Sunteți pe pagina 1din 23

Universitatea POLITEHNICA din București

Facultatea de Știința și Ingineria Materialelor


Master Biomateriale Metalice

Metode moderne de procesare a


biomaterialelor şi norme GMP

METODE DE OBŢINERE A ACOPERIRILOR FUNCŢIONALE


PENTRU APLICAŢII BIOMEDICALE

București
2017
Cuprins

1. Introducere ......................................................................................................................... 3
2. Metode de obtinere a acoperirilor funcționale- generalități ............................................... 4
2.1. Clasificarea metodelor de obținere a acoperirilor ........................................................ 5
3. Descrierea diferitelor tipuri de acoperiri bomedicale ........................................................ 8
3.1. Acoperiri bioactive și biocompatibile.......................................................................... 8
3.1.1. Acoperiri cu Hidroxiapatită .................................................................................... 8
3.1.2. Acoperiri cu biosticle active și ceramici vitroase ................................................... 9
3.1.3. Acoperiri cu compozite bioactive cu polimeri ..................................................... 10
3.1.4. Acoperiri cu oxid bioactiv .................................................................................... 10
3.2. Acoperiri antibacteriene ............................................................................................ 11
3.2.1.Acoperiri funcționale cu agent anorganic ............................................................. 11
3.2.2.Acoperiri funcționale cu antibiotice și anticorpi .................................................. 12
3.2.3.Acoperiri care eliberează oxid de azot ................................................................. 13
3.2.4.Acoperiri funcționale antimicrobiene peptidice ................................................... 14
3.3. Acoperiri anticorozive și antiuzură............................................................................ 15
3.3.1.Acoperiri oxidice .................................................................................................. 15
3.3.1.1.Oxidare termică ............................................................................................. 15
3.3.1.2.Oxidare cu micro-arc ..................................................................................... 16
3.3.1.3Implantare cu ioni de oxigen .......................................................................... 17
3.3.1.4.Metoda sol-gel ............................................................................................... 18
3.3.1.5.Pulverizare termică ........................................................................................ 19
3.3.2.Acoperiri cu nitruri ................................................................................................ 19
3.3.3.Acoperiri DLC ....................................................................................................... 20
Bibliografie ........................................................................................................................... 22

2
1. Introducere
Progresul realizat în domeniul ştiinţei materialelor şi al ingineriei, în mod special în
domeniile de procesare şi tratamente termo-mecanice permit ajustarea structurală a
materialelor metalice. Creşterea din ce în ce mai mare a aşteptărilor societăţii pentru un nivel
mai ridicat al vieţii a grăbit şi a înaintat cercetarea în domeniul biomaterialelor în special, în
domeniul tehnologiilor noi de obţinere și de caracterizare a implanturilor cu foarte bune
performanţe clinice.
În decursul ultimilor ani, s-a constatat că aderența microbiană la un anumit substrat,
care este urmată în aproape de colonizarea acestuia și formarea unor biofilme, este o problemă
majoră, din ce în ce mai răspândită în nenumărate domenii, pornind de la cel industrial, la cel
medical. Efecte considerabile s-au înregistrat, astfel, în implantologie, din această cauză
numeroase cercetări focalizându-se pe înțelegerea acestui mecanism de aderență și găsirea de
noi modalități de prevenire și combatere[1].
Este de așteptat ca utilizarea proiectată crescută de dispositive implantabile să
determine o creștere naturală a numărului de infecții. Astfel infecția asociată unui biomaterial
poate fi o complicație tot mai des întâlnită în cadrul chirurgiei ortopedice moderne, care
determină în cele mai rele cazuri și pierderi funcționale. Acest lucru se datorează faptului că
unii pacienți nu pot preveni în mod autonom formarea biofilmului pe suprafețele de implant,
[2] determinând apariția infecțiilor de natură cronică [3-7]. Se estimează că până în prezent
aproximativ 2,5% din artroplastiile primare de șold și genunchi și 20% din artroplastiile de
revizie prezintă complicații datorită apariției infecțiilor [8], iar ce este mai îngrijorător este
faptul că aceste valori sunt anual în creștere [9].
Biomaterialele metalice, cum ar fi oţelurile inoxidabile, aliajele pe bază de cobalt,
titanul şi aliajele sale sunt utilizate pentru implanturi de şold, plăci pentru fracturi sau
implanturi dentale datorită excelentelor lor proprietăţi mecanice şi a durabilităţii lor. Totodată,
pentru o durabilitate pe termen lung a implantelor chirurgicale, acestea sunt direct dependente
de proprietăţile de supraţă [10].
Cele mai mai multe implante biometalice au tendinţa de a elibera ioni în soluţie, cu
rezultat asupra potenţialului de coroziune în medii biologice, care determină probleme
inflamatorii şi deci pierderea implantului. Duritatea mică a suprafeţei, coeficientul mare de
frecare şi rezistenţa mică la uzare determină limitarea utilizării biomaterialelor metalice. A
fost raportat faptul că rezistenţa la uzură şi la coroziune sunt principalele raţiuni ale degradării
implanturilor chirurgicale, cum ar fi cele de şold sau genunchi, lucru care se întâmplă după
10-15 ani de utilizare.
O altă problemă asociată cu implantele metalice este capacitatea de a fi inerte biologic.
Materialele bioinerte sunt incapabile de a induce o osteogeneză pozitivă conectivă sau
creşterea osului nou, fapt care determină o rezistenţă mică de fixare între implant şi ţesutul
gazdă.
Pentru a proteja implantele metalice de coroziune şi uzură şi pentru a îmbunătăţi
bioactivitatea, au fost aplicate diferite tehnici de modificare a suprafeţei pentru a realiza o
gamă variată de acoperiri funcţionale a suprafeţelor implanturilor metalice. Cum infecţia
implantului cu bacterii este un principal impediment al utilizării acestora în ciuda tehnicilor de
sterilizare şi a celor aseptice, cercetările actuale au fost îndreptate în direcţia dezvoltării
acoperirilor cu activitate antibacteriană.
3
Problema obţinerii straturilor superficiale este destul de complexă, iar piesele sunt
considerate sisteme complexe formate din, strat superficial-substrat, asupra cărora se intervine
prin tehnologii specifice pentru modificarea proprietăţilor fiecărui element în parte, pentru a
obţine în final performanţele funcţionale dorite ale piesei în ansamblul ei.

2. Metode de obtinere a acoperirilor funcționale- generalități


Indiferent de metoda de depunere abordată, cel mai important aspect îl reprezintă
aderența stratului la substrat, iar în funcție de aceasta sunt impuse o serie de condiții. În
primul rând, alegerea materialului de depunere și a substratului trebuie să țină cont de
compatibilitatea celor două materiale. Această compatibilitate este legată în primul rând de
constantele de rețea ale celor două materiale și de coeficienții de dilatare termică ai
acestora[11].
Un alt aspect important în formarea straturilor îl constituie rugozitatea suprafeței.
Aceasta poate influența structura depunerii, deoarece stratul depus tinde să ia forma
substratului. Din acest motiv, suprafața stratului depus poate să fie neregulată, aspectul rugos
fiind datorat creșterii preferențiale în strucura columnară. De asemenea, și temperatura
substratului poate influența procesul de depunere, aceasta putând permite obținerea de
depuneri cu structură atât amorfă, cât și cristalină. Aderența startului la substrat sau mărimea
cristalelor depuse sunt în strânsă legătură cu temperatura[11].
În figura 2.1. este prezentat schematic sistemul: strat superficial-substrat, care prezintă
patru zone distincte, componentele și proprietățile cele mai importante ale sistemului [12, 13].

