal~poateficonfundat~ecograficcuectopia`ncruci#at~.

Ectopiarenal~`ncruci#at~

Esteomalforma[ierar~,inciden[apestudiilenecropticefiinddecirca1cazla1.500
autopsii(FriedlandGW,1990).
Ambii rinichi se situeaz~ de
aceea#iparte,`nlojarenal~sauflanc,`n
majoritatea cazurilor (90%) produc]ndu
se o fuziune `ntre polul superior al rini
chiului ectopic #i polul inferior al rini
chiuluinormalpozi[ionat.
Ecografic se descrie unilateral un
rinichi mare cu dou~ zone pielocaliceale
distincte #i parenchim de grosime nor
mal~ (Fig.6). Aspectul, uneori, poate fi
confundat cu duplicitatea pielocaliceal~,
un element care face diferen[ierea fiind
prezen[arinichiuluicontralateral`ncazul
Fig.6.Ectopiecufuziune`ncruci#at~
duplicit~[iipielocaliceale.
ambiirinichifuziona[i`nlombadreapt~.

Duplicitateapielocaliceal~

Esteconsiderat~dec~treuniiautoriovariant~anatomic~,iardeal[iidreptceamai
frecvent~anomaliecongenital~.Rinichiulprezint~gradediferitededuplica[ie.Inciden[a`n
popula[iageneral~difer~pestudiilestatistice,fiindcuprins~`ntre0,5#i10%(FriedlandGW,
1990).
Oduplicitatecomplet~presupuneexisten[aadou~sistemecolectoareseparate#ia
dou~ureterediferiteceseimplanteaz~`nvezic~independentunuldealtul.
`nduplicitateaincomplet~,ureterelefuzioneaz~`ntrunulsingur,cuunsingurorificiu
dev~rsare`nvezic~.
260

Capitolul5.2.Investiga[iaultrasonografic~

Fig.7.Duplicitatepielocaliceal~.

Seobserv~dou~regiunipielocalicealedistincte.

Ecografic,duplicitateapielourete
ral~ se vizualizeaz~ ca dou~ zone pielo
calicealedesp~r[iteprintroband~trans
versal~ de parenchim cu structur~ nor
mal~, ce ajunge `n hilul renal, rinichiul
fiind de obicei m~rit de volum (Fig.7).
Mai rar, aspectul poate fi `nt]lnit bilate
ral. Gradul de duplica[ie (complet~ sau
incomplet~)nupoatefi,celmaiadesea,
stabilit ecografic, pentru aceasta fiind
necesarunstudiuimagisticcusubstan[~
decontrast.

Ectopiarenal~

Rinichiulectopicpoatefisituatoriunde(dintoracep]n~`npelvis)(DabiriL,2006).Cel
maifrecvent,rinichiulectopicsesitueaz~`npelvis,`nvecin~tateavezicii,#iapareecografic
de dimensiuni variabile. Rinichiul poate fi de dimensiuni normale sau reduse (c]nd aportul
vascular este dificil), rar de dimensiuni crescute prin supraad~ugarea unui grad de
hidronefroz~.Deobicei,ectopiaesteasociat~cumalrota[ia.

Malrota[iarinichilor

Exist~gradediferitedemodificareapozi[ieirelativeabazinetului#iajonc[iuniipielo
ureterale fa[~ de rinichi. Aspectele ecografice difer~, explorarea cu ultrasunete put]nd s~
descriedelamodific~riminorealeaxelorrenalep]n~laorientareaanterioar~saulateral~a
bazinetului#iureterului.

Rinichiulsupranumerar

Anomaliaestefoarterar~#ipresupuneexisten[aunuialtreilearinichi,dedimensiuni
reduse,cuopozi[ievariabil~fa[~deunuldintrerinichiinormali.Diagnosticulecograficeste
`ngreunat de dimensiunile reduse ale rinichiului supranumerar #i de con[inutul redus `n
calice, ceea ce `l face mai greu de recunoscut ca structur~ renal~, rinichiul supranumerar
put]nd fi uneori confundat cu procese patologice retroperitoneale (tumori, ganglioni)
(FriedlandGW,1990).

Rinichiul`npotcoav~

Apare prin fuziunea rinichilor la unul dintre cei doi poli. Cel mai frecvent (95%),
fuziuneaareloclapolulinferioralcelordoirinichi.Ecografic,dup~vizualizareaunuirinichi,
se pune `n eviden[~ o prelungire sub forma unui istm ce face leg~tura cu rinichiul
contralateral. Istmul este format din parenchim renal func[ional sau [esut fibros #i are o
direc[ie transversal~, anterior de vasele mari abdominale (Friedland GW, 1990) (Fig.8).
Anomaliapoatefiacompaniat~dealtemodific~ri,maifrecventdeobstruc[iapieloureteral~,
carepredispunelainfec[ii,litiaz~#iuneorihidronefroz~secundar~(TalnerLB,1990).
261

TratatdeUrologie

Fig.8.Rinichi`npotcoav~.
Seremarc~istmulparenchimatos

plasatanteriordevaselemari

abdominale.

Ecografic,primulsemncareatrageaten[iaestepozi[iarinichilor,ace#tiafiindsitua[i
maimedialfa[~depozi[ianormal~,alipi[icoloaneilombare.Uneori,rinichiisuntdoar`ncli
na[i`nplancoronal,cupolulinferiororientatmedial.Decelemaimulteori,exist~#iungrad
de asimetrie `n dimensiuni renale. Vizualizarea istmului stabile#te diagnosticul ecografic,
de#iadeseaaten[iaecografistuluipoatefiatras~delitiaz~#ihidronefroz~frecventasociate.
Exist~#ialteanomaliiurogenitalecepot`nso[irinichiul`npotcoav~(duplicitateasistemului
colector,rinichisupranumerar,uretersituatretrocav)saugenerale(atrezieesofagian~,fistu
l~anorectal~,malforma[iialescheletuluisaucardiovasculare).

Ureterulretrocav

Aparec]ndpor[iuneainfrarenal~aveneicaveinferioarearealt~surs~dedezvoltare
embrionar~, provenind din vena subcardinal~ (`n loc de vena supracardinal~). Afec[iunea
estemaifrecvent`nt]lnit~lasexulmasculin.Ecograficsepoateurm~riuneoriureteruldrept
`nprimapor[iune,c]ndtreceposteriordevenacav~inferioar~,apoisesitueaz~medialde
venacav~,`ntreaceasta#iaort~,`ncruci#]nd`nfinalvaseleiliacedrepte(MooreKL,1993).

Megaureterulcongenital

Reprezint~odilatarefuziform~aureterului,constant~`ntreimeadistal~,vizibil~eco
grafic. P]n~ la 50% din pacien[ii cu megaureter congenital prezint~ afec[iunea bilateral
(VargasB,1986)#isunt`nmajoritatedesexmasculin.`ntruc]tafec[iuneainduceunobstacol
func[ional,sepoateasociacuungraddedilata[ieabazinetului#iacaliceloripsilateral.Zona
dilatat~dinureteresteaperistaltic~,fenomengreudepus`neviden[~ecografic.Afec[iunea
este confundat~ cu o ureterohidronefroz~, mai ales c]nd este prezent~ o ectazie pielocali
ceal~de`nso[ire.

Megacalicelecongenital

Se prezint~ ca o dilatare a grupelor caliceale, `n absen[a obstruc[iei. Imaginea eco


grafic~demonstreaz~distensiacalicelor,deobiceiunilateral~,`nabsen[adilata[ieiureteru
lui,rinichiulav]ndocortical~degrosimenormal~.Exameneleecografice,repetatelac]teva
s~pt~m]ni,arat~c~dilata[iacaliceal~nuesteprogresiv~.`nacela#itimp,pacientulprezint~,
din punct de vedere biologic, o func[ie renal~ normal~. Mai dificil de diagnosticat este
asocierea,dinfericiresporadic~,cumegaureterulcongenital(VargasB,1986),situa[iecare
ducelaconfuziicuuropatiaobstructiv~.

262

Capitolul5.2.Investiga[iaultrasonografic~

Anomaliicongenitalealeveziciiurinare

Extrofiavezical~

Apareprintrolips~dedezvoltareintrauterin~amezodermuluisubombilical,carese
vamanifestaprintroabsen[~apereteluiabdominallaacestnivel,ca#iapereteluivezical
anterior.Astfel,vezicaurinar~comunic~directcuexteriorul,examenulclinicfiinddeobicei
suficientpentruastabilidiagnosticul.Bolnavulexaminatestederegul~uncopil,malforma
[iafiinddedou~orimaifrecvent~lab~ie[i(MooreKL,1993).Explorareaecografic~seindic~
maialespentruadepistaasocieriposibilecualtemalforma[iideaparaturinar.

Ageneziavezical~

Ecograficsemanifest~prinimposibilitateavizualiz~riiveziciiurinare.Estedescris~`n
pu[inecazuri,maiales lacopiiidesexfeminin #ideobicei `nasocierecualtemalforma[ii.
Foarterar~,aceast~malforma[ietrebuiediferen[iat~`nprimulr]nddeositua[iefiziologic~
reprezentat~delipsadeurin~`nvezicaurinar~dup~mic[iunesaucaurmareaunorprocese
patologice,merg]ndp]n~lainsuficien[~renal~.Uneori,pentrucertitudineaabsen[eivezicii
urinare se recomand~ cateterizarea uretral~ #i introducerea unei cantit~[i variabile de ser
fiziologic,`n `ncercareadeadestindeo eventual~vezic~, altfelimposibildevizualizat eco
grafic(TortoraFLJr,1983).

Vezicadubl~

Seproducefieprinexisten[aunuibenzitransversalede[esutmuscular,fieprintrun
sept orientat coronal sau sagital (adesea multiplu) sau printrun fald peritoneal ce separ~
dou~vezicideobiceiinegale(MooreKL,1993).

Vaserenaleaberante

Pe parcursul evolu[iei embriologice a rinichiului din faza de pronefros `n cea de


metanefros(rinichidefinitiv),seproduce#iascensiuneatreptat~aacestuiorgansprepozi[ia
definitiv~`nlojarenal~.Petraiectuldemigra[ie,rinichiisuntvasculariza[isuccesivdevasecu
origineadinaort~,vaseleinferioareobliter]ndusepem~sur~cesedezvolt~celesuperioare.
Dac~vaseleinferioarenudispar,elevordana#tereunorartererenaleaberante(MooreKL,
1993).Acestevase`ncruci#eaz~ureterul(seobserv~celmaibinelaexamenulDopplercolor)
#i`lpotcomprima,av]nddreptconsecin[~apari[iaunorgradediferitedeobstruc[ie.

Anomaliideurac~

Uracaseoblitereaz~fiziologic`ntrimestrulaltreileadesarcin~.Dac~nuseproduce
obliterarea,aceastasepoatedatorauneiobstruc[iiuretrale.`nacestecondi[ii,uracapersist~
#irealizeaz~ocomunicare`ntrevezic~#iombilic.Esteceamaifrecvent~anomalie(Spataro
RF,1983)#isesemnaleaz~lasexulmasculindedou~orimaifrecventdec]tlacelfeminin.
Ecograficsepoatevizualizauntraseulichidiandediametruvariabil,situatpeliniamedian~,
imediatsubpereteleabdominalanterior,delaombiliclasimfizapubian~.ExamenulDoppler
negativelimin~confuziacuunvasaberantdepereteabdominal.

263

TratatdeUrologie

Simptomatologia clinic~. O mic~


cantitatedeurin~exteriorizat~lanivelul
ombilicului este cea care atrage ini[ial
aten[ia. Uneori, uraca se poate oblitera
par[ial (Fig.9). `n acest caz, uraca se
transform~ chistic pe traiect. Ecografic
sepoatedepistaoforma[iunelichidian~
pe fa[a posterioar~ a peretelui abdo
minalanterior,camlajum~tateadistan
[ei`ntreombilic#isimfizapubian~,f~r~
prezen[asemnaluluiDoppler`ninterior.

Fig.9.Chistdeurac~,forma[iunelichidian~peliniamedian~,caudaldevezica

urinar~,anteriordefunduluterului,`ncontactcupereteleabdominalanterior.

4.Artefactecemimeaz~opatologierenal~

Oseriedestructurirenale,`nanumitesitua[ii,potproduceimaginiartefactuale.Nu
estevorbadeanomaliicongenitale,sunt,maidegrab~,varianteanatomice,care,`nanumite
situa[ii,potfiinterpretateeronatdreptaspectepatologice.

Lobula[iafetal~prezent~fiziologiclacopil,poates~persistelaunelepersoane`n
propor[ievariabil~,ceatinge`nunelestatisticip]n~la50%dinpopula[ie(MooreKL,1993).
Rinichiul prezint~ un contur neregulat, cu mici indenta[ii ce p~trund `n parenchim, f~r~ a
ajunge la regiunea pielocaliceal~. Acest aspect diferen[iaz~ ecografic lobula[ia de aspectul
cicatricial,ocicatriceav]ndunaspectde pierdere abrupt~deparenchim.Lanivelulunei
cicatrici de parenchim, capsula renal~ ajunge `n contact direct cu regiunea pielocaliceal~,
fenomen ne`nt]lnit `n lobula[ia fetal~, unde parenchimul este de grosime cvasinormal~ la
nivelul indenta[iilor. Dac~ explorarea ecografic~ se dovede#te insuficient~ `n clarificarea
diagnosticului, pentru diferen[ierese recomand~ scintigrama renal~static~cu 99mTcDMSA
(aciddimercatosuccinic).`ncazullobula[iei,imagineascintigrafic~vademonstraexisten[ade
parenchim cu captare normal~ `n zona incriminat~, `n vreme ce o cicatrice cortical~ se
traducescintigraficprintroimaginelacunar~.