Suprafața de contact cu piesa sau cu mediul:


 Rugozitate
 Rugozitate la uzură i coroziune
 Porozitate
strat

Stratul superficial:
Interfață  Coroziune
 Tensiune superficială
 Proprietăți mecanice
substrat  Microstructură

Interfață:
 Aderența
 Interdifuzia
 Interacțiuneafizico-chimică strat-substrat

Substrat:
 Proprietăți mecanice
 Proprietăți termice

Fig.2.1. Sistemul strat superficial-substrat

4
2.1. Clasificarea metodelor de obținere a acoperirilor
În decursul ultimilor ani, multe domenii ale științei au dezvoltat un interes spectaculos
pentru depunerile de straturi subțiri.
Mediul de lucru în care se realizează depunerile, reprezintă un factor fundamental,
deoarece acesta are abilitatea de a influența atât compoziția, cât și structura straturilor depuse.
Astfel, în funcție de destinația materialului și implicit a stratului depus, pot fi controlați o serie
de factori, precum: timpul de depunere, grosimea stratului depus, rezistența electrică sau alt
parametru important[14].
O primă clasificare a metodelor de obținere a acoperirilor, des folosită în literatura de
specialitate, poate fi schematizată astfel:

Procedee Metode uscate Procedee


CVD de depunere PVD
(vapori)

Activare Activare Activare Evaporare Pulverizare Placare


termică în plasmă cu laser termică catodică ionică

Fig.2.1.1. Clasificarea procedeelor de obținere a straturilor subțiri (din fază de vapori) [15]

Metode umede
Electrodepunere Acoperire prin
de depunere
centrifugare
(soluție)

Sol-gel Electrostatică (sau Auto-asamblare


auto-asamblare chimică
polielectronică)

Fig.2.1.2. Clasificarea procedeelor de obținere a straturilor subțiri (din fază de soluții) [16]

5
Tabelul 2.1.1. Caracteristicile unor procese de depunere atomică [17].
Proces de depunere Evaporare termică Pulverizare Depunere chimică din
Caracteristica vapori
Mecanismul de producere a Energie termică Transfer de moment Reacție chimică
speciilor de depunere cinetic
Viteza de depunere Înaltă și foarte înaltă: Joasă până la medie: Medie: uzual 0.02- 0.025
uzual 1-2 μm/min, max uzual 0.01 μm/min, cu μm/min , mai mare în
75 μm/min excepția metalelor pure procesele asistate de
(exp. Cu- 1 μm/min ) plasma și fascicule de
particule
Specii de depunere Atomi și ioni Atomi și ioni Atomi
Uniformitea acoperirii Dependentă de Bună Dependentă de geometria
substraturilor cu suprafețe geometria sistemului reactorului, presiunea și
plane de dimensiuni mari de evaporare temperatura de lucru
Puterea de pătrundere pt:
- substraturi cu forme Slabă din cauza Bună dar grosime Bună
complexe umbririi geometrice neuniformă
- găuri mici, înfundate Slabă Slabă Limitată
Depunerea metalelor Da Da Da
Depunerea aliajelor Da Da Da
Depunerea comp. refractari Da Da Da
Energia speciilor de depunere Joasă: Poate fi înaltă: Poate fi înaltă în procesele
~0.1-0,5 eV 1-100 eV asistate de plasmă și
fascicule de particule
Bombardamentul substratului/ În mod normal, nu Da sau nu, în funcție de Posibil
stratului depus, cu ioni de gaz geometria sistemului
inert de pulverizare
Perturbarea interfeței de În mod normal, nu Da Da
creștere
Încălzirea externă a În mod normal, da În general, nu Da
substratului în timpul
depunerii

Tabel 2.1.2. Metodele chimice uzuale de obtinere acoperiri si compararea caracteristicilor principale
ale filmelor subtiri produse [18].
Metoda
Auto- Electrostatică
Acoperire prin
asamblare (auto-asamblare
Electrodepunere Sol-gel centrifugare
Caracteristica chimică polielectronică)
Adeziune Bună Bună Puternică Puternică Slabă
Stabilitate termică Înaltă, Înaltă, ~Slabă, ~Slabă, Slabă
dependentă de dependentă de dependentă de dependentă de
material material materialele polielectrolitul
organice folosit
folosite
Proprietăți Reonabilă Bună Reonabilă Reonabilă Slabă
mecanice
Precizia grosimii ~Slabă (zeci de ~Slabă (zeci Foarte înaltă Înaltă (domeniul ~Slabă (zeci
nn) de nn) (zeci de nm) nanometric) de nn)
Nivelul de ordonare Policristalin Amorf sau Foarte înaltă, Bună- ordonare Amorf sau
policristalin ordonare 2D strat cu strat policristalin
Compatibilitatea Foarte bună Foarte bună Reonabilă Reonabilă Foarte bună
industrială

6
Tabelul 2.1.2. prezinta metodele chimice uzuale de obtinere acoperiri nanostructurate
si compararea caracteristicilor principale ale filmelor subtiri produse. Aceasta clasificare
poate fi de ajutor in alegerea tehnicii de depunere potrivite pentru un anumit material si pentru
o anume aplicatie, deoarece proprietatile materialelor nanostructurate, produse prin diferite
metode chimice variaza foarte mult.
În ceea ce privește aplicațiile biomedicale pentru înlocuirea țesuturilr dure și nu numai,
se poate face o astfel de clasificare, precum în Fig. 2.1.3.
Acoperiri cu hidroxiapatită

Acoperiri cu biosticle active și ceramici vitroase

Acoperiri bioactive Acoperiri cu oxid bioactiv


și biocompatibile
Acoperiri cu compozite bioactive și polimeri

Acoperiri bioactive incorporate cu molecule biologice

Acoperiri funcționale cu antibiotice și anticorpi

Acoperiri funcționale cu agent anorganic


Acoperiri Acoperiri
antibacteriene
biomedicale
Acoperiri care eliberează oxid de azot

Acoperiri funcționale antimicrobiene peptidice

Acoperiri cu nitruri
Acoperiri
anticorozive
și antiuzură Acoperiri DLC

Acoperiri oxidice

Oxidarea Oxidare cu Implantare cu Pulverizare


termică microarc ioni de oxigen termică

Metoda
Sol-gel

Fig.2.1.3 Clasificarea acoperirilor biomedicale [10].

7
3. Descrierea diferitelor tipuri de acoperiri bomedicale

3.1. Acoperiri bioactive și biocompatibile

3.1.1. Acoperiri cu Hidroxiapatită


Recent, o atenţie deosebită este acordată în rândul cercetătorilor obţinerii unor
biomateriale cu scopul de reconstrucţie a ţesutului osos. Dintre aceste biomateriale,
hidroxiapatita (HA) prezintă o serie de proprietăţi deosebite, precum biocompatibilitate şi
bioactivitate, aceasta fiind frecvent folosită pentru realizarea grefelor osoase şi pentru
acoperirea unor componente metalice ale unor proteze utilizate în ortopedie.
Chiar dacă HA este disponibilă ca material sintetic de mai bine de 15 ani, fiind folosită
şi în implantologia ceramică de peste un deceniu, se caută noi soluţii de a include în structura
acesteia anumiţi substituienţi anionici sau cationici care să apropie compoziţia acesteia de
apatita biologică.
Având în vedere că viabilitatea implantului depinde de procesele care au loc la
interfaţa os-implant, optimizarea fizico-chimică a suprafeţei implanturilor folosite în chirurgia
ortopedică este fundamentală pentru realizarea unei integrări osoase consistente şi rapide[19].
. Există un mare interes în rândul fizicienilor, biologilor şi medicilor de specialitate
pentru dezvoltarea de suprafeţe biomimetice formate din fosfat de calciu şi proteine, care ar
îmbunătăţi aderenţa celulară şi, astfel, ar fi redus timpul de integrare osoasă [20]. Pentru a
evita pierderea de os periprotetică, se poate implementa terapia antiresorbţie medicamentoasă,
realizată prin includerea bifosfonaţilor care inhibă activitatea osteoclastelor [21]. Bifosfonaţii
sunt utilizaţi în multe boli, cum ar fi boala Paget a osului, osteoporoza, hipercalcemia[22].
Deşi efectul principal al bifosfonaţilor este inhibarea resorbţiei osoase a
osteoclastelor, există studii care arată un efect pozitiv şi asupra osteoblastelor. Astfel,
numeroase studii arată o creştere diferenţiată a celulelor progenitoare ale osteoblaştilor, cu
influenţe pozitive asupra proliferării şi maturării lor. În acelaşi timp, aceste studii
demonstrează că bifosfonaţii pot preveni apoptoza osteoblaştilor [23].
Cristalinitatea acoperirii cu HA variază de la 50% până la 90%. În prezent, nu există
un acord asupra cristalinităţii optime. Unanim este recunoscut faptul că acoperirile de HA cu
cristalinitate scăzută au tendinta mai mare de a se dizolva in lichidul uman, dând astfel naștere
la un ritm mai rapid de crestere osoasa, comparativ cu acoperirile cu cristalinitate mare. Cu
toate acestea, rata ridicată de dizolvare a acoperirii HA poate duce la degradarea mecanică,
deteriorarea adeziunea la interfață, ceea ce ar conduce în final la pierderea fixării și dezlipirea
învelișului. În plus, resturile de acoperire pot provoca reacții inflamatorii nedorite,
compromițând astfel fixarea implantului la os [10].
Procesele de pulverizare de plasmă la temperaturi înalte cauzează descompunerea unei
anumite cantităţi de fază HA într-un fosfat amorf și tricalcic (α și / sau β-TCP), fosfat
tetracalcic (Ca4P2O9, adică, TTCP) și oxid de calciu (CaO). Ratele de dizolvare ale acestor

8
produși de descompunere sunt mult mai mari decât cele de HA, și sunt în ordinea de TTCP >>
α-TCP> β-TCP >> HA [10]. Dizolvarea rapidă a acestor compuși Ca & P poate produce cu
ușurință o suprasaturare a mediului cu precipitate de apatită din suprafața de acoperire, ceea
ce duce la o creștere osoasă îmbunătățită. Ar trebui subliniat faptul că oxidul de calciu nu este
biocompatibil și trebuie evitat, deși are o viteză de dizolvare mare. Efectul secundar al
descompunerii HA este că dizolvarea rapidă a compusului Ca & P nou format poate provoca
degradarea rapidă nedorită a acoperirii. Prin urmare, atât cristalinitatea, cât și compoziția fazei
ar trebui să fie bine concepute sau controlate pentru utilizarea acoperirilor HA cu aplicaţii
biomedicale.

3.1.2. Acoperiri cu biosticle active și ceramici vitroase


De la descoperirea biosticlei în 1969 de către Hench, aceste materiale CaO-SiO2 au
fost studiate intensiv. Bioactivitate lor excelentă și biocompatibilitatea deosebită le face ideale
pentru aplicații biomedicale, în special în implanturi ortopedice si dentare. [10]
S-a demonstrat faptul că biosticla şi ceramicile de sticle bioactive sunt osteoconductive
[24, 25], acest fapt fiind pus pe seama formării unui strat relativ gros de CaP pe suprafața
acestora. Ca 29 proprietăți şi limitări acestea sunt similare ceramicilor fosfat-calcice, însă
anumite sticle prezintă rezistență mecanică mai mare decât ceramicile [26].
Tehnicile de suprafață pentru producerea acoperirilor de biosticla includ pulverizare în
plasmă, pulverizare cu flacără cu viteză mare de suspensie, sol-gel, tehnica de emailare,
depunerea electroforetică, pulverizare cu fascicul de ioni, cu laser cladding, și depunere laser
pulsata.
Da Silva şi colab. au prezentat [27] o clasă nouă de biomateriale proiectate din HA
întărită cu sticlă, GR-HA (glass reinforced HA), care dezvoltă bioactivitate mare şi
proprietăŃi mecanice mai bune comparativ cu faza de HA. GR-HA poate fi produsă prin
amestecarea de HA şi sticle bioactive. La adaosul de sticlă pe bază de CaO-P2O5
hidroxiapatitei, urmat de sinterizare, faza sticloasă reacționează cu HA. Fazele prezente vor
depinde de temperatura de sinterizare şi de compoziția sticlei.
Sticlele bioactive și materialele vitroceramice pot provoca interacțiuni complexe şi în
trepte cu fluidele corpului și țesuturile vii, prin care suprafața componentei nu suferă alterări
chimice și structurale care favorizează ulterior creșterea țesuturilor osoase. Rețeaua sticloasă a
acestor materiale poate fi parțial dizolvată de fluidele corporale, eliberând ionii Ca2+ și P5+ și
formarea unor cantități mari de grupuri Si-OH bioactive. Grupuri Si-OH pe suprafața de
acoperire sunt benefice pentru germinarea și creșterea apatitei în fluidele corpului care sunt
suprasaturate în raport cu HA, conducând astfel la formarea unui strat de suprafață cu o
substanță chimică și afinitate structurală a țesuturilor osoase. Ionii de Si eliberaţi de biosticlă
pot stimula reacții intracelulare și asista în continuare țesutul osos în lipirea la suprafața de
biosticla [10].

9
3.1.3. Acoperiri cu compozite bioactive cu polimeri
Acoperirile de HA și biosticlă sau bioceramice bazate pe Ca-Si posedă bioactivitate
excelentă și biocompatibilitate, cu toate acestea, deficiențele lor în proprietăți mecanice,
inclusiv fragilitate, rezistența la tracțiune mică și rezistență la impact, determină limitarea
utilizările lor în multe aplicații portante. Mai mult decât atât, caracteristicile lor de suprafață
care rezultă din compoziția chimică de suprafață pote fi insuficiente pentru inducerea
selectivă a adeziunii celulare, răspândire, proliferarea și diferențierea.
Inspirat din structura naturii osoase, biopolimerii cum ar fi colagen, gelatină, fibroin
de mătase și poli (lactidă-co-glicolidă), au fost folosiţi pentru obţinerea materialelor
anorganice compozit bioactive, cum ar fi HA. Compozitele rezultate sunt superioare mecanic
componentelor individuale datorită proprietăților ductile ale biopolimerului care măresc
tenacitatea la rupere a componentei anorganice. În plus, compozitele au proprietăți biologice
superioare comparativ cu componenții individuali, deoarece materialele compozite combină
bioactivitatea excelentă şi biocompatibilitatea.
În general moleculele bioactive sunt imobilizate pe suprafaţa metalică a implantului
prin asdorbţie, stabilindu-se legături covalente. În tabel sunt prezentate principalele metode de
imobilizare a moleculelor bioactive.

3.1.4. Acoperiri cu oxid bioactiv


Acoperirile cu oxid, cum ar fi TiO2, ZrO2 și SiO2 au, de asemenea bioactivitate. Cu
toate acestea, bioactivitatea lor este în funcție de tehnicile de acoperire și parametrii
procesului. Un rezumat de acoperiri oxid bioactive este prezentată în Tabelul 5.
Factori care influențează
Strat Metodă
bioactivitatea
Topografia, Structura
Sol-gel
cristalină
TiO2
Depunere electrolitică catodică Stuctura cristalină
Oxidare anodică Stuctura cristalină
ZrO2 Depunere cu arc catodic Suprafața nanostructurată
Oxidare cu micro-arc Grupul Zr-OH
Pulverizare în plasmă Structura cristalină
SiO2 Sol-gel Grupul Si-OH

Structura de suprafață (inclusiv rugozitatea, grănţii nanometrici), structura cristalină,


și de suprafață -OH grupuri influenteaza puternic bioactivitatea acoperirilor de oxid.
Grupurile - OH duc la suprafețe încărcate negativ care influenţează bioactivitatea acoperirilor
sol-gel de TiO2 și SiO2. Cu toate acestea, funcția de grupe -OH variază în funcție de structura

10
cristalină în care se găsesc grupurile -OH. De exemplu, s-a dovedit că grupurile -OH pe anatas
și rutil TiO2 sunt mai eficiente în inducerea precipitării de apatită în soluție SBF decât TiO2
amorf. În plus, acoperiri sol-gel de alumină nu arată bioactivitatea deși au multe grupuri -OH
pe suprafețele lor. Se consideră în general că zirconiu este un material bioinert, deoarece
ceramica de zirconia abia posedă abilitatea de a induce sinteza osoasă în mediu biologic. Cu
toate acestea, studiile recente realizate de Wang și colab. și Han și colab. au demonstrat
bioactivitatea in vitro a acoperiri de zirconiu prin pulverizare în plasmei și oxidare în micro-
arc.