HipertrofiacoloanelorBertinocoloan~medular~m~rit~aparecaopseudomas~
cedeplaseaz~piramidele`nvecinate#iamprenteaz~regiuneapielocaliceal~.Nudep~#e#te
de obicei un diametru de 3 cm (Yeh HC, 1992) #i con[ine cortex renal cu ecostructur~
normal~.`ntruc]texist~#iuneletumorirenalecuaspectizoecogencuparenchimulrenal,se
`ncearc~ diferen[ierea unei hipertrofii de coloan~ Bertin de o astfel de tumor~ cu ajutorul
examenuluiDoppler.`ncazulhipertrofieidecoloan~Bertin,forma[iuneanumodific~traseul
vaselor din zona de parenchim suspectat~, vasculariza[ia `n forma[iune fiind similar~ cu
restulparenchimuluirenal.

Pentrucertitudine,explorareaecografic~sepoatecompletacuoscintigram~renal~
cu un radiofarmaceutic cu tropism tubular. `n situa[ia unei hipertrofii de coloan~ Bertin,
captarearadiofarmaceuticului`npseudotumor~estenormal~.

Cocoa#a de c~mil~ apare printro amprent~ a polului inferior al splinei asupra


marginii laterale a rinichiului st]ng, ce duce consecutiv la formarea unei proeminen[e pe
marginealateral~,cam`ntreimearenal~medie.Fiindvorbadeoforma[iuneizoecogen~cu
264

Capitolul5.2.Investiga[iaultrasonografic~

restulparenchimului,darcaredeformeaz~conturulrenal,seimpunediagnosticuldiferen[ial
cu o forma[iune tumoral~. `n cazul cocoa#ei de c~mil~, structura ecografic~ #i examenul
Doppler arat~ aspecte similare cu restul parenchimului renal. `n caz de dubiu, se poate
recurge tot la scintigrama cu 99mTcDMSA, ce va demonstra o captare normal~ `n cazul
cocoa#eidec~mil~.

5.Patologiainfec[ioas~

Pielonefrita

Apare ca o infec[ie acut~ printrun mecanism de progresie ascendent~ a agentului


patogen de la o infec[ie urinar~ cu localizare vezical~. Un alt mecanism `l reprezint~ o
`ns~m]n[arepecalehematogen~.Frecven[acrescut~lafemeiseexplic~prinparticularitatea
anatomic~ a uretrei, aceasta av]nd traiectul scurt, ceea ce favorizeaz~ primul mecanism
(PapanicolaouN,1996).Dup~unelestatistici,aproximativ2%dingravideprezint~unepisod
depielonefrit~`ntimpulsarcinii.
Clinic#iecografic(TalnerLB,1994)sedescriumaimulteformedepielonefrit~acut~:
formau#oar~practicf~r~expresieecografic~
formamedie
formaavansat~.
Progresia inflama[iei f~c]nduse de la bazinet spre parenchim, primele modific~ri
ecografice nespecifice constau `ntro `ngro#are a pere[ilor bazinetului #i nu sunt
`ntotdeaunasesizate.Formau#oar~#iceamediesecaracterizeaz~prininfiltratleucocitar`n
intersti[iulintertubular,ceeacenuproducemodific~rimorfologicerenalevizibileecografic.
Dac~ inflama[ia progreseaz~,
apar microabcese peribazinetal #i ulte
rior la nivelul piramidelor #i cortexului
renal. `n aceast~ etap~, microabcesele
nu au de obicei expresie ecografic~.
Examenul ultrasonografic pune `ns~ `n
eviden[~ un rinichi m~rit de volum, cu
parenchimul `ngro#at #i hipoecogen di
fuz (prin gradul de edem asociat). Se
maiconstat~odiminuareadiferen[ierii
`ntre cortical~ #i medulara renal~
(Fig.10).

Fig.10. Pielonefrit~,rinichim~ritcuestompareadiferen[ieriicortical~

medular~#ibazinet`ngro#at.

Microabceselepots~confluezeproduc]ndabceseparenchimatoasepatente,vizibile
ecografic (forma[iuni hipoecogene sau mixte cu nivel hidroaeric #i depozit hiperecogen
decliv).`nunelecazuriavansate,abceseleseextind`ngr~simeaperirenal~(WanKS,2007).

Pielonefritacronic~

Reprezint~onefrit~intersti[ial~`nac~reietiologiesereg~se#tefrecventnefropatia
dereflux.Asociereacuaceast~afec[iuneestecitat~`ncirca30%dincazuri,cupreponderen[~
265

TratatdeUrologie

lapacien[iidesexfeminin.Boalaevolueaz~multifocal,unisaubilateral.Atuncic]ndintere
seaz~ambiirinichi,evolu[iaestediferit~,realiz]ndunaspectasimetric.
Ecografic, rinichii sunt de dimensiuni reduse (asimetrici), conturul renal este
neregulat, realiz]nd un aspect pseudocicatricial. Corticala renal~ este de grosime redus~ #i
hiperecogen~datorit~fenomenelordefibroz~(MorehouseHT,1984).`ntruc]trefluxulurinar
`n tubii colectori se produce prin orificiile ductale incompetente, mai ales din papilele
ramificate, modific~rile au aspect polar, `ntruc]t astfel de papile se g~sesc la cei doi poli
renali.

Pielonefritaemfizematoas~

Secaracterizeaz~prinprezen[adegaz`nparenchimulrenal,rezultatdinmetabolis
mulagentuluipatogen.CelmaifrecventincriminatesteEscherichiaColi,urmatdeKlebsiella
#iPseudomonas(MorehouseHT,1984).
Boala apare mai ales la persoane
cu predispozi[ie la infec[ii, cum sunt
pacien[ii diabetici (Fig.11). Evolu[ia este
de obicei unilateral~. Ecografia nu este
metoda de elec[ie pentru aprecierea mo
dific~rilorparenchimatoase,datorit~bule
lor de gaz ce reflect~ majoritatea fasci
culului ultrasonor #i produc adesea con
fuzii cu calculi pielocaliceali. `n situa[ia
unorimaginigreuinterpretabileecografic,
serecomand~examenulCT.

Fig.11.Pielonefrit~emfizematoas~(s~ge[ileindic~miciabcese`nparenchim).

Pielonefritaxantogranulomatoas~

Esteoafec[iunesupurativ~renal~,reprezent]nddeobiceistadiulfinaldeevolu[ieal
uneipielonefritecronicesecundareobstruc[iei.Deaceea,asociereaculitiazaestefrecvent~
(5080%).Boalaevolueaz~celmaiadeseaunilateral,cuointeresarefocal~saudifuz~(Shan
M,1989).
Aspectul focal se poate confunda ecografic cu un abces de parenchim renal. `n
formeledifuze,rinichiulseprezint~ecograficcudimensiunicrescute.
`n func[ie de gradul de distruc[ie (lichefiere) parenchimatoas~, se vizualizeaz~ zone
hipoecogenecorespunz]ndleziunilorinflamatoriisaucalicelordestinse.Acestaspectpoatefi
confundatcumodific~rileecograficedinpionefroz~(LoweLH,1994).

Pionefroza

Apare consecutiv unei obstruc[ii a sistemului pielocaliceal care a dus la apari[ia


hidronefrozei#iulteriorapionefrozei.Afec[iuneasecaracterizeaz~prinprezen[adepuroi`n
sistemulpielocaliceal#iposibil`nureter(`nfunc[iedenivelulobstruc[iei).
Explorarea ultrasonografic~ pune `n eviden[~ distensia cavit~[ilor intrarenale, a
bazinetuluiextrarenal#ieventualaureterului,ca#imodific~riledatorateprezen[eipuroiului
266

Capitolul5.2.Investiga[iaultrasonografic~

`n aceste cavit~[i: ecouri flotante `n cavit~[ile destinse, depozite hiperecogene `n calice #i


bazinet, ecouri intracavitare intense cu umbrire posterioar~ intermitent~ datorate gazului
formatdeuniiagen[iinfec[io#i(YoderIC,1983)(Fig.12).
Uneoriestevizibil~prezen[acalculilor
sauatumoriiresponsabiledeobstruc[ie.

Fig.12.Pionefroz~cavit~[iintrarenale

destinse,cudepozitehiperecogene.

Infec[iilespecifice

Tuberculozarenal~

Reprezint~infec[iapecalehematogen~arinichiuluicuMycobacteriumtuberculosis.
Celmaifrecvent,infec[iaestesecundar~uneiafect~riprimarepulmonare,survenit~`nurm~
cu c][iva ani. Adesea, nu se mai detecteaz~ radiologic leziuni evolutive pulmonare `n
momentulafect~riirenale,put]ndfig~siteaspectesechelarepulmonare.Hematuriaesteun
semncvasiconstant,g~sit`nunelestatisticip]n~la100%dincazuri(treisferturidinpacien[i
prezent]ndhematuriemicroscopic~#iunsferthematurietotal~,macroscopic~). Al[iautori
semnaleaz~lipsaoric~reisimptomatologiila1020%dinpacien[i(ElkinM,1990).
Analizaurineiridic~suspiciuneaclinic~detuberculoz~urinar~dincauzamodific~rii
pHuluispreacid,prezen[eipiurieisterilelaexamenulbacteriologicobi#nuit#iahematuriei
(celmaifrecventmicroscopic~).
Explorarea ultrasonografic~ aduce
adeseadatenespecifice.
Ecografic se poate detecta o mas~
pseudotumoral~ (unilateral~), hipoecoge
n~, asem~n~toaremodific~rilorecografice
din nefrita focal~ bacterian~ (Das KM,
1992)(Fig.13).
Uneoriimagineaecografic~secon
fund~ cu o forma[iune tumoral~ benign~
sau malign~ (Das KM, 1992). Prezen[a
calcific~rilor`nforma[iunenuconfer~spe
cificitate, calcific~ri fiind semnalate #i `n
alte tipuri de patologie, inclusiv tumoral~.
Calcific~rile pot fi adesea confundate cu
Fig.13.
Tuberculoz~renal~cuaspect
calculi, mai ales c]nd leziunile evolueaz~
pseudotumoral.
spreregiuneapielocaliceal~.

267

TratatdeUrologie

Infec[iilefungice

Reprezint~ o patologie rar `nt]lnit~ la pacien[ii cu un sistem imunitar normal, dar


poate ap~rea la bolnavii imunodeprima[i. Dintre infec[iile fungice, infec[ia cu Candida
albicans este mai des citat~ (Spring D, 1990), dar se pot `nt]lni #i infec[ii cu Aspergillus #i
Criptococcus.Infec[iacuCandidapoateproducemiciabceseparenchimatoasecuunaspect
ecograficsimilarcuceleprodusedebacterii.Evolu[iaserealizeaz~sprecapsularenal~,cuo
posibil~lezareaacesteia#iextensia`ngr~simeaperirenal~.Dac~evolu[iaseproducespre
regiunea pielocaliceal~, `n sistemul colector pot ap~rea imagini hipoecogene, rotund
ovalare, mobile, f~r~ umbr~ acustic~, reprezent]nd bile fungice sau gheme miceliene.
Aspectulecograficpermiteconfuziicupolipi,cheagurisangvinesautumori(carcinoame)cu
celuletranzi[ionale,hidronefrozafiindoposibil~complica[ie(YangCC,2007).

Infec[iileparazitarerenale

Echinococoza. Localizarea agentului patogen Echinococcus granulosus sau Echino


coccusmultilocularislarinichipoatefiadeseaconfundat~,`nstadiileincipiente,cuunchist
cortical(PalmerPES,1992).
Evolu[iachistuluiparazitarpermiterecunoa#tereaecografic~apatrustadiievolutive.
Adesea, `n primul stadiu, chistul parazitar se poate confunda cu un chist cortical. Posibi
litateadiferen[ieriioofer~`nveli#ulchistuluiparazitar,careareostructur~complex~,fiind
formatdinmaimultestraturi:perichist,endochist#iectochist.Chiarcuajutorulsistemelor
ecograficeperformante,nutoateceletreistraturisuntvizibileecografic.
Cel mai frecvent `n primul stadiu
de evolu[ie, folosind func[ia zoom a
aparatului, ecografistul poate s~ observe
un contur dublu al forma[iunii chistice
parazitare. Dac~ examenul ecografic sur
prindechistulparazitar`nstadiulaldoilea
sau al treilea, diagnosticul ecografic se
poate stabili datorit~ aspectului aproape
tipic al chistului: membrana par[ial deta
#at~ `n interiorul chistului, sub forma
unor falduri u#or mobilizabile `n stadiul
doi #i respectiv prin prezen[a veziculelor
fiice `n interiorul chistului, cei confer~
acestuiaunaspectmultiloculat,`nstadiul
trei(Fig.14).
Fig.14.Hidatidoz~hepatorenal~,stadiulIII.

Schistosomiaza #i filarioza sunt infec[ii foarte rar int]lnite prin pozi[ia geografic~ a
Rom]niei.
Filarioza se caracterizeaz~ prin prezen[a parazitului `n canalele limfatice pe care le
blocheaz~tardiv,lac][ivaanidup~infec[iaini[ial~.Aparastfelblocajealecanalelorlimfatice
retoperitonealececonduclaapari[iaasciteichiloase#iachiluriei(PalmerPES,1990).Elefan
tiazisulesteomanifestarecomun~lanivelulextremit~[ilor.
`n schistosomiaz~, dup~ maturarea parazitului `n ficat, acesta intr~ `n plexurile
venoaseperivezicaledeundeproducemodific~ridetipendarterit~obliterant~#igranuloa
me`nperetelevezical#iureteral.
268

Capitolul5.2.Investiga[iaultrasonografic~

De#i hematuria apare timpuriu, modific~rile ecografice sunt vizibile `n fazele


avansate ale bolii #i se caracterizeaz~ prin `ngro#area uroteliului la nivelul ureterelor #i
veziciiurinare.Cutimpul,vezicaurinar~`#imic#oreaz~capacitatea,peretelese`ngroa#~#i
devinehiperecogenprinfenomenedefibroz~(PalmerPES,1990).