3.2. Acoperiri antibacteriene

3.2.1. Acoperiri funcționale cu agent anorganic


Proprietăţile antiinfecţioase ale argintului şi ionilor de argint sunt cunoscute de multă
vreme. Au fost înregistrate de către US EPA (Agenția de Protecție a Mediului din SUA
2008), ca fiind materiale ce pot prezenta eficacitate antimicrobiană, materiale care conțin ioni
de argint [28], ioni de zinc [29,30] sau particule de titan [31].
În concordanţă cu Holt şi Bart, ionii de argint pot rupe membrana celulei bacteriene, a
lanţului oxidativ de fosforylan, pot distruge forţa motrice a membranei citoplasmatice şi
interacţiona cu grupul tiol la limita enzime, proteine. De asemenea, ionii de argint pot înlocui
alţi ioni de metale, ceea ce este esenţial pentru supravieţuire, cum ar fi Zn, Ca.
Activitatea antibacteriană a ionilor de argint acoperă un spectru larg de bacterii, de
exemplu P. aeruginosa, E. coli, S. aureus, şi S. epidermidis. Există diferite metode de
incorporare a ionilor de argint pe suprafaţa implantului, incluzând metoda sol-gel, implantare
cu ioni, depunere de ioni, oxidare electrolitică în plasmă, evaporare/ dizolvare, deunere
chimică din fază de vapori. Cele mai multe studii au încercat depunerea de Ag şi ioni pe aliaje
de titan, care au avut anterior diferite acoperiri, existând un dualism.
Se poate afirma că și o concentrație mare de ioni de zinc poate avea unele proprietăți
antibacteriene [29]. Oxidul de zinc este utilizat pe scară largă în stomatologie, unde au fost
raportate o serie de efecte antibacteriene ale acestuia. De asemenea, s-a arătat că și acetatul de
zinc are efect antibacterian asupra: Staphylococcus aureus, Staphylococcus epidermidis și
Staphylococcus aeruginosa [30].
D.K. Tiwari și J. Behari au raportat că nanoparticulele de argint expuse pentru scurt
timp la ultrasunete, a determinat o creștere a efectului antibacterian, dar nu suficient pentru a
ucide bacteriile. S-a constatat un efect de sinergie între ultrasunete și nanoparticulele de
argint, ultrasunetele facilitând intrarea particulelor de Ag în interiorul celulelor, îmbunătățind
efectul antibacterian[32].

11
3.2.2. Acoperiri funcționale cu antibiotice și anticorpi
Strategia clinică curentă pentru a preveni infecția cu antibiotice provocată de implant
este de a trata pacientul cu o concentrație ridicată de antibiotic, așa-numita strategie de
administrare sistemică. Problemele majore asociate cu această strategie includ distribuția
slabă a agentului antibacterian la locul implantului datorită circulatiei limitate a sangelui la
țesuturile scheletate infectate, și incapacitatea de a aborda direct scenariul patogen al
biofilmelor. Deși doza, uneori ridicată de antibiotice poate penetra țesutul sau biofilmele
formate pe implanturi, sunt, de asemenea, probabil să se întâmple în acest caz diferite efecte
secundare toxice. Cercetatorii depun acum eforturi pentru a substitui terapia sistemic
convențională cu un sistem de eliberare controlată și local antibacteriană. Potrivit analizei de
Wu et al., avantajele sistemului de eliberare controlată pe terapia cu antibiotice sistemice
poate fi rezumată în următoarele câteva puncte: administrarea de doze mici atunci când este
necesar, un control mai mare asupra toxicității și biodisponibilitatea de doză, mai puțin
sensibilitatea la promovarea rezistenta la antibiotice, durata prelungită de eliberare, evitarea
expunerii sistemice la medicament și eliberare controlată de pe suprafața implantului direct la
site-ul.
Un sistem ideal de eliberare cu antibiotice pentru tratarea infecției legate de implant, la
fel ca toate celelalte sisteme de eliberare a medicamentului, ar trebui să ofere un profil de
eliberare adecvat și eficient a antibioticelor la locul implantului. Anume, un profil local și
eliberarea controlată trebuie să fie caracterizată în mod ideal, printr-o rată ridicată de eliberare
inițială, urmată de o eliberare terapeutic durabil pentru perioade prelungite. Cele mai
frecvente antibiotice utilizate pentru tratarea infecției legate de implant includ vancomicina,
tobramicina, cefamandol, cefalotina, carbenicilină, amoxicilina și gentamicină [10].
Pentru controlarea eliberării de antibiotice, antibioticul trebuie să fie dopat sau
încărcat într-un material gazdă care poate fi din polimeri (de exemplu, poliuretan (PU),
cauciuc siliconic, poli L-lactic Acid (PLA), poli (acid glicolic) (PGA) și
polihidroxialcanoaților (PHA) și polimetilmetacrilat (PMMA)) și acoperiri anorganice (de
exemplu, hidroxiapatita). Acoperirea antibacteriană dezvoltat de această abordare se referă la
acoperirile cu matrice impregnată. Eliberarea de antibiotice este dependentă de cantitatea de
încărcare și proprietățile fizico-chimice ale antibioticelor și proprietățile materialelor gazdă
sau matrici.
Pentru a atinge un sistem de eliberare controlată a antibioticelor cu matrici polimerice,
este necesar ca polimerii să aibă un control hidrofil, care poate fi realizat prin schimbarea
raportului de hidrofil și lanțurile hidrofobe și ar trebui să aibă, de asemenea, un echilibru
adecvat de biodegradabilitate și biostabilitate. Polimerul hidrofil permite moleculelor de apă
să difuzeze în matrici, provocând expandarea sau / și degradarea polimerilor, astfel încât
antibioticele pot fi dizolvate în apă și eliminate din matrice, în timp ce lanțurile polimerice
hidrofobe pot reține stabilitatea matricilor în apă. În plus, similitudine chimice ca

12
lipofilicitatea între medicament și matricea polimerică poate duce la distribuirea
medicamentului omogenă în polimer, care apoi influențează profilul de eliberare a
medicamentului.

3.2.3. Acoperiri care elibereaza oxid de azot


Oxidul nitric (NO) este un regulator și mediator importantal pentru numeroase procese
în sistemul nervos, imunitar și cardiovascular, inclusiv relaxarea musculaturii netede,
rezultând astfel vasodilatația arterei și creșterea fluxului sanguin, neurotransmisia în sistemul
nervos și macrofage citotoxicitatea mediată de microbi și celule tumorale. NO poate fi
sintetizat în mod natural în organism prin diferite metode, precum sintetaza oxidului nitric
(NOS).
De exemplu, NO poate fi produsă prin sintaza endoteliale a oxidului de azot (eNOS)
sub stimularea trombocite factori care derivă, tensiune de forfecare, acetilcolina, și citokine.
NO poate fi de asemenea sintetizat prin macrofage in timpul fagocitozei bacteriilor. Expusă la
imunostimulante, macrofage activate poate produce superoxid (O2) și NO, care poate duce la
formarea unei peroxynitrite mult mai puternic oxidant (ONOO-). Peroxinitritul ar putea media
NO-dependente ucidere microbiene. Cu toate acestea, există un decalaj de timp între
producerea de O2 și sintezei NO ca prima etapă, iar mai târziu este nevoie de inițiere de mai
multe ore. Acest timp decalaj poate permite bacteriilor pentru a crea biofilme protejează-le
astfel de la iminenta ONOO-. Se propune ca o sursă suplimentară de NO ar putea favoriza
formarea ONOO- la etapa inițială a colonizarea atunci cand bacteriile sunt cele mai sensibile.
Recent, acoperiri cu cedare de NO s-au dovedit eficiente în reducerea aderenței bacteriene in
vitro și inhibarea infecțiilor legate de implant in vivo. Aşa cum arată schema 3.2.3.1, donorul
de NO sau grupele fucnţionale se produc la expounerea la donorul de hidrogen, cum ar fi apa,
în care diazeniumdiolat se descompune în NO şi precursorul corespunzător de amine [10].