Cistitele

Cistita acut~ reprezint~ infla


ma[iamucoaseivezicale,celmaiadesea
caurmareaagresiuniiunuiagentinfec
[ios sau factor chimic, fizic (cistita
radic~) etc. Cistita infec[ioas~ este mai
frecvent~ la femei din cauza lungimii
reduseauretrei,ceeacepermiteascen
siunea mai u#oar~ a florei microbiene
delasuprafa[ategumentului.

Fig.15.Cistit~pere[ivezicali`ngro#a[icuecouriflotante#ireziduuvezical

importantprinobstruc[ieincomplet~subvezical~(adenomdeprostat~).

Afec[iunea se `nt]lne#te #i la b~rbat, prin acela#i mecanism sau prin pasajul ger
menilordinrect.AgentulcelmaiincriminatesteE.coli.Lab~rbat,afec[iuneasepoateasocia
cuobstruc[iasubvezical~decauz~prostatic~,cuuretritesauprostatite(ClaymanRV,1990)
(Fig.15).
Al[iagen[ipatogeniresponsabilipotfiProteussauKlebsiella.Modific~rileecografice
sereducdeobiceilaomucoas~vezical~`ngro#at~,neregulatconturat~.Uneoriundepozit
urinardeclivpoatefivizualizatecografic.`ncistitelefocalesepoate`nt]lniaspectulpseudo
polipoidcaresepreteaz~laconfuziicuprocesetumorale(DasKM,1992).
Cistita cronic~ prin persisten[a cauzelor iritative, inflama[ia peretelui vezical se
cronicizeaz~.Vezicaurinar~poateap~reacontractat~,cupere[ii`ngro#a[i,uneoricuzonede
peretecemimeaz~aspecteleinfiltrativedinuneleneoplazii.
Cistitaemfizematoas~estedescris~labolnaviicudiabetzaharat#isecaracterizeaz~
printrogravitatecrescut~aevolu[ieiinfec[ieicuunagentpatogen,celmaifrecventE.coli.
Modific~riledeperetevezicalsuntcaracterizateprinulcera[ii#inecrozauroteliului,uneori
cuzonedegangren~.Ecograficsepoatedetectaprezen[adegaz`nperetelevezicalsau`n
lumenul vezicii sub forma unor imagini hiperecogene cu umbr~ posterioar~ (Kauzlauric D,
1985).
Malakoplakiareprezint~oinfec[iegranulomatoas~deetiologienecunoscut~#iapare
rar, `n special la femei v]rstnice, cu imunitatea alterat~. Ecografic, afec[iunea poate avea
multiple localiz~ri; `n vezic~ se caracterizeaz~ prin prezen[a uneia sau a mai multor mase
protruzive,localizatepepereteleinferior(KogulanPK,2001),u#ordeconfundatcutumori
deuroteliu,cubaz~larg~deimplantare.

269

TratatdeUrologie

6.Uropatiaobstructiv~

Obstruc[iafluxuluiurinararedreptconsecin[~apari[iahidronefrozei,caresetraduce
ecografic prin dilatarea sistemului pielocaliceal intrarenal #i posibil a sistemului colector
extrarenal,`nfunc[iedenivelulobstruc[iei(GoldmanL,2004).
`nmodnormal,sistemulpielocalicealreprezint~unsistemdecavit~[irenalecupere[i
apropia[i,pere[icarenusepotvizualizaseparatatuncic]ndnuexist~unoarecaregradde
distensiepielocaliceal~.`nmodfiziologiclacopii,precum#ilaadul[iibinehidrata[isepoate
detectaofoartemic~cantitatedeurin~`nsistemulcolector.
O serie de adev~rate capcane ecografice pot crea dificult~[i `n stabilirea diagnos
ticuluiecograficdehidronefroz~.
Undiagnosticfalspozitivpoateap~rea`ndiferitesitua[ii,cumarfi:
un megacalice congenital sau un bazinet extrarenal dezvoltat. Diagnosticul ecografic
corectsestabile#teprinabsen[avizualiz~riiuneicauzeobstructive,alipseidedistensie
generalizat~latoategrupelecaliceale,ca#iprinlipsadistensieiureterale
oafec[iunechistic~detipulrinichiuluipolichistic,arinichiuluimultichisticsauachiste
lorsimple(Fig.16). Ecografistulartrebuis~cunoasc~aspectul ecografictipicalafec
[iunilor chistice la care forma[iunile lichidiene evolueaz~ de obicei excentric, spre
periferiarenal~.
Oparticularitateopoateconstituiunchistparapielic(peripelvic)dedimensiunimari,
care poate comprima ureterul sau bazinetul extrarenal cu consecin[a unui grad de
hidronefroz~asociat~.
Invers, un diagnostic fals negativ
poate s~ apar~ `n situa[ia instal~rii unei
insuficien[e renale, c]nd, de#i exist~ un
obstacol `n calea evacu~rii urinei, diminu
area sau absen[a producerii urinei nu
creeaz~ o distensie a cavit~[ilor renale,
vizibil~ecografic.

Fig.16.Rinichipolichistici

debutulboliipoatemimaohidronefroz~.

`n func[ie de mai mul[i factori, cum ar fi viteza de instalare a obstruc[iei,gradul de


obstruc[ie#idurataacesteia,sepotobservalarinichiulinteresatmodific~rialeparametrilor
fluxuluisangvinintrarenal(cre#tereaindexuluiderezistivitate)(CronanJJ,1995)sauungrad
deatrofiecortical~.Aceastadinurm~aparecaurmareainextensibilit~[iicapsuleirenale#ia
cre#teriipresiuniihidrostaticesubcapsular,urmat~desc~dereafluxuluisangvinparenchima
tos.

7.Litiazarenal~

Prezen[a calculilor `n sistemul colector intra #i extrarenal a fost una din primele
tipuridepatologie`ncareexplorareaecografic~aaparatuluiurogenitalsaimpus.
270

Capitolul5.2.Investiga[iaultrasonografic~

Frecven[alitiazeirenaleestemare,cresc]ndcu`naintarea`nv]rst~.Afostdescris~`n
unele statistici `n propor[ie de p]n~ la 1012% din popula[ia general~, ca manifestare cel
pu[inepisodic~.Dinpunctdevederechimic,compozi[iacalculilorestecelmaifrecventdat~
deoxalatuldecalciu(SpirnakJP,1990).
Examenul ecografic poate s~ eviden[ieze prezen[a calculilor unici sau multipli, uni
sau bilaterali, datorit~ diferen[ei mari de densitate `ntre calcul #i structurile `nvecinate.
Fenomenulfacecalasuprafa[acalcululuis~apar~oreflexiemarcat~`nso[it~deoabsorb[ie
aproape total~ a fasciculului ultrasonor ce trece de prima suprafa[~ de separare [esut/
calcul.
Acest fenomen creeaz~ conul de
umbr~ acustic~ pe care trebuie s~l prezin
te, `n principiu, un calcul cu orice compo
zi[ie chimic~. `n situa[ia c]nd calculul este
`nconjuratdeurin~,fenomenelesunt#imai
evidente,calcululdeta#]nduse#ifiindu#or
vizibilecografic(Fig.17).
`npractic~,lucrurilesepotprezenta
diferit, datorit~ unor particularit~[i de pro
pagare a ultrasunetelor`n [esuturi,de pro
funzimealacareseafl~calculul#imaiales
dedimensiuneaacestuia.

Fig.17. Hidronefroz~ princalcullajonc[iuneapieloureteral~.

Pentruaseconvingec~estevorbadelitiaz~,unecografistartrebuis~eviden[ieze
umbraacustic~,posterioar~calculului.

Trebuie men[ionat c~ detec[ia unui


calcul depinde #i de rezolu[ia spa[ial~ a
aparatului,sistemeleecograficeperforman
teput]nddetectamicrocalculicudiametrul
minim de circa 3 mm. Calculi cu diametrul
maimaresauegalcu5mmaufostdetecta[i
`n unele statistici `n toate cazurile
examinate, demonstr]nd o sensibilitate a
metodei de 100% (Fowler KA, 2002)
(Fig.18).
Specificitatea ultrasonografiei este
`ns~maimic~datorit~unorprocesepatolo
gicecepotficonfundateecograficculitiaza.
Fig.18.Calculcoraliform.

C]tevaexemplesuntreprezentatedeprezen[aunorcalcific~riintraparenchimatoase
saualepereteluiartereirenale,calcific~ri`nuneletumorirenalesaudeprezen[adegaz.
`n diagnosticul hidronefrozei, un aport `n cre#terea sensibilit~[ii #i a specificit~[ii `l
aduce examenul Doppler. Astfel, cercetarea regiunii trigonului vezical cu metoda Doppler
color poate s~ pun~ `n eviden[~ fluxul urinar intravezical, provenit din orificiile ureterale.
M~rimea fluxului urinar astfel detectat variaz~ fiziologic `n func[ie de gradul de hidratare;
271

TratatdeUrologie

oricum,eltrebuies~fiesimetric.`ncazuluneiobstruc[iiunilaterale,fluxulurinarintravezical
vizualizat cu metoda Doppler color este diminuat p]n~ la dispari[ie, pe partea rinichiului
obstruat(CatalanoO,1989).

8.Nefrocalcinoza

Reprezint~calcificareaparenchimuluirenaldetipdistrofic(prindepuneredecalciu
`nparenchimrenaldevitalizat)saudetipmetastatic(`nst~riledehipercalcemieconsecutive
acidozei tubulare #i, mai frecvent, hiperparatiroidismului). `n nefrocalcinoza de tip metas
tatic, depunerea de calciu poate avea loc `n corticala sau `n medulara renal~ (Katz ME,
1994).
Nefrocalcinozamedular~aredreptcauz~principal~hiperparatiroidismul#iprezint~
ecografic piramide medulare mult mai hiperecogene dec]t parenchimul renal. `n evolu[iile
`ndelungate,depoziteledecalciudinmedular~producfenomenedeumbrireposterioar~.
Nefrocalcinozacortical~apareconsecutivunorafec[iunidiferiteca:glomerulonefrita
cronic~,necrozaacut~cortical~,intoxica[iacuetilenglicol(antigel)sau`ncazderejetlaun
rinichi transplantat. Ecografic, `n afara modific~rilor renale datorate afec[iunii de baz~,
corticala renal~ devine intens hiperecogen~, cu fenomene de umbrire acustic~ (Banner M,
1990).

9.Litiazavezical~

Recunoa#tedou~cauzeprincipale:
migrareaunuicalcul(calculi)dinsistemulpieloureteral`nvezic~
stazaurinar~intravezical~prinobstruc[iesubvezical~sauvezic~neurologic~.
`n primul mecanism, mai frecvent incriminat, calculul r~m]ne `n vezic~ dac~ dep~
#esteodimensiunepragsaudac~exist~untipdepatologieasociat~,defelulceleiincri
minatedealdoileamecanismdeformareacalculilorvezicali.

Vizualizarea calculilor vezicali nu ar


trebui s~ ridice probleme de diagnostic,
calculiifiind de obiceidedimensiunisufi
cientdemaripentruar~m]ne`nvezic~#i
decidepistabiliecografic.Detec[iaecogra
fic~ este u#urat~ de prezen[a lichidului
(urina vezical~) `n jurul calculului, reco
mand]nduse `ntotdeauna explorarea
ecografic~cuvezicadestins~(Fig.19).

Fig.19.Calculi`npor[iuneadecliv~aveziciiurinare.

Calculii sunt descri#i ecografic ca grupuri hiperecogene cu umbr~ acustic~ poste


rioar~.Pentrusiguran[~,ecografistultrebuies~`ncercemobilizareacalculilorprinschimba
reapozi[ieipacientului`ndecubitlateraldrept#ist]ng.Manevrademobilizarediferen[iaz~
uncalculdeunposibilcheagaderentsauotumor~calcificat~.Rar,uncalculpoates~adere
laperetelevezicalprintrunprocesinflamatordevecin~tate.

272

Capitolul5.2.Investiga[iaultrasonografic~

10.Patologiatumoral~

Tumorilerenalepotfi:tumorimalignesaubenigne,lichidiene,solidesaumixte.Acest
capitol `ncearc~ o abordare imagistic~, prin prisma aspectului ecografic al diferitelor tipuri
tumorale.Se`ncearc~astfelpunerealadispozi[iaurologuluiecografistsauaimagistuluicare
face investiga[ii ecografice pentru un serviciu de urologie a unor elemente de diagnostic
ecografic`ntentativadeadescrieimagisticadiferitelortipuritumorale#ideastabilicore
la[iiimagisticohistologice.
Tumorilesolide
Tumorileizoecogene
Sunt forma[iuni solide cu aceea#i ecostructur~ cu a parenchimului renal. `n acest
grupintr~toatepseudotumorilerenale,inclusivlobula[iafetal~.
`ntruc]tpseudotumorilesuntadeseasuspectateecografic,unsimplustudiumorfo
logicecograficesteinsuficientpentrudiferen[iereadeotumor~adev~rat~(PaspulatiRM,
2006)(Fig.20).
Totu#i, ecografistul are c]teva argu
mentemorfologice:
o hipertrofie de coloan~ Bertin, care
de#i amprenteaz~ regiunea pielocali
ceal~,nuvamodificatraiectelevascu
lare din parenchimul de vecin~tate,
acestea trec]nd nestingherite prin co
loanahipertrofiat~(fenomenmaibine
exploratcumetodaDopplercolorsau
Dopplerpower)
cocoa#~ de c~mil~ dat~ de
amprenta polului inferior al splinei `n
Fig.20.Tumor~izoecogen~(`ntres~ge[i)cu
jum~tatea superioar~ a rinichiului
hidronefroz~secundar~parcelar~.
st]ng nu va modifica traiectele
vasculareintraparenchimatoase.
A#acumammaimen[ionat,`nambelesitua[ii,studiulecograficpoateficompletatcu
succes de explorarea scintigrafic~ (99mTcDTPA). `n situa[ia existen[ei unei pseudotumori,
aspectulscintigraficnuvarelevaoimaginelacunar~la nivelulzoneideparenchimsuspec
tateecografic.
Tumorilehipoecogene
Ceamaifrecvent~tumor~malign~renal~estecarcinomul(PellerPA,1995),careare
deobiceiaspectecografic hipoecogen c]nd diametrulmaximdep~#e#te34 cm(circa30%
dincarcinoamelediagnosticateecografic)(BosniakMA,1991).
Caform~histologic~,formapapilar~se caracterizeaz~`ndeosebi prin aspectulhipo
ecogen#ireprezint~circa15%dintotalulcarcinoamelor,av]ndorat~decre#teremailent~
#iunprognosticmaifavorabil(YamashitaY,1992)(Fig.21). `nt]lnit deobiceilapersoanele
v]rstnice(6070deani),carcinomulrenalareofrecven[~maimarelab~rba[i(decirca3ori
mai frecvent dec]t la femei). Se descrie, de asemenea, o asociere cu boala von Hippel
Lindau(ChoykePL,1995).
273

TratatdeUrologie

Fig.21.Tumor~hipoecogen~
carcinomdedimensiunimari,
cuvasculariza[iecrescut~.