Fig. 3.2.3.1. Reacția NO cu aminele pentru producerea donorilor de NO diateniumdiolat

Metoda chimică sol-gel este o abordare ușoară și eficientă pentru depunerea cu cedare
de NO pe suprafețe biomedicale de implant. Pe scurt, se prepară mai întâi o soluţie prin
amestecarea unei anumite cantităţi de butyltrimethoxysilane (BTMOS), etanol, apă, și acid
clorhidric, urmată de adăugarea unei anumite cantităţi de siliciu amino-alcoxizi (de exemplu,
N- (2-aminoetil) -3- aminopropylmethyldimethoxysilane (AEAP2), (aminoethylaminomethyl)
phenylethylethyltrime-thoxysilane (AEMP3), N- (6-aminohexil) –aminopropyltrime-
thoxysilane (AHAP3), și (3- trimethoxysilylpropyl) -diethylenetriamine (DET3)).

13
Pentru depunerea acoperirilor pe suprafețe de implant, pot fi utilizate atât metode de
acoperire de turnare cu picătura și metode de adâncime. Nablo și colab. au depusacoperiri pe
lamela de sticlă cu cedare de NO a substraturilor și oțel inoxidabil folosind metode sol-gel. Ei
au studiat patru precursori de amine diferite asupra comportamentelor lor NO de eliberare,
precum și activitățile lor bacteriene. O rată constantă de a eliberării de NO a fost observată
pentru toate compozițiile sol-gel cadrul 30 min în soluție tampon de fosfat (PBS), dar nivelul
de NO de eliberare a fost dependentă de cantitatea și tipul de funcțiune amină în filmele. Rata
de eliberare a crescut în ordinea DET3> AHAP3 ≈ AEAP2> AEMP3.
Testul de aderenta bacteriana a arătat că aceste acoperiri NR cedare ar putea reduce
bacteriană (P. aeruginosa) aderența cu 30% până la 90% în funcție de NO fluxul de acoperiri.
La un NO flux mai mic de 1 pmol· s -1 · cm2 -, aceste acoperiri pierdut activitatea lor
antibacteriană. Pentru a evalua eficacitatea lor ca acoperiri antibacteriene pentru aplicații
implant ortopedice, le-au aplicat cu cedare de NO acoperiri de a modifica suporturilor de oțel
inoxidabil [10].
Rezultatele au aratat ca acoperiri sol-gel au o stabilitate mai bună la substraturile din
oțel inoxidabil și a scăzut semnificativ adeziunea bacteriană. Pentru a valida rezultatele
testelor in vitro, in vivo activitatea antibacteriană a NO-eliberare acoperiri xerogel a fost
evaluată în continuare împotriva unei subcutanată infectie agresiv aureus S. . într-un model
animal subcutanat (șobolan). După 8 zile de la implantare, numărul de implanturi infectate cu
acoperiri cu cedare de NO a fost redus cu 82%. Rezultatele histologice au aratat ca capsulă
formează în jurul implanturilor cu cedare de NO a avut o mai mare vascularizație, comparativ
cu cei fără NO donor sau control neacoperite. Pe lângă avantajele menționate mai sus, Hetrick
și colab. au constatat că de acoperire cu cedare de NO poate promova, de asemenea,
integrarea dispozitiv eficient in tesutul vascularizat sanatos si reduce formarea de capsule de
corp străin.

3.2.4. Acoperiri funcționale antimicrobiene peptidice


O utilizare mai recentă de agenți antibacterieni pentru acoperirile biomedicale este
peptide antimicrobiene (AmPs). (AmPs) compusă în general din 15-45 resturi de aminoacizi
sunt moleculele efectoare ale imunității înnăscute și sunt folosite ca o prima linie de apărare
impotriva agentilor patogeni invadatori. După cum (AmPs) poate fi produsă de insecte, pesti,
mamifere și plante, ele sunt adesea numite peptide antimicrobiene naturale. (AmPs) au un
spectru larg de activitate antibacteriană față gram pozitive, gram-negative, și rezistența
multiplă bacterii. În plus, acestea nu sunt susceptibile de a provoca rezistența bacteriană ca
mecanismul lor antibacterian ar trebui să se bazeze pe efectul membrana destabilizare
specific.
Pe baza acestor merite, în curs de dezvoltare de acoperire antibacteriene cu aceste
peptide naturale pare a fi foarte atractiv in manipularea legate de infectii implant. Tabelul

14
prezintă unele peptide antimicrobiene (AmPs) folosite pentru a funcționaliza antibacterian
filmele biomedicale.

Tabel 3.2.4.1. Peptide antimicrobiene (AmPs) utilizate pentru funcţionalizarea filmelor şi principalele
metode de incorporare
Peptide Secvența de aminoacid Metoda de
antimicrobiene acoperire
Defensin ATCDLASGFGVGSSLCAAHCIARRYRGGYCNSKAVCVRN LBL
Chromofungin RILSILRHQNLLKELQDLAL LBL
Magainin I GIGLPLHSAGLPGLAPVGGIMLS SAM
Gramicidine A VGALAVVVWLWLWLW LBL
Ponericin G1 GWKDWAKKAGGWLKKKGPGMAKAALKAAMQ LBL
LL-37 [LL-37, 37 aa] EISA

Depunerile Strat-cu strat (LBL) și monostraturile de asamblare auto (SAM) sunt două
metode utilizate pentru a încorpora AmPs în filme pe suprafețe suport solid. Depunerea LBL
este un mijloc simplu și puternic pentru fabricarea acoperiri multistrat cu compoziții și
structuri specifice. Ea se bazează pe depunerea alternativă de materiale încărcate opus pe
suprafețe solide cu etape de spălare în între. Aplicabilitatea metodei de depunere LBL pe
încorporarea amperi în filme se bazează în mare parte pe cationic Componența AMPS. În
acest context, AmPs pot fi încorporate, pur și simplu în mutilayers polyelctrolyte prin
absorbție electrostatică în timpul construcției de film sau prin precomplexation cu polianion
utilizate pentru asamblarea LBL [10].
Mai multe peptide antimicrobiene, cum ar fi defensin, chromofungin, gramicidine A,
ponericin G1, și LL-37, au fost încorporate cu succes în filme polielectrolitice multistrat prin
metode LBL.

3.3. Acoperiri anticorozive și antiuzură

3.3.1. Acoperiri oxidice

3.3.1.1. Oxidare termică


Tehnica de oxidare termică este un proces utilizat pe scară largă în ingineria de
suprafata pentru a îmbunătăți proprietățile de rezistență la coroziune și la uzură a titanului pur
și aliaje deTi pe baza reacției termice. Acesta este de obicei efectuată într-o atmosferă
controlată care conține oxigen și azot la aproximativ 600 ° C.
Borgioli și colab. [13] au fabricat cu succes straturi de oxid de Ti-6Al-4V prin tratarea
Ti-6Al-4V într-un cuptor la 1173 K pentru 2 ore cu circulație de aer la 105 Pa, urmată de
stingerea cu ajutorul aerului comprimat. Testele de uzura efectuate pe probe netratate și probe
oxidate au arătat că tratamentul de oxidare termică a fost capabil de a îmbunătăți în mod
substanțial rezistența la uzură a probelor Ti-6Al-4V, reducând volumul de uzură de
aproximativ 4 până la 6 ori în comparație cu aliajul netratat.
15
Performanța îmbunătățită a fost determinată de formarea stratului de oxid greu și zona
de difuzie a oxigenului (ODZ) sub ea. Duritatea Vickers a fost crescut 169-492 (100 g masa)
pentru Cp-Ti și 369- 755 (100 g masa) pentru Ti-6Al-4V dupa tratament oxidare termică. Atât
stratul de oxid și ODZ au contribuit la îmbunătățirea rezistenței la uzură și prevenirea din
gama largă a coroziunii-uzură al Ti-6Al-4V. Cu toate acestea, stratul de oxid produs prin
oxidarea termică, în special la temperaturi ridicate (peste 800 ° C) și cu timpi lungi de
înmuiere, are o aderenta scazuta cu substratul și este înclinată la desprinderea. Pentru a
rezolva această problemă, tratamente de răcire cu o rată foarte mică poate fi aplicat pe titan
după oxidare termică [10].
În ceea ce privește proprietățile biologice, s-a demonstrat că atât Ti, cât și aliajul Ti-
6Al-4V au avut biocompatibilitate îmbunătățită după oxidare termică.