Dimensiunile relativ mari, la care se prezint~ ca o tumor~ hipoecogen~, fac adesea


posibil~ depistarea ecografic~ a unor zone de necroz~ central~, sub forma unor structuri
lichidiene `n forma[iunea solid~ (Ameri C, 2006). Astfel de aspecte trebuie diferen[iate de
hidronefrozaregional~ce`nso[e#teuneoriotumor~careaobstruatpar[ialsistemulcolector
intrarenal.ExamenulDoppler,de#idemonstreaz~ovasculariza[iemaicrescut~`nmajorita
tea acestor tumori (`n circa 70% ), are specificitate limitat~, acela#i comportament fiind
descrislaovarietatedetumorimaligne,ca#i`nuneleproceseinflamatoriirenale(RajGV,
2007).
Rinichiul reprezint~ a treia localizare pentru limfom, `n ordinea frecven[ei dup~
localizarea `n sistemul hematopoietic #i reticuloendotelial (Tefekli A, 2006). Localizarea
renal~estemaifrecvent~`nlimfoamelenonHodgkin#iseprezint~ecograficcaostructur~
hipoecogen~, slab delimitat~, av]nd aspect infiltrativ, extins~ uneori la tot parenchimul
renal.`nacestcaz,rinichiulafectatestemare,cuarhitecturamodificat~#i#tergereapractic
total~ a diferen[ierii cortical~ medular~. Ecografic se descriu patru tipuri de afectare
renal~:
infiltratul parenchimatos localizat, unic sau multiplu, uneori confundat cu structuri
chisticedincauzaaspectuluihipoecogen
infiltra[iadifuz~cuaspecthipoecogen,extins~latotparenchimulrenal
invaziadirect~delastructuriganglionare(adenopatiiretroperitoneale)devecin~ta
te,situa[ie`ncareadenopatiilesuntevidente,`ncontactdirectcucapsularenal~care
apare`ntrerupt~
infiltratulperirenalrealizeaz~unaspecthipoecogencepoatefiuneoriconfundatcuo
acumularedelichidperirenal~(ex.:unhematom).
Infiltratul leucemic `n rinichi are un aspect ecografic hipoecogen #i poate s~ se
prezinte sub forma de infiltrat difuz sau focal. Conform studiilor necroptice, circa 65% din
pacien[iicuoform~deleucemieprezint~oafectarerenal~.Infiltratulrenalareaspectuleco
graficsimilarcuceldescris`nlimfom(HunterS,2006).

Carcinomul cu celule tranzi[ionale, dezvoltat din sistemul colector, este `nt]lnit la


adult#iv]rstnic(`njurulv]rsteide65ani),fiinddepatruorimaifrecventlasexulmasculin
(LeaderRA,1990).
Esteunadintretumorilerenalecelmaigreudediagnosticatecograficdirect.Adesea
sunt vizibile semne indirecte ale prezen[ei tumorii, reprezentate de dilata[ia sistemului
pielocaliceal.Tumorapoatefidedimensiunireduse,situa[ie`ncareseconfund~cugr~si
meadinsinusulrenal.Uneoriperetelebazinetuluise`ngroa#~#i,dac~zona`ngro#at~proe
min~`nlumenulbazinetuluidestins,diagnosticulecograficesteposibil(Fig.22).
274

Capitolul5.2.Investiga[iaultrasonografic~

Fig.22.Rinichicudilata[iepielocaliceal~.

Bazinet`ngro#atlajonc[iunea

pieloureteral~.

Practic`ns~,tumorilemici(circa1cm#isub1cm),neobstructive,suntimposibilde
diagnosticatecografic(ZhangJ,2007).Chiardac~,ecografic,astfeldetumorisemaivizuali
zeaz~uneori,elepotfiu#orconfundatecucheaguri`nbazinetsaucumodific~ribazinetale
date de o infec[ie fungic~. Ca #i `n cazul majorit~[ii forma[iunilor tumorale care evolueaz~
spre regiunea pielocaliceal~, ecografia r~m]ne doar un examen evaluativ, diagnosticul de
certitudinefiindstabilitdepreferin[~printrometod~radiologic~cusubstan[~decontrast.

Metastazelerenaleseprezint~deobiceicaforma[iuninodulare,cuconturpoliciclic
#iaspectecografichipoecogen.Potfiunicesaumultiple,`mbr~c]ndformaleziunilorfocale
sauprezent]ndunaspectdifuz,infiltrativ.Localizarearenal~ametastazelorprovinecelmai
frecventdelauncarcinompulmonarsauuncarcinomdes]n(circa25%dintotalulmetas
tazelorrenalepentrufiecarelocalizare),urmatedemetastazedelauncarcinomdezvoltat`n
rinichiulcontralateral.Decelemaimulteori,metastazelerenaleapartardiv`nevolu[iatu
moriideorigine#ievolueaz~celmaiadeseaasimptomatic(ZhangJ,2007).`ngeneral,aspec
tulmultilezional`ldetermin~peecografists~ia`nconsiderareodiseminareintrarenal~de
tip metastatic. Dac~ `ns~ leziunea este unic~, leziunea metastatic~ nu se poate deosebi
practic de o tumor~ primitiv~ hipoecogen~, de parenchim (cel mai probabil un carcinom
renal).
Metastazele pot s~ prezinte zone de necroz~ central~, focare hemoragice, supra
infec[ie sau calcific~ri `n interior #i la periferia forma[iunii. Necroza central~ #i zonele
hemoragice realizeaz~ un aspect mixt al forma[iunii (forma[iunilor) cu preponderen[a
componenteisolide.Suprainfec[iapoates~transformeleziuneametastatic~`ntrunproces
septic, realiz]nd ecografic aspectul unui abces, deci o leziune mixt~ neomogen~, cu ecouri
datedeniveledegaz,culichid#idetritusdecliv.
Oncocitomularecelmaifrecventlaexamenulecograficunaspecthipoecogen,mai
rarfiindizoecogencurestulparenchimuluirenal.Oncocitoamelereprezint~`ntre3#i6%din
totalitatea tumorilor renale (Honda H, 1992) #i sunt considerate clasic adenoame av]nd
origineahistologic~`nceluleletubilorproximali.Dimensiunilevariabile,`ngeneral`ntre3#i
8 cm, #i aspectul hipoecogen fac oncocitomul greu de diferen[iat ecografic de carcinom.
Totu#i, dac~ acesta din urm~ poate s~ prezinte zone hemoragice #i calcific~ri, astfel de
aspecte sunt practic inexistente `n cazul oncocitomului, ceea ce ar putea ajuta la
diferen[iereacelordou~tipuritumorale.

Tumorilehiperecogene
Carcinomulse poateprezentaecografic#icaforma[iunehiperecogen~, atuncic]nd
estedepistatladimensiunisubcirca3cm.Tumorasepoateconfundacuangiomiolipomul
275

TratatdeUrologie

(Yamashita Y, 1993), singurule elemente care le poate diferen[ia ecografic fiind, `n cazul
carcinomului, un halou peritumoral hiperecogen sau un contur al tumorii mai hipoecogen,
asemeneauneipseudocapsule,aspectepecareangiomiolipomulnuleprezint~(Fig.23,24).

Fig.23.Carcinomhiperecogencumichalou
Fig.24. Acela#icaz. Vasculariza[iecrescut~

perilezional.
intratumoral#ilaperiferiaforma[iunii.

Tumorirareculocalizarerenal~

Sarcoamele sunt considerate neoplazii renale rare, reprezent]nd `n ansamblu circa


1%dintumorilemaligneceafecteaz~rinichiul.
Dintre sarcoame, leiomiosarcomul
ocup~, ca pondere, peste jum~tate, `n
vremecehemangiopericitomul#iliposar
comul reprezint~ fiecare circa 20% (Won
YL,1994).Sarcoameleauoevolutierapid~
#i un prognostic nefavorabil. Rata de
cre#tere accelerat~ le face de obicei
detectabile ecografic la dimensiuni deja
mari. Ecografistul descrie o forma[iune
solid~, hiperecogen~, rotundovalar~, ce
dep~#e#te capsula renal~, av]nd tendin[a
deaseproiectaperirenal(Fig.25).

Fig.25.Sarcomcuevolu[ieextraparenchimal~.
Seobserv~vaseledealimentaredinparenchimulrenal.

Reninomul este o tumor~ secretoare de renin~, av]nd o inciden[~ sc~zut~. Este


semnalat~ cu predilec[ie la pacien[ii tineri, mai ales de sex feminin, #i este `nso[it~ de o
simptomatologie specific~ crizelor hipertensive de `nso[ire, prin nivele serice crescute de
renin~ cu prezen[a aldosteronismului secundar (Leogite G, 2003). Tumora este cel mai
frecventdetectat~la dimensiunide25cm.Atuncic]ndestesuspectat~clinic,ecografistul
trebuie s~ o caute mai ales subcapsular spre unul din cei doi poli renali, unde poate fi
identificat~caoforma[iunesolid~,unic~,hiperecogen~.
Tumora Wilms este o tumor~ rar `nt]lnit~ la adult, fiind `ns~ cea mai frecvent~
neoplazierenal~acopilului.Laadult,tumoraseconfund~ecograficcucarcinomulrenal.
Lacopil,tumorase`nt]lne#telav]rstemici,dou~treimidintumorifiinddescoperite
subv]rstade5ani.Av]ndorat~decre#tererapid~#ifiindmulttimpasimptomatic~,tumora
276

Capitolul5.2.Investiga[iaultrasonografic~

este de obicei detectat~ la dimensiuni mari, uneori impresionante, `n raport cu m~rimea


rinichiului(diametrede1012cm).
Calcific~rile intratumorale sunt ci
tate la copil, `n circa 1 din 10 tumori
Wilms, `n vreme ce la adult este descris~
mai ales o component~ chistic~
(GallagherDJ,2007)(Fig.26).

Fig.26.

Tumor~dedimensiunimari,cucalcific~ri

multiple`ninterior,dezvoltat~lacopil.

Adenocarcinomulculocalizareprimar~lanivelulrinichiului#itractuluiurinaresteo
tumor~rar~(ChangYL,2007).Adenocarcinoameledetracturinarinferiorsunt,defapt,cel
maiadesea,invaziidevecin~tatedelaadenocarcinoamedeuter,prostat~saurect.
Ceva mai frecvent este semnalat adenocarcinomul de urac~, dezvoltat pe un rest
embriologic al canalului alantoidian obliterat. Tumora are de obicei ca punct de plecare
peretelesuperioralvezicii#iaretendin[adeinvazierapid~`npereteleabdominalanterior,
cuextensie`ngr~simeaperivezical~.
Angiomiolipomul este o tumor~ benign~, rar `nt]lnit~ `n popula[ia general~, dar
frecvent citat~ la bolnavii cu scleroz~ tuberoas~ (epilepsie, retard mental, adenoamele
sebaceealefe[ei).Ecografic,tumoraareunaspectconsideratclasichiperecogenprinames
teculdecomponentetisulare:[esutmuscularneted,[esutadipos#ivasedes]nge(KangKP,
2007). Dac~ `ns~ predomin~ componenta vascular~ cu elemente hemoragice, forma[iunea
poatefi(mairar)hipoecogen~.

Tumoriureterale#ivezicale

Carcinomul cu celule tranzi[ionale este rar `nt]lnit ca localizare ureteral~, nedep~


#ind6%dintumorilemalignedetracturinarsuperior.
Tumorasedezvolt~maiales`n1/3inferioar~aureterului#ipoatefidiagnosticat~
ecografic`ncazdeobstruc[ieureteral~cuureterohidronefroz~consecutiv~,situa[ie`ncare
ureterulsepoateobservadelajonc[iuneapieloureteral~p]n~laloculobstacolului(Chung
SD,2007).
Diagnosticuldiferen[ialcuobstruc[ia
litiazic~ este necesar #i nu totdeauna
simplu, din cauza, uneori, a imposibilit~[ii
devizualizareaconuluideumbr~datdeun
calcul la acest nivel (gaz `n colon, ureter
retrocav sau prea profund situat fa[~ de
suprafa[a tegumentului, calcul mic etc.)
(Fig.27).

Fig.27.Carcinomcuceluletranzi[ionale
`nvezicaurinar~.

277

TratatdeUrologie

Localizareavezical~acarcinomuluicuceluletranzi[ionaleestefoartefrecvent~,mai
ales la b~rba[ii v]rstnici (de 3 ori mai frecvent fa[~ de femei). Primul simptom care atrage
aten[iaestehematuria.Chiarc]ndtumoraestesuspectat~prinsimptomatologie#inueste
descoperit~ `nt]mpl~tor, doar aproximativ o treime din forma[iunile vezicale au aspect
infiltrativ.