3.3.1.2. Oxidare cu micro-arc


Oxidarea cu micro-arc, denumită de asemenea şi oxidare în microplasma sau depunere
anodică prin scânteie, este o tehnologie de modificare a suprafeței dezvoltată pentru a produce
acoperiri dure, straturi groase de oxid pe substraturi metalice.
Aceasta este o metoda de depunere fizica care foloseste un arc electric de joasa
tensiune si curent mare pentru a vaporiza materiale de la o tinta catod. Materialul vaporizat
condenseaza apoi pe substrat. Tehnica poate fi utilizata pentru a depune straturi metalice,
ceramice si compozite. De asemenea metoda este folosita pentru a obtine depuneri de nitruri,
carburi, oxizi din catozi metalici cu proprietati de durificare si coeficienti redusi de alunecare.
Materialul ionizat este accelerat catre substrat de tensiunea bias negativa (potentialul dezvoltat
pe tinta in timpul aprinderii plasmei), care este aplicat acestuia. Ionii de metal intra in reactie
cu gazul reactiv (oxigen sau azot) introdus si bombardeaza cu o energie mare (10-100 eV)
piesele care urmeaza a fi acoperite si se depun sub forma unui strat de acoperire subtire, foarte
aderent [33].
Xue și colab. au realizat acoperiri ceramice pe Ti-6Al-4V prin oxidarea micro-arc în
soluție de aluminat. Acoperirea a fost compusă în principal din TiO2 sub formă rutil și
compușii TiAl2O5. Conținutul de TiO2 a crescut de la suprafață spre interiorul acoperirii, în
timp ce TiAl2O5 fost exact invers. Testele de nanoindentare au arătat că duritatea a fost
îmbunătățită în mod semnificativ prin această metodă şi a crescut treptat de la suprafață spre
interior cu variația fracției TiO2 lungul grosimii acoperirii. Cinetica de acoperire prin oxidare
cu microarc este controlată de natura interfeței și depinde în mare măsură de densitatea
curentului şi durata tratamentul aplicat.
În afară de Ti și Ti aliaje, oxidarea cu microarc a fost, de asemenea, utilizată pe scară
largă pe aliaj de magneziu pentru a se proteja la coroziune și la uzură. Rezistența la coroziune
a aliajului de magneziu AZ91D a fost îmbunătățită de peste 100 de ori după tratament MAO
în soluție conținând aluminat și fluorură de potasiu la densități de curent constant aplicate, ca

16
urmare a formării acoperirii ceramice compusă din faza spinel MgAl2O4 şi faza intermetalic
Al2Mg. Cu toate acestea, acoperirea MAO are, în general, o structură tip spumă ca, cu
porozitate mare vrac, care este nedorit în aplicații anti-coroziune și anti-uzură.
Activitatea desfășurată de Guo et al. a arătat că adăugarea de surfactanți în electrolit
poate inhiba cu succes generarea de pori în interiorul acoperiri ceramice, îmbunătățind astfel
calitatea acoperirii. Electroliții de silicat și electroliții de fosfat sunt, de asemenea, de multe
ori folosiţi în procesul MAO, ca acoperiri de protecţie anticorozivă şi antiuzură a aliajelor de
magneziu. S-a demonstrat că acoperirile formate din soluție de silicat au o capacitatea de
anticoroziune mai mare decât cea de la soluție de fosfat datorită compoziției de fază și a
structurii lor diferite [10].
Acoperirile formate din electrolit silicat sunt, de obicei compacte și sunt compuse în
principal din Mg2SiO4 și MgO, în timp ce de acoperirile din fosfat sunt relativ poroase și sunt
compuse în principal din MgO.

3.3.1.3. Implantare cu ioni de oxigen


Implantarea ionica este un proces prin care ionii dopanti sunt introdusi direct intr-un
substrat (prin bombardament ionic) dupa ce in prealabil au fost accelerati[34].

Fig.3.3.1.3. Reprezentre schematică a unui echipament de implantare ionică

Implantarea de ioni de oxigen poate fi, de asemenea, folosită pentru a îmbunătăți


rezistența la coroziune și uzură, precum și biocompatibilitatea materialelor metalice.
Implantarea de ioni include implantarea convențională cu fascicul de ioni de implantare și
imersiune in ioni in stare de plasma (PIII). În convențional implantarea cu fascicul de ioni, o
sursă de ioni este folosită pentru a crea un fascicul de ioni din specia care urmează să fie
implantată, iar apoi fasciculului de ioni este accelerat printr-un potențialul ridicat și
bombardat în substraturi. Este un proces liniar, astfel încât obiectele trebuie să fie manipulate
în mod corect pentru a obține suprafața dorită pe implant. Inițial s-a dezvoltat de Conrad
procedeul PIII, care nu necesita manipularea substraturilor [32]. Acesta a fost utilizat pe scară
largă pentru a îmbunătăți proprietățile suprafeței materialelor metalice biomedicale, cum ar fi
rezistenţa la uzură, rezistenţa la coroziune şi biocompatibilitatea.
17
Leng și colab. [33] au demonstrat că scufundarea în ioni de titan în stare plasmatică și
oxigen pe Ti-6Al-4V îmbunătățit conferă o rezistența la uzură foarte mare a Ti-6Al-4V sub
sarcină redusă. Duritatea noului strat format TiOx creşte odată cu creșterea presiunii parțiale a
oxigenului în intervalul 0 -3x10-2 Pa, și a ajuns la maximul de 17 GPa la o presiune parțială
de oxigen din 3x10-2 Pa. Totuși, grosimea filmelor nu a fost optimă pentru această aplicație.
Grosimea stratului de suprafață depinde de temperatura de implantare și durata tratamentului
[34]. La temperatură joasă, oxigenul nu difuzează în mod adecvat într-un material în vrac
limitând astfel grosimea stratului. Pentru aliaje NiTi, călite şi îmbătrînite, Tan [35] au
demonstrat că grosimea acoperirii de oxid implantarea folosirea oxigenului a fost influențată
de temperatura finală de transformare a austenitei (Af). Grosimea de oxid a fost de 1140 nm
pentru probele la care Af = 21 ° probe, mai mare decât cea la probele cu AF = -3 ° (370nm ).

3.3.1.4. Metoda sol-gel


Prin metoda sol-gel se pot sintetiza atat nanoparticule pure, stoechiometrice si
monodisperse de oxizi metalici, precum si filme subtiri. Metoda sol-gel este aplicata
preferential la obtinerea pulberilor ceramice. La pulberile astfel sintetizate, functie de tehnica
folosita, poate fi necesar un tratament termic ulterior de deshidratare, de indepartare a
componentelor organice si o cristalizare controlata pentru a forma oxizii cu structura si
dimensiunile cristalitelor dorite.
Peliculele de oxid sau acoperirile, cum ar fi SiO2, Al2O3, TiO2 și ZrO2, se pot
depune pe metale prin metoda derivata Sol-gel cu scopul de a îmbunătăți rezistența lor la
coroziune și uzură.
Procesul sol-gel, de asemenea, cunoscut sub numele de depunere soluție chimică, este
o tehnică chimică umedă, un proces care implică cinci etape principale:
 hidroliză și policondensare;
 gelificare;
 îmbătrânire;
 uscarea;
 densificarea și cristalizare.
Comparativ cu procedeele convenționale cu peliculă subțire, procesul sol-gel permite
un control mai bun al compoziției chimice și microstructurii peliculelor, care utilizează
echipamente simple şi un cost scăzut. Mai ales, temperatura de tratament termic este mai mic,
deoarece precursorii pot fi amestecaţi la nivel molecular în soluție și, astfel, se pot obține
filmele cu un grad ridicat de omogenitate. Acoperirile subțiri prin metoda Sol-gel de ZrO2,
SiO2, 70SiO2 -30TiO2 și compoziția 88SiO2 -12Al2O3 (mol%) au fost preparate din soluri
catalizate și depuse prin tehnica acoperire în adâncime pe folii de oțel inoxidabil 316L. Toate
acoperirile au condus la o rată mai scăzută de coroziune comparativ cu probele neacoperite.
Liu și colab. au depus acoperiri TiO2 pe aliaj NiTi folosind metoda sol-gel si au