Diagnosticul ecografic este relativ


u#or de stabilit, chiar pentru tumorile de
dimensiuni reduse (Dowling CR, 2007).
Desigur, c]nd suspiciunea de carcinom cu
celuletranzi[ionaleestemare#iexamenul
ecografic transabdominal nu pune `n evi
den[~ tumora sau eviden[iaz~ o zon~ de
peretevezicalmodificat~,darf~r~apreci
za natura modific~rilor, se recomand~ o
ecografie transrectal~, tumora fiind mai
frecvent localizat~ `n trigon #i pe pere[ii
lateraliaivezicii(Fig.28).
Fig.28.Carcinomcuceluletranzi[ionale

vasculariza[ielaexamenulDopplercolor.

Depistarea ecografic~ a tumorii nu exclude cistoscopia, ci, dimpotriv~, o indic~ `n


vedereabiopsiei.Aceasta,deoareceaspectulmorfologicaltumoriinuestesuficientpentru
stabilirea diagnosticului, tumora put]nd fi confundat~ ecografic cu forma[iuni invazive de
prostat~,culimfomulculocalizarevezical~,cumetastaze`nperetelevezicalsauchiarcuun
cheagsangvinaderentdeperetelevezicii.
Dac~ ecografistul are la dispozi[ie substan[e de contrast ecografic, poate `ncerca
administrarea`nbolus#icercetareavasculariza[iei`ntumoravezical~.Absen[avasculariza
[iei intratumorale la examenul Doppler, chiar #i dup~ administrarea de contrast, pledeaz~
pentruuncheagaderentlaperetelevezical,o`ngro#aredeperetepostiradiereetc.
O particularitate o reprezint~ tumorile dezvoltate `n diverticulele vezicale. Atunci
c]nddiverticululareocomunicare`ngust~cuvezica,cistoscopianupoateexploradiverticu
lul. Pe de alt~ parte, diagnosticul trebuie pus c]t mai repede, exist]nd riscul infiltr~rii #i al
extinderii rapide a tumorii `n gr~simea perivezical~ din cauza peretelui sub[ire al diverti
culului.`nastfeldesitua[ii,ecografiapoates~devin~metodaprincipal~dediagnostic.
Carcinomulcucelulescuamoasese`nt]lne#temultmairar(58%dintotalultumo
rilor maligne vezicale) (Narumi Y, 1998). `n patogenia lui este citat~ frecvent asocierea cu
litiaza #i infec[ia urinar~ (Fig.29). Ecografic se prezint~ ca o forma[iune u#or protruziv~ `n
lumenul vezicii, neregulat conturat~ datorit~ ulcera[iilor de suprafa[~ #i adesea cu aspect
infiltrativ(Fig.30).
Limfomul cu localizarevezical~apare prin interesarea foliculilor limfatici din stratul
submucos al vezicii #i se caracterizeaz~ ecografic prin eviden[ierea unei forma[iuni solide,
hipoecogenesituate`nperete#icarelas~intact~mucoasavezical~(BinkovitzLA,1988).
Metastazele`nvezicaurinar~suntrare#iprovinmaialesdelaunmelanom,unneo
plasmpulmonar,unneoplasmmamar,uncancergastricsauotumor~renal~prin`ns~m]n
[are pe cale urinar~, motiv pentru care orice tumor~ renal~, odat~ depistat~ ecografic,

278

Capitolul5.2.Investiga[iaultrasonografic~

atrage automat examinarea vezical~ am~nun[it~. Aspectul ecografic nu poate diferen[ia


metastazeledetumorileprimarealepereteluivezical.

Fig.29.Carcinomcucelulescuamoasepe

peretelevezicalposterolateralaspect

infiltrativcuinvaziameatuluiureteralst]ng#i

ureterohidronefroz~secundar~.

Fig.30.Carcinomcucelulescuamoase;
localizarevezical~ureterulst]nginvadat`n
por[iuneaintramural~.

Tumorilebenigneculocalizarevezical~

Leiomiomulesteceamaifrecvent~tumor~benign~dezvoltat~dinperetelevezical.
Poate`mbr~caunaspectpediculatsausesil,#i,dup~unelestatistici,circa otreime sepot
dezvoltaextravezical(ChenM,1997).
Neurofibromul apare mai rar izolat, mai frecvent fiind `nt]lnit `n cadrul neurofibro
matozei Recklinghausen, c]nd depistarea ecografic~ a unor forma[iuni solide `n peretele
vezicalseinterpreteaz~`ncontextulboliidefond.
Feocromocitomulculocalizarevezical~poatefidiagnosticat`nprimulr]ndclinicprin
simptomatologia specific~ (tahicardie, cefalee, transpira[ii), declan#at~ de distensia sau de
golirea vezicii. Ecografic se descrie o forma[iune solid~ bine delimitat~, localizat~ mai
frecvent`nperetelesuperioralvezicii.

Forma[iunilechistice

Afec[iunilepolichistice

Boalapolichistic~renal~autosomaldominant~aparelaadultcuofrecven[~decirca
un caz la o mie de locuitori #i este cea mai comun~ afec[iune renal~ ereditar~ f~r~
predilec[ie de sex (Choyke PL, 1996). Afec[iunea este bilateral~ #i se caracterizeaz~ prin
forma[iuni chistice multiple, corticale #i medulare, de dimensiuni variabile. `n ordinea
frecven[ei,sepot`nt]lniforma[iunichistice`nficat(`np]n~la60%dincazuri),`npancreas
(p]n~ la 10%), `n splin~ (5%) #i sporadic `n tiroid~, ovare, pl~m]n, encefal #i hipofiz~.
Diagnosticulecograficesterelativsimplu,`nformeletipicedeboal~rinichiiav]ndunaspectecograficcaracteristic.
Astfel,rinichiisuntmari,parenchimulfiindpractic`nlocuitdeforma[iunichisticedem~rimevariabil~(delac][iva
milimetrilac][ivacentimetri).Dac~sesuprapune(frecvent)hemoragiaintrachistic~sausuprainfec[ia,chisturileau
pere[ii`ngro#a[i#iuncon[inuthiperecogen.Pere[iiforma[iunilorchisticese`ngroa#~#iprezint~conurideumbr~
acustic~posterior`ncazdecalcificaredistrofic~,de#iastfeldeimaginisuntgreudediferen[iatdeprezen[acalculilor

279

TratatdeUrologie

`n regiunea pielocaliceal~. Sau raportat #i afect~ri renale unilaterale, de#i nu to[i autorii
sunt de acord, consider]nd c~ este vorba de rinichiul multichistic sau de chisturi corticale
simple,`nnum~rmarelaunsingurrinichi(ChoykePL,1996).
Criteriiledediagnosticenun[atedeBearJC(1984)aufostmodificatedeRavineD#i
colab.(1994),astfel:
v]rstasub30deani+antecedentefamiliale=diagnosticpozitiv`ncazuldepist~riia
minimumdou~forma[iunichisticerenale(unisaubilateral)
v]rsta 3059 de ani + antecedente familiale = diagnostic pozitiv `n cazul depist~rii a
minimumc]tedou~forma[iunichistice(obligatoriubilateral)
v]rstapeste60deani+antecedentefamiliale=diagnosticpozitiv`ncazuldepist~riia
minimumc]tepatruforma[iunichistice(obligatoriubilateral).

Diagnosticul diferen[ial ecografic se


face`nprincipalcuhidronefrozadecarese
deosebe#te prin num~rul mare de forma
[iuni lichidiene situate `n tot parenchimul
renal, inclusiv subcapsular, precum #i cu
alte afec[iuni chistice renale pe care le
prezent~m`ncontinuare.

Fig.31.Boal~polichistic~autosomaldominant~ debutlaunpacientde16ani,cutat~l
transplantatrenalpentruaceast~afec[iune.

Boala polichistic~ renal~ autosomal recesiv~ apare la copil prin dilata[ia #i hiper
plazia tubulilor colectori renali. Afec[iunea evolueaz~ bilateral #i de obicei simetric, fiind
`nso[it~deposibilechisturihepatice#ifibroz~periportal~,carepoateproducelacopiiimai
marisindromuldehipertensiuneportal~(SixR,1975).`nfunc[iedev]rstaapari[ieimanifes
t~rilor clinice, boala include o form~ perinatal~, o form~ neonatal~ (ambele caracterizate
maialesprinmodific~rirenale),oform~infantil~#ioform~juvenil~(ultimacaracterizat~`n
specialprinmodific~rihepatice).Ecografic,manifest~rilerenalesecaracterizeaz~maipu[in
prinprezen[aforma[iunilorchistice,adeseadedimensiunipreamicipentruafivizibile#imai
alesprinm~rireadifuz~,simetric~aambilorrinichi,carecap~t~unaspecthiperecogen,cu
#tergereadiferen[ieriicortical~medular~.

Displazia renal~ multichistic~ (rinichiul multichistic) este o malforma[ie de obicei


unilateral~ (bilateral~ este incompatibil~ cu via[a), f~r~ predilec[ie de sex, caracterizat~
printrun rinichi de dimensiuni reduse cu multiple forma[iuni chistice #i parenchim mult
diminuat. Aproximativ o treime din bolnavi prezint~ un grad de obstruc[ie a jonc[iunii
ureteropelvice la rinichiul contralateral (Labropoulos N, 2007). Diagnosticul ecografic se
stabile#teprinprezen[aforma[iunilorchisticemultipleceocup~totinteriorulrinichiuluicu
absen[avizualiz~riiparenchimului#iaregiuniipielocaliceale#iprezen[aunorariiecogenice
intrarenale.Maipotfisemnalateecograficcalcific~riuneoriimportanteceproducoreflexie
#ioabsorb[iesemnificativ~,`mpiedic]ndvizualizarea`ntotalitatearinichiului.

Nefromul chistic multilocular (adenomul chistic, nefroblastomul polichistic, limf


angiomul) este de obicei o forma[iune chistic~ benign~ (malign~ c]nd con[ine #i o strom~
sarcomatoas~).Afec[iunease`nt]lne#temaifrecventlasexulmasculinsubv]rstade4ani#i
280

Capitolul5.2.Investiga[iaultrasonografic~

la femei adulte (Jacobs JE, 1989). Ecografic, forma[iunease prezint~cu un aspect mixt, de
imaginilichidiene(dedimensiunivariabile,uneorireduse)`ntromas~solid~binedelimitat~
#i,deregul~,f~r~calcific~risausepturi.

Chisturilecorticale

Chistulcorticalsimpluestepresupusafidob]ndit#iareofrecven[~carecre#tecu
v]rsta,ajung]ndlaor~sp]ndirevariabil~dep]n~lacirca50%`npopula[iapeste50deani.
De#i evolueaz~ asimptomatic, durerea #i, ocazional, hematuria pot `nso[i forma[iunile de
dimensiunimari.
Totu#i, `n cazul unei hematurii, dat~ fiind frecven[a `n popula[ie #i deci
probabilitatea mare ca pacientul s~ prezinte un chist, acesta nu trebuie s~l fac~ pe
ecografist s~ renun[e la a c~uta o alt~ cauz~ a hematuriei, adesea mai pu[in evident~
ecografic(otumor~,oleziunevascular~,uncalculetc.).
Ecografic,chistulcorticalsimpluse
prezint~ ca o forma[iune transonic~,
rotundovalar~, cu perete sub[ire #i bine
delimitat, cu `nt~rire posterioar~, uneori
ie#it~par[ialdinconturulrenal(Fig.32).

Fig.32.Forma[iunichisticesimple`n

corticalarenal~.

Fig.31.

Chistulcorticalsimpludevinecomplicatatuncic]nd:
con[inutulchistuluidevinehiperecogencaurmareauneiinfec[iisauauneihemoragii
intrachistice(ChanJCM,1980)
peretele se `ngroa#~, de obicei tot ca urmare a unei infec[ii. Dac~ `ngro#area este
evident~ cu mase solide aderente de perete sau cu digita[ii spre lumen, forma[iunea
chistic~estemaidegrab~malign~
prezen[a unor calcific~ri fine, sporadice, `n perete sau a unor posibile septuri fine `n
interiorulforma[iuniidemonstreaz~unchistcomplicat,#inuunulmalign
posibilesepturifinepotap~reasecundarhemoragiei,suprainfec[ieisauprinal~turarea
adou~sauamaimultorforma[iunichisticesimple.Septurilegroase(peste1mm)sunt
sugestivepentruunchistdecauz~malign~.

Chistul parapielic (parapelvic) este de origine limfatic~ sau se dezvolt~ din resturi
embrionare(GoldmanS,1990).C]ndsuntmultiple,diagnosticuldiferen[ialcuhidronefroz~
este dificil ecografic. Proiectat `n vecinatatea pelvisului renal, poate s~l comprime #i s~
produc~ungraddehidronefroz~saupoates~seasociezecuhematurie,hipertensiune#ise
poatesuprainfecta(LevineE,1984).`nastfeldecazuri,numaip~streaz~caractereleecogra
ficealechistuluisimplu#idevineunchistcomplicat.

Chisturilemedulare

Rinichiulcumedular~spongioas~,cunoscut#icaectaziatubular~benign~,apareca
o dilata[ie a ductelor colectoare `n medular~ #i papile, focal~ sau difuz~, de cauz~
281

TratatdeUrologie

necunoscut~, dar asociat~ cu unele afec[iuni ca: stenoza piloric~ hipertrofic~ congenital~,
hiperparatiroidismul,boalaCarolietc.(GoldmanS,1990).Ecografic,rinichiulestedeobicei
de dimensiuni normale, dilata[iile tubulare fiind de dimensiuni sub limita de detec[ie
ecografic~. Se pot vizualiza `ns~ calcific~ri ductale fine ce trebuie diferen[iate ecografic de
nefrocalcinozamedular~,`nultimaafec[iunecalcific~rilefiindmultmaievidente.

Boala chistic~ medular~ se prezint~ sub dou~ forme (a copilului #i a adultului) #i


apare prin progresia atrofiei tubulare renale, rinichii fiind de dimensiuni mai reduse, cu
aspect hiperecogen difuz prin fenomene de fibroz~ tubulointersti[ial~, cu prezen[a unor
miciforma[iunichistice(maximum1cmdiametru)vizibile`nmedular~.