18
comparat rezistenta lor la coroziune și compatibilitatea faţă de sange cu eșantion neacoperit.
Acoperirea a fost 205 nm în grosime și compus în principal din rutil TiO2 după sinterizate la
500°C. Testele electrochimice pe probe acoperite și neacoperite din aliajele NiTi în soluție
Tyrode au arătat o creștere a potențialului de defalcare (Eb) de 200 mV și o scădere a
curentului în pasiv (IP), indicând rezistența la coroziune îmbunătățită a aliajelor NiTi de
acoperire TiO2 . În plus, compatibilitatea la sânge a probelor din aliaj NiTi acoperit a fost, de
asemenea, superioară metalului neacoperit.
Comportamentul tribologic al filmelor TiO2 sol-gel pe un substrat de sticlă a fost
studiat prin utilizarea unui piston cu frecare și uzura faţă de un tester alunecare împotriva
Si3N4 minge și AISI52100 oțel. O ușoară deformare plastică a filmului și adeziunea sa bună
la suport au fost considerate a fi principalele motive pentru rezistenta la uzura îmbunătățită.

3.3.1.5. Pulverizare termică


Pulverizarea termică este un proces în care particulele semitopite sunt pulverizate pe o
suprafață a substratului. Această metodă poate fi împărțită în mai multe categorii în funcție de
sursele de energie utilizate pentru încălzirea sau topirea particulelor de pulbere, cum ar fi:
pulverizarea cu plasmă, pulverizare cu flacără, viteză înaltă pulverizare oxi-combustibil, cu
arc ș.a.m.d. Datorită capacității sale de încălzire de o temperatură foarte mare și a posibilităţii
de fabricare a componentelor cu straturi alternative cu materiale diferite, precum și a
costurilor reduse de exploatare și de capital, pulverizarea cu plasma a atras atenția în mai
multe domenii. O mare varietate de acoperiri ceramice, cum ar fi Cr2O3 - SiO2 -TiO2, Cr2O3,
Cr2O3 -Ni-Cr, WC-Co, TiO2, ZrO2, Al2O3 și genul asta, au fost studiate pentru proprietățile lor
tribologice. Cu toate acestea, numai acoperirile de TiO2, Al2O3 și ZrO2 au fost încercate
pentru a fi utilizate ca straturi biomedicale din cauza biocompatibilităţii lor bune [10].
Acoperirile de Al2O3 sunt deosebit de atractive datorită durităţii mari şi a
conductivităţii termice ridicate, dar problema lor este fragilitatea. Adaosurile de TiO 2 și ZrO2
pot îmbunătăţi rezilienţa, dar micşorează duritatea. Optimizarea proporţiei de alumină şi
zirconie în compozit poate îmbunătăţi rezistenţa la uzură.

3.3.2. Acoperiri cu nitruri


Nitrura de titan (TiN) este un material ceramic ce prezintă o rezistenţă ridicată la
uzare, un coeficient de frecare scăzut şi rezistenţă mecanică la temperaturi ridicate, etc. [35].
Nitrura de titan se foloseşte la realizarea de microstraturi dure pe scule aşchietoare,
pe componente din industria petrochimică, etc. supuse frecvent la solicitări complexe, uzare
abrazivă şi coroziune generalizată. De regulă, acest material ceramic se depune pe substraturi
metalice prin metodele PVD sau CVD, cu o eficienţă scăzută datorită faptului că aceste
metode asigură grosimi de microstraturi mici, sub 10µm [36]. S-a demonstrat că
performanţele microstraturilor de nitrură de titan depind de grosimea acestora, cu cât

19
grosimea este mai mare cu atât cresc şi valorile rezistenţei la uzare şi la coroziune [37].
Depunerea de microstraturi de nitrură de titan prin pulverizare termică în jet de
plasmă a titanului tehnic în atmosferă de azot conduce la realizarea de grosimi ce pot ajunge
la 200μm, şi microdurităţi cuprinse între 700 şi 800 HV 0,1 asigurând astfel o comportare
corespunzătoare la uzarea abrazivă şi coroziune a piesei.
Pulverizarea termică în jet de plasmă a pulberii de titan în atmosferă de azot este
un procedeul complex ce combină în acelaşi timp atât aspecte legate de pulverizarea termică
cât şi reacţii chimice ce apar în timpul procesului de pulverizare.
În figura 3.3.2.1 este prezentată schema de principiu a instalaţiei de pulverizare
termică în jet de plasmă de azot.

Fig. 3.3.2.1. Schema de funcţionare a procesului de obţinere a nitrurii de titan prin pulverizare
termică în jet de plasmă de azot
Datorită temperaturii înalte, pulberea de titan se topeşte în plasma de azot şi este
antrenată de jetul de gaz spre substrat. Particulele ajunse pe suprafaţa piesei, în stare plastică
aderă pe aceasta în baza unor mecanisme specifice. În urma reacţiei directe a particulelor de
titan topite cu azotul se formează compuşi de titan (TiN2, Ti2N, TiO2) sub diferite forme
microscopice.

3.3.3. Acoperiri DLC

Acoperirile de carbon tip Diamant (DLC) au o rezistența ridicată la uzură și o


rezistența la coroziune, inerție chimică, rezistivitate electrică mare, transparenţă în infraroșu,
indicele de refracție ridicat și o finețe excelentă. Toate aceste merite duc la un biomaterial bun
pentru aplicaţii în ortopedice, cardiovasculare, lentile de contact, sau stomatologie. Tehnici de
modificare Mulți suprafață au fost aplicate pentru a produce filme DLC cu o varietate de
materiale precursoare cărbunoase, inclusiv depuneri de fascicul ionic, depunere asistata de
plasma chimică de vapori (PACVD), filtrare în vid cu arc catodic (FCVA), placare cu ioni,
imersiune plasma implantare de ioni și depunere (PIIID), pulverizare cu magnetron,
pulverizare cu fascicul de ioni, depunere cu laser și depunere cu fasciculi de ioni [10].
Rugozitatea suprafeței filmelor DLC și substraturilor are o influență decisivă asupra
rezistenţei la uzura, mai ales în cazul unui material moale, cum ar fi ultra polyenthylene cu

20
greutate moleculară mare (UHMWPE). Acesta a fost raportat ca, chiar zgârieturi unice în
film, care poate fi nedetectabile prin măsurarea medie rugozitate, sunt capabile de a crește rata
de uzura a UHMWPE cu un factor de 30-70. Efectul rugozității suprafeței substratului asupra
comportamentului uzură a filmelor DLC fost investigat pe o platformă centrali-la-disc uzură
în aer uscat de Jiang și colab. Rata de uzură a filmelor a crescut semnificativ odată cu
creșterea rugozității suprafeței substratului, în timp ce comportamentul de frecare nu a fost
aparent afectat. Rugozitate de 0,93 pm s-a dovedit a fi rugozitatea critică a suprafeței
substratului, peste care mecanismul dominant de uzură schimbat de la aderarea la cip /
formarea balon și fragmentare [38].
Filmele groase sunt preferate pentru protejarea metalelor împotriva coroziunii și
uzurii. Cu toate acestea, tensiunea şi compresiunea pot limita grosimea maximă a peliculelor
adezive și pot provoca exfolierii în timpul uzurii. Prin urmare, sunt folosite diferite metode
pentru îmbunătățirea rezistenței de adeziune și de a reduce tensiunea la compresiune. În
primul rând, curățarea suprafeței de substraturi cu bombardament de ioni Ar înainte de
depunerea filmului oferă o rezistență la aderență ridicată. În al doilea rând, formând o
interfață mixtă între film și substrat în prima etapă de depunere poate crește, de asemenea
rezistența de adeziune. În al treilea rând, doparea cu elemente metalice sau non-metalice,
pentru a reduce stresul intern al filmului este de asemenea, o modalitate eficientă de a obține o
rezistență ridicată la aderență [38].
S-a raportat că doparea cu Si ar putea îmbunătăți puterea de adeziune și reduce stresul
intern, sporind astfel stabilitatea termică a filmului, precum și insensibilitatea coeficientului
de frecare la umiditatea. Metalele cu filme dopate precum Ta, W, Ti, Nb și Zr cu hidrogenat
scăzut, de asemenea tensiunilor interne și reduce dependența coeficientului de frecare a
filmului la umiditate. În al patrulea rând, o abordare multistrat folosind strat moale alternativ
este un alt mod eficient de a reduce stresul compresiune în filmul DLC. Filmele fabricate prin
această metodă au arătat performanță bună la frecare și uzură. În cele din urmă,-diamant
nanocompozite (DLN) de film. DLN film este o noua clasa de materiale cu reducerea stresului
și de compresie a crescut puterea de adeziune. Acest tip de film este compus din
întrepătrunderea a două rețele aleatoare amorfe, una este rețea DLC (α-C: H), iar cealălaltă
este o reţea α-Si asemănător sticlei. Avantajele sale includ, de asemenea o stabilitate mai mare
și o temperatură coeficient de frecare redus [10].