Forma[iunichisticedob]ndite

Boala chistic~ secundar~ dializei este descris~ cu o frecven[~ de p]n~ la 90% la


pacien[ii cu insuficien[~ renal~ care fac dializ~ peritoneal~ sau hemodializ~ de peste 5 ani
(LevineE,1984).Boalapoateap~rea#ilapacien[iicutransplantrenal,`ntimpulcurelorde
dializ~. Ecografic, pe fondul modific~rilor renale produse de boala de fond care a dus la
instalarea insuficien[ei renale ce a necesitat dializ~, se constat~ prezen[a unor forma[iuni
chisticededimensiunimici,vizibilebilateral(LevineE,1996).

BoalavonHippelLindauesteoboal~genetic~cutransmitereautosomaldominant~
cu o inciden[~ `n statisticile anglosaxone de circa 1 caz la 35.000 de na#teri. Boala se
caracterizeaz~prinprezen[a,latreisferturidintrebolnavi,achisturilorrenale,darmodific~
rile principale constau `n formarea de hemangioblastoame `n sistemul nervos central, de
angioamemultipleretiniene,`nprezen[adecarcinoamerenalemultifocale#i`nceaaunor
feocromocitoamesuprarenaliene(SchreinemakersJM,2007).

11.Traumatismele

Clasic,traumatismulrenalesteclasificat`npenetrant#inepenetrant.Traumatismele
nepenetranteproducdeobiceileziunimaipu[ingrave,princontuzia#imairardilacerarea
parenchimuluirenal.Traumatismelepenetrantesesoldeaz~deobiceicusec[ionareastruc
turilor vasculare sau a sistemului colector intra sau extrarenal #i necesit~ de regul~ inter
ven[ia chirurgical~. De#i este o excelent~ metod~ de prim~ evaluare, ecografia nu poate
apreciaexacttoatemodific~rileposttraumatice,deaceeaseindic~explorarearadiologic~cu
substan[~ de contrast. Hematomul renal subcapsular se poate prezenta ecografic ca o
structur~hipoecogen~,chiartransonic~,atuncic]ndesterecent(sub24ore).
Imaginea descris~ poate supradeni
vela capsula #i poate amprenta regiunea
pielocaliceal~.Aspectulsepoatecombina#i
cuocolec[ieperirenal~subformauneilame
lichidiene. Dac~ au trecut mai multe zile de
la traumatism, hematomul se organizeaz~,
fiind vizibil ca o structur~ hiperecogen~. `n
evolu[ia ulterioar~, dup~ c]teva luni, hema
tomulsepoatetransformachistic.

Fig.33.Hematomperinefreticiatrogen,
ap~rutdup~punc[iabiopsierenal~.

282

Capitolul5.2.Investiga[iaultrasonografic~

Dilacerarea parenchimului apare ca o imagine hipoecogen~ sub form~ de band~ ce


porne#te subcapsular, de la nivelul corticalei #i poate p~trunde ad]nc, `n regiunea pielo
caliceal~.
Aspectulsepoate`nso[ideprezen[auneilamelichidiene(s]ngesauurin~)localizate
extracapsular,perirenal,maiales`ncazul`ncareparenchimulrenalestefracturat(Fig.33).

12.Leziunilevasculare

Examinarea circula[iei renale cu ajutorul tehnicilor de explorare Doppler color sau


Dopplerpowerpermiteecografistuluis~identifice`nprimulr]ndnum~ruldeartererenale
(`nmajoritateacazurilor,c]teunapentrufiecarerinichi).
La examenul Doppler color este vizibil sensul de curgere a s]ngelui `n vase #i se
individualizeaz~u#orartereledevene.
Explorarea Doppler power este de 610 ori mai sensibil~ dec]t explorarea Doppler
color#i,de#inucodeaz~`nculoridiferitesensuldecurgere`nvase,areavantajulc~prezint~
fluxulsangvindinvaseinclusivdecalibruredus,indiferentdeunghiulsubcareesteabordat
vasuldec~trefascicululdeultrasunete.
Metoda Doppler duplex permite vizualizarea vasului `n modul bidimensional,
simultancuanalizaspectral~amodific~rilordefrecven[~,transpusecaspectrulvitezelorde
curgereas]ngeluiprinvasulexaminat.Metodapermitem~surareacuacurate[eavitezelor
de curgere at]t `n vasele mari din hilul renal, c]t #i `n cele din parenchim, p]n~ la nivelul
arterelorarcuate.
Metoda Doppler triplex echivaleaz~ cu metoda duplex, la care se suprapune, peste
imagineabidimensional~,imagineaDopplercolor,cuscopulprincipalaldepist~riimairapide
avasuluideexaminat.
Explorareaecografic~cumetodologiadeexaminareDoppleresteprimainvestiga[ie
deefectuatatuncic]ndsesuspecteaz~leziunivascularerenaledeoricefel.`nunelecazuri,
explorarea Doppler ofer~ date complete pentru un diagnostic final. Alteori, explorarea
ecografic~ cu examen Doppler este doar orientativ~ din motive dependente de pacient
(obezitate, interpozi[ie de gaze etc.), de calitatea sistemului ecografic sau de tehnica de
examinare.
Avantajul examenului Doppler const~ `n lipsa total~ de invazivitate fa[~ de
explor~rileradiologicecusubstan[~decontrastintravascular.
`n explorarea ecografic~ Doppler
se folosesc de mai mult timp agen[i de
contrast (ex.: combina[ii de galactoz~,
acizi gra#i #i microbule de gaz). Ace#tia
aduc date suplimentare #i permit explo
rarea unor structuri vasculare nevizuali
zate la examenul Doppler f~r~ contrast.
Astfel,de#iestediminuatcaracterulnein
vazivalexplor~rii,cre#teacurate[eadiag
nosticului(Fig.34).

Fig.34.ExaminareDopplerspectralposibil~`nparenchimulunuirinichitransplantat

(suspiciunedegrefonavascular),dup~administrareasubstan[eidecontrastecografic.

283

TratatdeUrologie

Stenozadearter~renal~

Apare `n majoritatea cazurilor (circa 66%) prin modific~ri de ateroscleroz~, restul


cazurilorfiinddatoratemaialesdisplazieifibromusculare.Stenozaartereirenaleesteprima
cauz~ a hipertensiunii arteriale secundare (Mitty HA, 1996). Examenul Doppler ar trebui,
teoretic, s~ eviden[ieze stenoza, sediul, gradul #i eventual cauza. Din p~cate, `n practic~
lucrurilenuse`nt]mpl~totdeaunaastfel.
Diagnosticul de stenoz~ poate fi presupus clinic, dar trebuie documentat imagistic.
Pentrudiagnosticuldestenoz~aartereirenalenusuntsuficientesemneindirectecumarfi
modific~ri morfologice renale, acestea fiind nespecifice sau tardive. Practic, este necesar~
vizualizareaartereirenalepetottraiectul,delaaort~p]n~`nhilulrenal,examenulDoppler
incluz]ndunexamenmorfologicalpere[ilorarteriali,unexamenalcon[inutuluivasului#io
m~surareaparametrilorhemodinamici`ndiferitepunctepetraiectulvascular.
Majoritateaautorilorsuntdeacordc~`nsitua[iaunuiexamencorectefectuat,cuun
sistemecograficperformant,localizareaprofund~aarterelorrenale#icondi[iiledificilede
propagareaultrasunetelor(obezitate,steatoz~hepatic~,lumendigestivdestinsdegazetc.)
facadeseaimposibil~vizualizareaacestorartere(`np]n~la42%dincazuri)(MittyHA1996).
Laaceastacontribuie#ivarianteleanatomice,cumsuntarterelerenalemultiple.

Diagnosticulecograficdestenoz~arterial~sepunepe:
modific~rile de perete ce atrag reducerea diametrului vascular la locul stenozei #i
posibildilata[iapoststenotic~
modificarea de flux la acest nivel (morfologia anvelopei Doppler `n examinarea
Dopplerpuls,spectruldefrecven[el~rgitaltraseuluiDopplerspectral`nexaminarea
duplexDoppler,parametrihemodinamicimodifica[ilocal)
modificarea parametrilor hemodinamici la distan[~, poststenotic #i respectiv `n
parenchimulrinichiuluiafectat.
Modificarea de diametru este greu
de apreciat, artera renal~ av]nd oricum pe
traiect un diametru de doar circa 46 mm
(Fig.35).
Mai simpl~ este aprecierea diame
trelorlaoriginealordinaorta,loc`n careo
serie de procese patologice aortice (dilata[ii
anevrismale cu sau f~r~ tromboz~ asociat~,
pl~ci de aterom etc.) pot afecta #i
emergen[aarterelorrenale.

Fig.35.Stenoz~dearter~renal~dreapt~dup~
origineadinaort~.ExamenulDopplercolor

eviden[iaz~unfluxcuaspect`nmozaicdin

cauzavitezelorcrescute#iturbulen[eidinvas.

Modific~rile de flux constau `n primul r]nd `n cre#terea vitezei de curgere la locul


stenozei (Fig.35). Sau vehiculat mai multe opinii cu privire la valorile care s~ certifice
stenoza,astfel:
cre#tereavitezeisistolicepeste120140cm/sec.laloculstenozei
284

Capitolul5.2.Investiga[iaultrasonografic~

cre#terearaportului`ntrevitezamaxi
m~sistolic~dinarterarenal~#imaxi
masistolic~dinaort~peste3,5:1
cre#terearezistivita[ii`narterarenal~;
indexul de rezistivitate crescut peste
0,7(saumaispecificpeste0,8)pre
stenotic
absen[afluxului(viteza=0)`nstenoza
total~
cre#tereaturbulen[ei(spectrudefrec
ven[el~rgit)laloculstenozei.
Fig.36.ExaminareaDopplerspectraleviden[iaz~vitezemultcrescute,deaproape4m/sec.`n
arterarenal~,laemergen[adinaort~.

Modificarea parametrilor hemodinamici `n parenchimul renal se traduce printro


anvelop~Dopplercutendin[adeaplatizare(semnaltardusparvus)cuo`ncetinireaaccele
ra[ieisistolice#ioreducereaamplitudiniivitezeimaximesistolice(DudeaMS,2004).
Al[i autori apreciaz~ sc~derea indexului de rezistivitate #i pulsatilitate `n vasele
parenchimatoasedinrinichiuldependentdearterastenozat~,asimetric,cu0,150,2fa[~de
rinichiulnormal.Modific~riletuturoracestorparametripotfisensibilizateprinadministrare
deCaptopril,inhibitordeenzim~deconversie,carerelev~maibineunelemodific~riminime
`nstenozeleunilaterale.

Cu toate acestea, ecografia cu examen Doppler nu poate fi considerat~ un test


screening pentru detec[ia stenozei de arter~ renal~. Din fericire, un arsenal de metode
radiologice (arteriografia cu substrac[ie digital~, angioRM) sau scintigrafice (nefrograma
izotopic~cu99mTcDTPAcombinat~cutestulcucaptopril)poates~stabileasc~diagnosticul.

Infarctulrenal

Apare prin ocluzia unui ram arterial, dimensiunea ramului dict]nd `ntinderea
infarctului.Saudescrischiarsitua[iideocluzietotal~aartereirenalesoldat~,`ntroprim~
faz~, cu absen[a complet~ a vasculariza[iei la examenul Doppler (color sau power) pe un
rinichiadeseanormalmorfologic.
Infarctulrenalrecunoa#teofaz~acut~`ncareleziuneaparenchimatoas~ajungede
obicei subcapsular, supradenivel]nd capsula prin edemul local #i conferind un aspect greu
delimitabil,asem~n~torcupielonefritaacut~(HedayatiB,2007).
`n faza subacut~, leziunea se delimi
teaz~ mai evident #i pot s~ apar~ unele
complica[ii (ex.: abcedarea) pe fondul tulbu
r~rilorvascularetisularelocale.
`n faza cronic~ poate ap~rea aspectul
triunghiular, hiperecogen, bine delimitat.
Fibroza cicatricial~ poate s~ trac[ionezestruc
turile tisulare adiacente, subdenivel]nd
capsularenal~(Fig.37).

Fig.37.Aspectcicatricial`ntreimeamedieaparenchimului,dup~uninfarctrenal.
285

TratatdeUrologie

Anevrismuldearter~renal~

Aparecaodilata[iepulsatil~maifrecventcuaspectfuziformsausacularpetraiectul
artereirenale.LaexamenulDoppler,forma[iuneaprezint~semnalvascular`ninterior,dar#i
posibilitateavizualiz~riiunuitrombmural.Ecografistultrebuies~m~soarediametrulmaxim
#i`ntindereaanevrismului,undiametrudepeste2,5cmindic]ndsanc[iuneachirurgical~din
cauzarisculuiderupere.

Trombozadeven~renal~

Aparec]ndsunt`ntrunitecondi[iilegeneraledetromboz~,respectivsc~dereavitezei
decircula[ie(compresieextrinsec~,fibrozaretroperitoneal~,traumatism),cre#tereacoagu
labilit~[ii(deshidratare,sindromparaneoplazic)#imodificareapereteluivascular(inflamato
rie,tumoral~).
Ecografic, rinichiul apare m~rit prin
edem,hipoecogen,cuarhitecturap~strat~,
dar cu estomparea diferen[ierii cortical~
medular~(AschwandenM,2006).Examenul
ecografic `n modul bidimensional al venei
renale poate releva material trombotic
`ntroven~decalibrucrescut(Fig.38).

Fig.38.Trombtumoral

`nvenarenal~st]ng~,`nhil.

Adesea,dincauzatrombozeiextinse,venanusedeta#eaz~destructurilesolidede
vecin~tate. Examenul Doppler (color, duplex sau triplex) demonstreaz~ de obicei lipsa
semnalului `n vena renal~ trombozat~. Frecvent, mai ales c]nd tromboza este de cauz~
tumoral~, trombul din vena renal~ se prelunge#te `n vena cav~ inferioar~ p]n~ `n
vecin~tateahiatusuluidiafragmaticalacesteiasauchiar`ldep~#estecranial.