21
Bibliografie

[1] P. Kaali, E. Strömberg, S. Karlsson, Prevention of Biofilm associated Infections and Degradation
of Polymeric Materials used in Biomedical Applications, Pub. In Tech, 2011, pp. 513-540.
[2] J. Gallo, M. Holinka, C.S. Moucha, Antibacterial Surface Treatment for Orthopaedic Implants,
Rev., International Journal of Molecular Sciences, 15 (2014), pp. 13849-13880.
[3] R.M. Donlan, J.W. Costerton, Biofilms: s forurvival mechanisms of clinically relevant
microorganisms, Clin Microbiol Rev, vol.15 (2002), pp.167-193.
[4] R.M. Donlan, Biofilms and device-associated infections, Emerg Infect Dis, vol. 7 (2001), pp.
277-281.
[5] R.M. Donlan, Biofilms: microbial life on surfaces, Emerg Infect Dis., vol. 8 (2002), pp. 881-890.
[6] R.M. Donlan, Role of biofilms in antimicrobial resistance, ASAIO J., vol. 46 (2000), pp. 47-52.
[7] H. Ceri, M. Olson, et. al, The calgary biofilm device: new technology for rapid determination of
antibiotic susceptibilities of bacterial biofilms, J Clin Microbiol, 37 (1999), pp. 1771-1776.
[8] J.R. Lentino, Prosthetic joint infections: Bane of orthopedists, challenge for infectious disease
specialists. Clin. Infect. Dis. 2003, 36, pp. 1157–1161.
[9] H. Dale, G. Hallan, B. Espehaug, L.1. Havelin, L.B. Engesaeter, Increasing risk of revision due
to deep infection after hip arthroplasty. Acta Orthop. 2009, 80, pp. 639–645.
[10] Suport curs Metode modern de procesare a biomaterialelor și norme GMP, Prof. Brândușa
Ghiban.
[11] V. Suciu, M.V. Suciu, Studiul Materialelor, Fair Partners, București, 2007.
[12] ASM Handbook, Formerly, Ninth Edition, Metals, Corrosion Handbook, Vol.13, 1987. pp. 20-
40,47-49, 210-220, pp. 865-870.
[13] M. Bertagnolli, ş.a. – Modeling of Particles Impacting on a Rigid Substrate under Plasma
Spraying Cnditions, ASM International, March,Vol.4/1, 1994, pg. 41-47, pp. 117-136.
[14] Gh. Mateescu, Tehnologii avansate. Straturi subțiri depuse în vid, Editura Dorotea, București,
199822.
[15] W.A. Bryant, Review-the fundamentals of chemical vapour deposition, J. of Materials Science,
12 , 1977, pp. 1285-1306.
[16] A. Naboc, Organic and Inorganic Nanostructures, Artech House, London, UK, 2005, pp. 268.
[17] G. Ionascu, Curs Tehnologii moderne pentru straturi protectoare.
[18] R.W. Schwartz, et. al., Chemical solution deposition of electronic oxide films, Comptes Rendus
Chimie, 2004, vol. 7, pp. 433.
[19] D.A. Puleo, Encyclopedia of Biomaterials and Biomedical Engineering (1), 2004, Marcel
Dekker Inc., New York, pp. 190-198.
[20] C.J. WilsoN, R.E. Clegg, D.I. Leavesley, M.J. Pearcy, Mediation of biomaterial-cell interactions
by adsorbed proteins: A review. Tissue Eng. 2005; 11, pp. 1-18.
[21] S.J. Suratwala, S.K. Cho, J.J. Van Raalte, S.H. Park, S.W. Seo, S.S. Chang, T.R. Gardner, F.Y.
Lee, Enhancement of periprosthetic bone qwuality with topical hydroxyapatitebisphosphonate
composite. J. Bone Joint Surg. Am. 2008; 90, pp. 2189–2196.
[22] S.E. Papapoulos, Bisphosphonates: how do they work? Best Pract. Res. Cl. En. 2008; 22(5), pp.
831–847.
[23] F. Knoch, C. Eckhardt, C.I. Alabre, E. Schneider, H.E. Rubash, A.S. Shanbhag, Anabolic effects
of bisphosphonates on peri-implant bone stock. Biomater. 2007; 28, pp. 3549– 3559.
[24] H. Yuan, K. De Groot, NATO Science Series II: Mathematics, Physics and Chemistry, Springer
Netherlands 171(2005), pp. 37-57.
[25] R.Z. LeGeros, Y-K. J. Lee, Mat. Sci. Letters 39(2004) , pp. 5577-5579.
[26] T. Kokubo, H.M. Kim, M. Kawashita, Biomaterials 24(2003), pp. 2161-2175.
[27] Da Silva, M. H. P., Lemos, A. F., da Fonte Fereira, J. M., Santos, J. D., Mat. Research 6(3)
(2003), pp. 321-325.

22
[28] H. T. Michels, J.O. Noyce, C.W. Keevil, Effects of temperature and humidity on the efficacy of
methicillin-resistant Staphylococcus aureus challenged antimicrobial materials containing silver and
copper, Letters in Applied Microbiology, 49, 2009, pp. 191-195.
[29] S. Atmaca, K. Gül, R. Çiçek, The Effect of Zinc On Microbial Growth, Tr. J. of Medical
Sciences 28 (1998), pp. 595-597.
[30] G. Kalyani, VG. Anil, C. Bo-Jung, L. Yong-Chien, Preparation and characterization of ZnO
nanoparticles coated paper and its antibacterial activity study, J Green Chem 8 (2006), pp. 1034–1041.
[31] M.S.A. Shah, M. Nag, T. Kalagara, S. Singh, S.V. Manorama, PEG-PU-TiO2 polymer
nanocomposite films; an excellent system for antibacterial applications, Chem Materials 20(7) (2008),
pp. 2455–2460.
[32] D. Pitter, S. Harbarth, A. Voss, Antimicrobial Resistance and Infection Control, 2, 2013.
[33] D. Nistoran, V. Procese de depunere in plasma cu arc catodic (plasmatron)
[34] A. Anders, Metal plasma immersion ion implantation and deposition: a review, Surf Coat
Technol, 93, 1997, pp. 158-167.
[35] Lisong Xiao, Dianran Yan, Jining He: Nanostructured TiN coating prepared by reactive plasma
spraying in atmosphere, Applied Surface Science 253, 2007 .
[36] Dongli Zou, Dianran Yan, Lisong Xiao, Yanchun Dong: Characterization of nanostructured TiN
coatings fabricated by reactive plasma spraying, Surface & Coatings Technology 202, 2008.
[37] Zhengping Mao, Jing Ma, Jun Wang, Baode Sun: The effect of powder preparation method on
the corrosion and mechanical properties of TiN-based coatings by reactive plasma spraying, Applied
Surface Science 255, 2009.
[38] S.V. Hainsworth, N.J. Uhure, Diamond-Like Carbon Coatings for Tribology: production
techniques, characterization methods and application, Review, 2007.

23