13.Rinichiultransplantat

`n explorarea rinichiului transplantat, ultrasonografia sa impus ca o metod~


excelent~deevaluareamodific~rilormorfologice#iapatologieideoricetip,`nprimulr]nd
datorit~ pozi[iei superficiale a grefonului, ceea ce `l face mai u#or de examinat dec]t pe
rinichiulnativ.Ecografistultrebuies~fieinformatdespretehniciledetransplantrenal#imai
ales despre varianta tehnic~ folosit~ curent `n serviciile de urologie cu care colaboreaz~.
Rinichiul transplantat este pozi[ionat extraperitoneal `n fosa iliac~ dreapt~ sau st]ng~, cu
anastomoza terminolateral~ a pediculului vascular renal la pachetul iliac extern #i o
implantare direct~ a ureterului pe peretele superior al vezicii, `n partea liniei mediane de
careestepozi[ionatgrefonul.

Studiilemorfologiceauar~tatocre#tereavolumuluigrefonuluiimediatdup~trans
plant, ajung]nduse la o cre#tere a dimensiunilor cu circa 1520% eviden[iat~ la dou~
s~pt~m]nidup~interven[ie(LachanceSL,1988).

286

Capitolul5.2.Investiga[iaultrasonografic~

Complica[iile care pot ap~rea dup~


transplantul renal pot fi de tip morfologic
(anatomic)saufunc[ional.
`n categoria complica[iilor morfologice
intr~celelegatedeactulchirurgicalceauo
posibil~ cauz~ vascular~: pseudoanevrisme,
fistulearteriovenoase,stenozesautrombo
zearterialesauvenoase(Fig.39).

Fig.39. Colec[iesubcapsulagrefonului.

Altecomplica[iidetipmorfologic,decauzenevascularesunt:limfocelul,hematomul,
urinomul, abcesul, hidronefroza. Toate acestea sunt complica[ii pe care explor~rile ima
gistice`ngeneral#iecografia`nspecialpots~ledepistezecuoexcelent~sensibilitate#icuo
relativbun~specificitate,examenulDopplerfiindobligatoriu`ncomplica[iilevasculare.

Complica[iile func[ionale includ rejetul (hiperacut, acut #i cronic), necroza acut~


tubular~ #i toxicitatea prin supradozajul medica[iei imunosupresoare. Fiind caracterizate
prinmodific~rimorfologicemaimultsaumaipu[inevidente,darmaialesnespecifice,aceste
complica[iisuntmaidificildediagnosticatecografic.#iaiciexplorareavascular~cumetoda
Dopplercre#tesensibilitatea#i`mbun~t~[e#tespecificitateadiagnosticuluiecografic.

Desigur,toateacestecomplica[iitrebuiev~zute`ncontextulunormodific~riclinice,
modific~ri de la care dac~ se pleac~, #i care, dac~ sunt cunoscute de ecografist,
`mbun~t~[escacurate[eadiagnosticului(`nspecialpentrucomplica[iilefunc[ionale).

Complica[iimorfologice

Colec[iile perinefretice la nivelul grefonului sunt destul de des `nt]lnite, dup~ unele
statistici ele fiind semnalate `n p]n~ la 50% din cazurile de pacien[i transplanta[i renal
(Khositseth S, 2007). Dac~ nu sunt de dimensiuni mari, exercit]nd compresii pe parenchim
sau sistemul colector #i au tendin[a de a diminua la examene ecografice repetate, aceste
colec[iinuartrebuis~pun~problemedeosebite.

Elepotfiseroame,dar#imicihematoamecareseprezint~ecografic`nmodvariat,
`n func[ie de vechimea hematomului (Fig.40). C]nd este vizualizat `n primele 2448 de ore
aparecaoimaginelichidian~cecoafeaz~deobiceiunuldinpoliirenali.Ulterior,retrac[ia
cheagului#iorganizareafibroas~creeaz~pseudosepturi`ncolec[ie.

Asem~n~tor
se
prezint~
#i
limfocelul, care apare ca o colec[ie
lichidian~, cu aspect multiloculat, format~
prin sec[ionarea canalelor limfatice `n
timpul actului operator. Rezult~ o
acumulare lichidian~ (limfatic~) vizibil~
dup~ c]teva s~pt~m]ni de la transplant.
Cicatrizareaartrebuis~conduc~lareluarea
drenajului limfatic #i diminuarea colec[iei
p]n~ la dispari[ie. Drenajul percutan este
rar eficient, colec[ia av]nd tendin[a de a se
refacedup~suprimareacateterului.

Fig.40. Hematomcecomprim~pachetuliliac.

287

TratatdeUrologie

Mairapid,`nprimelezilepostoperator,sepoateconstituiunurinom,reprezent]ndo
acumulare de urin~ ap~rut~ prin lezarea sistemului colector extrarenal #i mai ales prin
necroza ureterului la nivelul ureteroneocistostomei. Ecografic se prezint~ ca o colec[ie cu
lichidclar,f~r~ecouri`ninteriorsaudepozitdecliv.Dac~diagnosticulecograficridic~dubii,
diagnosticul de certitudine poate fi stabilit scintigrafic sau cistografic, ambele metode
ar~t]ndoscurgere(aradiotrasorului#i,respectiv,asubstan[eiiodate)dinsistemulcolector.

Toatetipuriledecolec[iiprezentatemaisussepotsuprainfecta,rezult]ndunabces
cuimagineaecografic~decolec[ieorganizat~cudetritus`ninterior#ibuledegaz(imagine
uneori mai greu de recunoscut din cauza anselor intestinale cu gaz `n lumen). Pacientul
prezint~semneleclinicedeinfec[ie.

Hidronefroza este u#or de diagnosticat ecografic, orice dilata[ie de sistem pielo


caliceal sau ureter fiind vizibil~ `n cazul rinichiului transplantat (Platt JF, 1991). Un grad
moderat de distensie pielocaliceal~ poate s~ existe `n mod normal `n primele s~pt~m]ni
dup~transplant,prinedemullaloculanastomozeiureterovezicale.Dac~distensiapersist~,
serecomand~reexaminareapacientuluicuvezicaplin~#iimediatdup~ceestetrimiss~o
goleasc~. Dac~ dilata[ia pieloureteral~ dispare odat~ cu golirea vezicii, aceasta sa datorat
maiprobabilrefluxuluivezicoureteral.`ncazul`ncaredilata[iapersist~dup~golireavezicii,
estefoarteprobabilvorbadeoobstruc[ieureteral~ceaprovocathidronefroza.Dac~vezica
prezint~ reziduu postmic[ional este vorba de o obstruc[ie (obstacol, compresie) la nivel
subvezical.

Sa`ncercatfolosireaindexuluiderezistivitate`ndiagnosticulhidronefrozei(KelczF,
1990). Consider]nd capsula renal~ inextensibil~ #i presiunea subcapsular~ crescut~ prin
distensiasistemuluicolector,indexulderezistivitatesemodific~`nvaselerinichiuluitrans
plantat. Din p~cate, de#i confer~ o oarecaresensibilitate,parametruleste lipsit de specifi
citate,modificareaindexuluiderezistivitatesurvenind`nmultealtecomplica[iialerinichiului
transplantat.

Stenoza arterei renale poate surveni ca rezultat al unei complica[ii chirurgicale,


legat~detehnicadeanastomoz~vascular~.Stricturaanastomozeiapare`nspecial`nanasto
mozele de tip terminoterminal. De asemenea, este descris~ stenoza de arter~ renal~ `n
procesul de rejet al grefonului sau secundar~ unei afec[iuni vasculare intrinseci (Dodd GD,
1991)(Fig.41).
ExamenulDopplerpulspermitevizua
lizarea sediului stenozei `n paralel cu
`nregistrarea traseului Doppler spectral
`n vas. Chiar dac~ vasul este de calibru
redus,#imorfologicnusepoatepune`n
eviden[~modificareadeperetevascular,
traseul Doppler spectral eviden[iaz~ la
locul stenozei o curgere turbulent~
(spectru de frecven[e l~rgit) #i o vitez~
de curgere crescut~ semnificativ, peste
180cm/sec.

Fig.41.Stenozaartereigrefonului.

Trombozaartereirenaleaparec]ndse`ntrunesccondi[iileclasicedetromboz~:
sc~dereavitezeidecircula[ie`nvas(ex.:hipotensiune)
288

Capitolul5.2.Investiga[iaultrasonografic~

hipercoagulabilitate(ex.:hemoconcentra[ie)
modificarea peretelui vascular (ex.: leziuni ale intimei secundare anastomozei
vasculare).

Cauzaceamaifrecvent~oconstituierejetulacut,situa[ie`ncareaparfenomenede
tromboz~arteriolar~.Trombozapoateprogresap]n~`narterarenal~agrefonului.Examenul
Dopplercolor#ipuls`nregistreaz~semnaldiastolicinversatsauabsent(depindedeloculde
plasare a ferestrei de e#antionare Doppler). Modific~rile pot progresa p]n~ la dispari[ia
semnaluluisistolic#idiastolic`narterarenal~.

Trombozaveneirenalerecunoa#teacelea#icauzegenerale#ise`nt]lne#te`nsitua[ii
decompresievenoas~princolec[iicarescadvitezadecurgere`nvas,`ncazdehipovolemie
(hemoconcentra[ie cu hipercoagulabilitate) sau prin traumatizarea vasului intraoperator.
Examenul ecografic poate detecta o ven~ renal~ de diametru m~rit cu un con[inut hiper
ecogen (material trombotic) `n vas. Semnalul Doppler color poate fi absent (tromboz~
ocluziv~)sausporadic`ncazdetromboz~neocluziv~sauderemaniereatrombului.

Pseudoanevrismul recunoa#te o cauz~ iatrogen~ (de obicei punc[ia grefonului) #i


apareprinlezareaunuiramarterial.Ecograficseprezint~caoforma[iunelichidian~(transo
nic~) intraparenchimatoas~ cu semnal Doppler color, power #i puls (ultimul cu morfologie
arterial~,eviden[iat~petraseulDopplerspectral).

Fistulaarteriovenoas~poateap~reatotcaurmareapunc[ieigrefonului,atuncic]nd
suntlezate`mpreun~unramarterial#iunulvenos,suficientdemari#ideapropiatepentru
arealizaocomunicareimportant~.
Explorareaecografic~nudifer~deaspectele`nt]lnite`npseudoanevrism,vizualiz]nd
o imagine lichidian~ de obicei de dimensiuni reduse (Fig.42). Examenul Doppler color
eviden[iaz~semnalvascular`nforma[iunealichidian~.ExamenulDopplerpulsdemonstreaz~
spectru de curgere arterial cu rezistivitate joas~ #i viteze maxime ridicate pe versantul
arterial. Pe versantul venos, examenul Doppler spectral arat~ arterializarea fluxului venos
(Fig.43).

Fig.42.Imaginelichidian~`nrinichiulnativla

unpacienttransplantatrenal,cuHTA.

Fig.42.
Fig.43.SemnalDoppler`nforma[iunecu
arterializareaversantuluivenos;fistul~arterio
venoas~dup~punc[iabiopsierenal~pre
transplant.

289

TratatdeUrologie

Complica[iifunc[ionale

Rejetulhiperacutapareprinformareadeanticorpiantidonor#isemanifest~foarte
precoce, uneori chiar `n timpul opera[iei de transplant, necesit]nd renun[area la grefonul
ini[ial#i`nlocuirealuicuunaltgrefoncompatibil.Rejetulacutestetotunprocesautoimun
mediatcelular.Rinichiultransplantatestem~ritprinedem(corticalahipoecogen~cuestom
parea diferen[ierii cortical~medular~), modificare ce atrage cre#terea presiunii subcapsu
lare#icre#tereaindexuluiderezistivitate(lavaloripeste0,8).

Modificareaindexuluiderezistivitatefiindnespecific~#iap~r]ndtardiv(GenkinsSM,
1989),seindic~punc[iabiopsie,de#imaigreuacceptat~at]tdec~treurolog,c]t#idec~tre
bolnav,dindorin[adeaseevitaunelecomplica[iiredutabilealepunc[iei,cumarfioposibil~
fistul~arteriovenoas~sauunpseudoanevrism.

`nrejetulcronic,reac[iileautoimuneproducocluziacanalelorlimfaticeintrarenalecu
acumularea limfei `n parenchimul renal #i apari[ia unei zone de edem subcapsular vizibil~
ecograficcaoimaginehipoecogen~`nband~.

Toxicitatea la ciclosporin~ (nefropatia indus~ de terapia imunosupresoare) nu pro


ducemodific~rimorfologiceat]tdeevidentepentruafivizualizateecografic.Opiniiledifer~
`nceprive#teutilitateaexamenuluiDoppler.Studiile`ncareexamenulDopplerafostfolosit
pentrudepistareamodific~rilorvascularelanivelulgrefonului(GenkinsSM,1989)`ndiferite
complica[ii au demonstrat c~ parametrii vasculari erau modifica[i nespecific (index de
rezistivitate#ipulsatilitatecrescut).Studiiulterioarenudemonstreaz~constantmodific~ri`n
sensul cre#terii semnificative a indexului de rezistivitate `n cazul nefropatiei induse de
ciclosporin~(PozniakMA,1992).

Necroza acut~ tubular~, de#i apare prin mecanism vascular (ischemia grefonului
anterioranastomozelorvasculare),semanifest~caocomplica[iefunc[ional~#i,deaseme
nea, nu prezint~ un aspect morfologic specific ecografic. Afec[iunea poate produce
modific~ri minore eviden[iabile radiologic la nivelul sistemului caliceal (este necesar~
substan[~ de contrast). Altfel, aspectul ecografic nu se poate diferen[ia de modific~rile
indusedetoxicitatealaciclosporin~saudeceledinrejet.

14.Prostata

Anatomiaprostatei

Descrierea zonelor anatomice `n prostat~ permite o abordare mai precis~ a


patologieiacestuiorgansituatprofund,`nmiculbazin.Dela`nceputtrebuie men[ionatc~
examinarea ultrasonografic~ a prostatei pe cale transabdominal~, folosind vezica urinar~
destins~cafereastr~depropagarepentruultrasunete,r~m]nedoarometod~evaluativ~a
dimensiunilor,conturului,raportuluicuorganeledinjur#iaposibilelorprocesepatologice
`nvecinate. Dimensiunile reduse #i pozi[ia profund~ fac greu de apreciat modific~rile de
structur~aleprostateiprinecografietransabdominal~.Oaprecieremaiexact~aproceselor
patologice de prostat~, dar #i ale structurilor `nvecinate (vezicule seminale, perete vezical
posteroinferior#irect)sepoaterealizaprinmetodaecografieitransrectale.

Astfel,prostateiisedescriupatruzone(conceptintrodusdeMcNeal,`n1968):
zonaperiferic~reprezent]ndcirca70%din[esutulglandular.`nconjoar~uretradistal~
#i este separat~ de celelalte zone printro capsul~ chirurgical~ ce poate fi decelat~
ecografic(`nspecial`ncazdecalcificare)caoimagineliniar~sub[ire,hiperecogen~
290

Capitolul5.2.Investiga[iaultrasonografic~

zonadetranzi[iecon[inecirca5%din[esutulglandular#iestelocalizat~periuretralsub
formaadou~micizoneglandulare.Caudal,zonadetranzi[ieeste`ncontactcuverum
montanum, la acest nivel afl]nduse jonc[iunea ductelor ejaculatorii cu uretra
proximal~
zona central~ reprezint~ circa 25% din [esutul glandular #i este localizat~ la baza
prostatei,fiindstr~b~tut~deducteleejaculatorii
glandeleperiuretralereprezint~circa1%din[estulglandular#isuntlocalizate`na#a
numitul sfincter prostatic intern reprezentat de mu#chiul neted de la nivelul uretrei
proximale.

Tehnicaexamenuluitransrectal

Pacientul,curectulgolit#if~r~opremedica[iespecial~(eventualunanxiolitic),este
pozi[ionatpepatuldeexaminare,`ndecubitlateralst]ng.Coapselesuntflectatepetrunchi,
musculaturaperineal~esterelaxat~.Estebinecaunexamenalprostateiprintu#eurectals~
precead~examinarea ultrasonografic~. Cu acest prilej,examinatorul sesizeaz~ orice posibil
obstacol `n calea introducerii transductorului intracavitar #i localizeaz~ modific~rile de
consisten[~aleparenchimuluiprostaticpentruastabilicoresponden[acueventualeaspecte
imagistice. Transductorul intracavitar (cu apertura axial~ sau lateral~) este `nvelit `ntrun
prezervativ,dup~ce,`nprealabil,`ntrefantadelucruatransductorului#i`nveli#uls~usa
interpusocantitatemoderat~degel,pentrueliminareaaerului.Transductorulcu`nveli#ul
lubrifiat este introdus treptat `n rect printro u#oar~ mi#care de rota[ie, cu achizi[ia de
imaginepornit~pentruaseapreciaperetelerectalchiardinvecin~tateaorificiuluianal.`n
cazul transductorilor cu vizare axial~, markerul de pe m]nerul acestuia permite orientarea
rapid~aimaginii.Seiaucarepereperetelerectalanterior#iperetelevezicalinferior.Sefac
sec[iuni `n toate planurile posibile, prin tot parenchimul prostatic, dar #i prin structurile
`nvecinate.
Avantajul major al ecografiei transrectale const~ `n posibilitatea explor~rii cu
transductoricufrecven[amaredeemisie(`ngeneralpeste7MHz),transductorulfiindsituat
`nimediatavecin~tateastructurilordeexaminat.Aceastaasigur~orezolu[iefoartebun~a
imaginii structurilor examinate #i o sensibilitate crescut~ `n depistarea modific~rilor de
structur~.Dezavantajele principaleconstau`nlimitareac]mpuluideinvestigatlaoprofun
zimecenudep~#e#tedeobiceimaximum810cm,precum#i`nintroducereaunuigradde
invazivitate`nexplorareaecografic~.

Aspectulnormal
Aspectulprostatei`nexplorareatransrectal~depindedetipuldesec[iune.
`ntruc]t majoritatea transduc
torilor intracavitari au vizare axial~,
cea mai frecvent~ explorare este cea
`nsec[iunicoronale#iaxiale(Fig.44).

Fig.44.Vasculariza[iaprostatei

normaleecografietransrectal~.

291

TratatdeUrologie

`n planul coronal, prostata are un aspect simetric, iar jonc[iunea [esutului hipo
ecogen periuretral cu verum montanum se vizualizeaz~ central, ca o band~ hipoecogen~
evazat~ la cap~tul dinspre rect, reprezent]nd o adevarat~ ax~ de simetrie pentru paren
chimulprostatic.
Uneori,sepoatevizualizacapsulachirurgical~caresepar~zonaperiferic~derestul
parenchimuluiglandular.
Pe sec[iunea transversal~ se poate delimita mai bine [esutul prostatic de gr~simea
periprostatic~,de#icapsulaprostatic~nuestebinedefinit~histologic.
Structura normal~ const~ `n arii izoecogene `n zonele periferic~, tranzi[ional~ #i `n
zonacentral~.
`nmodnormal,zonacentral~esteu#ormaihiperecogen~dec]tzonaperiferic~.
Eventualele diferen[e de structur~ ecografic~ se datoreaz~ ecogenit~[ii diferite a
mu#chiuluineteddeceaa[esutuluigr~sos.

Aspectepatologice
Constauadesea`nmodificareadimensiunilorprostatei(simetricsauasimetric)#ide
aceeaprostatasem~soar~`ncele3dimensiuni#iseapreciaz~volumul:

Volum=Diam.transversxDiam.anteroposteriorxDiam.craniocaudalx0,523

Se cerceteaz~ prezen[a unor posibile aspecte patologice periprostatice, legate de


veziculele seminale, peretele vezical sau cel rectal sau a unor colec[ii lichidiene peri
prostatice.
Setrecelaapreciereastructuriiprostatei,lacare,`nafaraaspectuluiecografichipo
sau hiperecogen al leziunilor, compresia cu transductorul poate s~ l~mureasc~ dac~ este
vorbadespreoimaginelichidian~(u#orcompresibil~),ohipertrofiebenign~(compresibil~)
sauuncancerdeprostat~(necompresibil).
Din zona tranzi[ional~ se dezvolt~ hipertrofia benign~ de prostat~ a v]rstnicului.
Aceasta produce o m~rire de volum a postatei, `n general simetric~, put]nd `mbr~ca dou~
aspecte:
unaspecthipoecogendifuz`ncazulprimuluitip,datorat~hiperplazieifibromusculare
sauprolifer~riiomogeneastromei
un aspect ecografic variabil (hipo #i hiperecogen difuz) `n situa[ia tipului de hiper
trofiebenign~caracterizatprinhiperplaziaglandular~.
Un aspect posibil de observat este prezen[a unei mici imagini intens hiperecogene,
care(dac~ecografulestecorectreglat,cufocalizarealanivelulzoneideinteres)prezint~un
condeumbr~posterior.Aspectulestetipicpentruuncalcul.
Doar`ntre10%#i20%dintreproceselemalignealeprostatei`#iauoriginea`nzona
tranzi[ional~.

`nzonacentral~p~trundsimetricveziculeleseminalecadou~imaginihipoecogene
`n band~, precum #i vasele deferente, confluen[a form]nd bilateral ductele ejaculatorii,
structuri ce nu trebuie confundate cu aspecte patologice. Prin refluxul urinei `n ducte,
posibiliicalculisepotdezvolta`ncorporaamilacea,`nzonacentral~.

De#i doar aproximativ 5% din procesele maligne se dezvolt~ din zona central~, ele
trebuierapiddepistate,`ntruc]tpotinvadarapiddincauzalipseicapsuleilaloculdeintrare
alveziculelorseminale#ialvaselordeferente.

292

Capitolul5.2.Investiga[iaultrasonografic~

Zona periferic~ poate fi mai u#or recunoscut~, av]nd un aspect mai hiperecogen
comparativ cu aspectul hipoecogen al zonei tranzi[ionale, `n hipertrofia benign~ a v]rstni
cului.
Aproximativ 70% din cancerele de
prostat~ se dezvolt~ din zona periferic~,
darnumaitreisferturidintreeleau#ansa
de a fi depistate la examenul digital prin
tu#eurectal.Restulsesitueaz~anteriorde
nivelulluiverummontanum#ipotfinepal
pabile`nmomentulexamin~rii(Fig.45).

Fig.45.Tumor~`nlobuldreptprostatic ecografie transrectal~.

ExamenulDopplercolor#ipowerestefoarteutil`napreciereauneiforma[iuniintra
prostatice. O vasculariza[ie crescut~ la examenul Doppler demonstreaz~ adesea originea
malign~aforma[iunii,indiferentdecaractereleeimorfologiceecografice.
Este oricum binevenit~ examinarea Doppler `n toat~ masa parenchimului prostatic,
indiferent dac~ examenul ecografic bidimensional a depistat sau nu o forma[iune `n
parenchim.
Adesea, forma[iuni izoecogene, ce
pot s~ scape detec[iei ecografice, au o
vasculariza[ieabundent~#idevinvizibilela
examenulDoppler.
Totu#i, datorit~ existen[ei unor
cancere izoecogene cu restul paren
chimului #i f~r~ modific~ri de semnal
Doppler, ca #i pentru documentarea
histologic~ a forma[iunilor depistate eco
grafic,serecurgelapunc[iabiopsieprosta
tic~(Fig.46).

Fig.46.Tumorahipovascularizat~laexamenulDoppler
cenecesit~ biopsieprostatic~.

Punc[iabiopsieprostatic~

Biopsiaprostatic~clasic~utilizeaz~abordulcuaculdebiopsiepecaletransperineal~
sautransrectal~,cudegetulexaminatorului`nrect.
Primapunc[iebiopsieprostatic~afostf~cut~prinabordcuacultransperineal,utili
z]ndpentrughidajuntransductorintrarectal,cuvizarecircular~(HolmHH,1981).
Majoritateatransductorilorintracavitarifolosi[i`nprezentauunsistemdeghidajal
acului, adaptabil pentru punc[ia prostatei, solu[iile constructive fiind variabile de la un
produc~torlaaltul.
Aceledepunc[iesuntdemaimultefeluri,darcelecarescotunmice#antionhisto
logicsuntpreferatecelorcarepermitdoarexaminareacitologic~.`nfunc[iedefelulacului,
293

TratatdeUrologie

metoda de manevrare a acestuia `n abordul leziunii difer~ pentru fiecare tip de ac. Se
prefer~utilizareaunuisistemdebiopsiereautomatsausemiautomatadaptatacului`nlocul
clasicei seringi, sistem ce face manevra rapid~ #i sigur~, executabil~ de c~tre un singur
examinator.
M~suriledesiguran[~careseiau`nainteapunc[ieibiopsiesuntm~surigeneralecare
serecomand~`noriceactmedicals]nger]nd(miniminvaziv).Astfel,pacientuluiisesuprim~
medica[ia anticoagulant~ #i antiagregant~ plachetar~ pe un interval de timp suficient, ce
precede#isuccedemomentulpunc[iei.Explorareacoagul~rii#iceaatimpuluides]ngerare
sunt binevenite, ca #i administrarea unui antibiotic cu spectru larg `n scopul profilaxiei
infec[iilor.

Indica[iilepunc[ieibiopsieprostatice
`n [~rile `n care controlul antigenului specific prostatic (PSA) se folose#te ca test
screening, inclusiv parametrii deriva[i (PSA predictiv, PSAdensitate etc.), se practic~ de
rutin~metodabiopsieisextante.
Aceasta presupune `mp~r[irea prostatei `n #ase sectoare #i ghidajul ecografic al
biopsiei`nfiecaredincele#asezonealeprostatei(PellerPA,1995),chiardac~explorarea
imagistic~nudetecteaz~niciomodificare.
Metodaareastfelavantajuldiagnosti
c~rii unor leziuni neoplazice izoecogene cu
[esutulprostatic.
Metoda biopsiei ghidate `n leziune
presupune, bine`n[eles, depistarea leziunilor
#i se recomand~ indiferent dac~ aspectul
imagisticalacestorapledeaz~saunupentru
caracteredemalignitate(Fig.47).

Fig.47. Adenocarcinom`nlobulst]ng prostatic confirmarebioptic~.

`npractic~,omodificaremorfologic~aprostateipoatefiodescoperire`nt]mpl~toare
cu ocazia unui examen ecografic f~cut pentru orice suferin[~ abdominal~ sau poate fi o
examinaredirec[ionat~deosimptomatologieprostatic~.Practic,ecografiaabdominal~are
valoareorientativ~,av]nddoaravantajultotaleineinvazivit~[i,motivpentrucarepacientulo
prefer~examenuluidigitalprintu#eurectal.Acestatrebuie`ns~s~completezeexaminarea
#ipentruceamaimic~modificaremorfologic~,dedimensiunisaustructural~,artrebuis~se
cerceteze nivelul seric al PSA (Olson MC, 1994). Orice suspiciune legat~ de un nivel mai
ridicatalPSAatrageautomatefectuareaecografieitransrectaleaprostatei.`nfunc[iedec]t
de mult este crescut nivelul seric al PSA #i de modific~rile ecografice g~site la examenul
transrectal,setrecelaefectuareapunc[ieibiopsieprostaticeghidat~,`ntrunadinceledou~
variante descrise. `n unele situa[ii, c]nd leziunea prostatic~ este evident~, se poate trece
directlabiopsierea[intit~aacesteia,`ncompletareaexamin~riiprostaticetransrectale.

Complica[iilepunc[ieibiopsieprostatice